BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046E03

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006385204.1|  hypothetical protein POPTR_0003s011002g            157   4e-45   
dbj|BAF01745.1|  putative endomembrane protein EMP70 precusor isolog    156   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140443.1|  uncharacterized protein LOC100272502               155   3e-44   
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    162   2e-43   Nicotiana tomentosiformis
ref|NP_001182857.1|  uncharacterized protein LOC100501115 precursor     155   2e-43   
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3    162   2e-43   Prunus mume [ume]
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    162   2e-43   Nicotiana sylvestris
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             162   2e-43   Phaseolus vulgaris [French bean]
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg             162   2e-43   Prunus persica
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3    162   2e-43   Cucumis melo [Oriental melon]
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    162   2e-43   Pyrus x bretschneideri [bai li]
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg                162   2e-43   Erythranthe guttata [common monkey flower]
gb|KJB12212.1|  hypothetical protein B456_002G006200                    162   2e-43   Gossypium raimondii
ref|XP_002530674.1|  endomembrane protein emp70, putative               162   3e-43   Ricinus communis
emb|CDO97576.1|  unnamed protein product                                162   3e-43   Coffea canephora [robusta coffee]
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg             162   3e-43   Citrus clementina [clementine]
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...    162   3e-43   Sesamum indicum [beniseed]
gb|KDP38816.1|  hypothetical protein JCGZ_04973                         162   3e-43   Jatropha curcas
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    162   3e-43   
gb|KGN57596.1|  hypothetical protein Csa_3G222780                       162   3e-43   Cucumis sativus [cucumbers]
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    162   3e-43   Pyrus x bretschneideri [bai li]
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...    162   3e-43   Citrus sinensis [apfelsine]
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    162   3e-43   Fragaria vesca subsp. vesca
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    161   3e-43   Malus domestica [apple tree]
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...    161   4e-43   
emb|CDY20974.1|  BnaA08g25510D                                          161   4e-43   Brassica napus [oilseed rape]
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    161   4e-43   
gb|KJB77692.1|  hypothetical protein B456_012G151500                    161   4e-43   Gossypium raimondii
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3    161   4e-43   Eucalyptus grandis [rose gum]
ref|XP_007042269.1|  Transmembrane nine 1                               161   4e-43   
emb|CDX94774.1|  BnaC07g17830D                                          161   4e-43   
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    161   4e-43   Arabis alpina [alpine rockcress]
gb|KJB79239.1|  hypothetical protein B456_013G038900                    161   4e-43   Gossypium raimondii
emb|CDX97924.1|  BnaA06g06750D                                          161   4e-43   
emb|CDY34667.1|  BnaC08g42260D                                          161   4e-43   Brassica napus [oilseed rape]
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...    161   4e-43   Nicotiana sylvestris
emb|CDY19333.1|  BnaC05g08420D                                          161   4e-43   Brassica napus [oilseed rape]
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    161   5e-43   Elaeis guineensis
emb|CDY20592.1|  BnaC08g14660D                                          161   5e-43   Brassica napus [oilseed rape]
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...    161   5e-43   Brassica rapa
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    161   5e-43   Glycine max [soybeans]
gb|KJB79238.1|  hypothetical protein B456_013G038900                    162   5e-43   Gossypium raimondii
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg             160   6e-43   Eutrema salsugineum [saltwater cress]
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    161   6e-43   Glycine soja [wild soybean]
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    161   6e-43   Glycine soja [wild soybean]
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1    160   6e-43   Populus euphratica
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    160   6e-43   Glycine max [soybeans]
emb|CDY34861.1|  BnaA09g47870D                                          160   6e-43   Brassica napus [oilseed rape]
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...    160   6e-43   Brassica rapa
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...    160   7e-43   Zea mays [maize]
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    160   7e-43   Phoenix dactylifera
ref|XP_006384984.1|  endomembrane protein 70                            160   7e-43   
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...    160   8e-43   
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1    160   8e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    160   8e-43   Elaeis guineensis
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                    161   8e-43   Gossypium arboreum [tree cotton]
gb|KJB47459.1|  hypothetical protein B456_008G027700                    159   8e-43   Gossypium raimondii
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    160   8e-43   Nicotiana tomentosiformis
gb|KJB47458.1|  hypothetical protein B456_008G027700                    160   8e-43   Gossypium raimondii
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    160   9e-43   Solanum lycopersicum
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...    160   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...    160   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...    160   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg             160   9e-43   Capsella rubella
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          160   9e-43   Sorghum bicolor [broomcorn]
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...    160   9e-43   
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    160   9e-43   Solanum tuberosum [potatoes]
gb|KHG27380.1|  Tm9sf3                                                  160   9e-43   Gossypium arboreum [tree cotton]
ref|NP_563881.1|  transmembrane nine 1                                  160   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233             160   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    160   1e-42   Nicotiana sylvestris
gb|KJB79240.1|  hypothetical protein B456_013G038900                    160   1e-42   Gossypium raimondii
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...    160   1e-42   Elaeis guineensis
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...    160   1e-42   
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg                160   1e-42   Erythranthe guttata [common monkey flower]
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    160   1e-42   Setaria italica
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    159   1e-42   Tarenaya hassleriana [spider flower]
ref|NP_001065897.1|  Os11g0181100                                       160   1e-42   
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...    160   1e-42   Populus euphratica
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...    159   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    159   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...    159   1e-42   Solanum tuberosum [potatoes]
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                    159   1e-42   Triticum urartu
dbj|BAJ96423.1|  predicted protein                                      159   1e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86318.1|  predicted protein                                      159   1e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...    159   1e-42   Camelina sativa [gold-of-pleasure]
gb|AAL07091.2|  putative endomembrane protein EMP70 precusor isolog     159   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3    159   2e-42   Solanum lycopersicum
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    159   2e-42   Brachypodium distachyon [annual false brome]
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1    159   2e-42   Vitis vinifera
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...    159   2e-42   Phoenix dactylifera
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...    159   2e-42   
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    159   2e-42   Elaeis guineensis
dbj|BAJ87519.1|  predicted protein                                      159   2e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3    159   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg             159   3e-42   Eutrema salsugineum [saltwater cress]
emb|CDY03772.1|  BnaC01g28890D                                          158   3e-42   
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...    158   3e-42   Setaria italica
emb|CDY12876.1|  BnaA09g13980D                                          158   3e-42   Brassica napus [oilseed rape]
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g             158   3e-42   Phaseolus vulgaris [French bean]
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...    158   3e-42   Glycine max [soybeans]
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...    158   3e-42   Cicer arietinum [garbanzo]
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...    158   3e-42   Glycine max [soybeans]
emb|CDY54577.1|  BnaCnng27330D                                          158   3e-42   Brassica napus [oilseed rape]
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    158   3e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...    158   3e-42   Brassica rapa
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-42   Glycine max [soybeans]
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                    158   4e-42   Arabis alpina [alpine rockcress]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-42   Glycine max [soybeans]
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-42   
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-42   Phoenix dactylifera
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         158   4e-42   Medicago truncatula
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                    158   4e-42   
ref|XP_006392091.1|  hypothetical protein EUTSA_v10023368mg             158   4e-42   
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-42   Oryza brachyantha
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    158   5e-42   
ref|NP_001066292.1|  Os12g0175700                                       157   5e-42   
emb|CDY54580.1|  BnaCnng27350D                                          157   5e-42   Brassica napus [oilseed rape]
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...    157   5e-42   Zea mays [maize]
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...    157   5e-42   Zea mays [maize]
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...    157   6e-42   Setaria italica
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350          157   6e-42   Amborella trichopoda
ref|XP_001785033.1|  predicted protein                                  155   6e-42   
emb|CAN77106.1|  hypothetical protein VITISV_037096                     159   6e-42   Vitis vinifera
ref|NP_001047104.1|  Os02g0552000                                       157   7e-42   
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...    157   7e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500          157   7e-42   Sorghum bicolor [broomcorn]
gb|AFX67030.1|  endomembrane protein emp70                              155   7e-42   Solanum tuberosum [potatoes]
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...    157   7e-42   Tarenaya hassleriana [spider flower]
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...    157   8e-42   
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    157   9e-42   Solanum tuberosum [potatoes]
emb|CDY33319.1|  BnaAnng04300D                                          159   1e-41   Brassica napus [oilseed rape]
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...    156   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...    157   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    156   1e-41   
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              156   1e-41   
emb|CDY46193.1|  BnaA01g23150D                                          158   1e-41   Brassica napus [oilseed rape]
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    156   1e-41   Solanum lycopersicum
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...    156   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          156   2e-41   Sorghum bicolor [broomcorn]
emb|CDY44834.1|  BnaCnng11900D                                          158   2e-41   Brassica napus [oilseed rape]
ref|XP_009615816.1|  PREDICTED: transmembrane 9 superfamily membe...    147   2e-41   
ref|XP_001785045.1|  predicted protein                                  154   3e-41   
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...    155   3e-41   Sesamum indicum [beniseed]
ref|XP_011092339.1|  PREDICTED: transmembrane 9 superfamily membe...    154   4e-41   
gb|EPS65883.1|  hypothetical protein M569_08888                         153   8e-41   Genlisea aurea
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331             153   1e-40   
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    152   2e-40   Cicer arietinum [garbanzo]
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    152   2e-40   Cicer arietinum [garbanzo]
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...    152   3e-40   Brachypodium distachyon [annual false brome]
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member         151   5e-40   Medicago truncatula
ref|XP_003592977.1|  Transmembrane 9 superfamily protein member         150   6e-40   
ref|NP_001146830.1|  uncharacterized protein LOC100280437               143   1e-39   
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520             147   6e-39   Selaginella moellendorffii
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...    146   1e-38   Sesamum indicum [beniseed]
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    145   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991              142   3e-37   Coccomyxa subellipsoidea C-169
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...    143   3e-36   Solanum tuberosum [potatoes]
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...    140   4e-36   Nicotiana sylvestris
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...    142   6e-36   Solanum lycopersicum
ref|XP_007509634.1|  predicted protein                                  140   9e-36   Bathycoccus prasinos
ref|XP_009631163.1|  PREDICTED: transmembrane 9 superfamily membe...    136   5e-35   
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...    136   6e-35   Nicotiana tomentosiformis
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3               132   3e-34   Auxenochlorella protothecoides
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511              129   2e-33   Chlorella variabilis
gb|KFO35950.1|  Phosphoinositide 3-kinase adapter protein 1             129   2e-33   Fukomys damarensis [Damara mole rat]
gb|KDD76545.1|  endomembrane protein 70                                 127   9e-33   Helicosporidium sp. ATCC 50920
gb|ETN57960.1|  hypothetical protein AND_010453                         125   2e-32   Anopheles darlingi [American malaria mosquito]
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231              124   5e-32   Volvox carteri f. nagariensis
gb|AAX96186.1|  Endomembrane protein 70                                 121   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    124   8e-31   Acanthamoeba castellanii str. Neff
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3               120   1e-30   
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    119   4e-30   Stegastes partitus
gb|KJB47460.1|  hypothetical protein B456_008G027700                    118   4e-30   Gossypium raimondii
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...    118   4e-30   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008057299.1|  PREDICTED: transmembrane 9 superfamily member 3    118   5e-30   Carlito syrichta
emb|CDQ61092.1|  unnamed protein product                                118   5e-30   Oncorhynchus mykiss
ref|XP_005795250.1|  PREDICTED: transmembrane 9 superfamily membe...    118   5e-30   Xiphophorus maculatus
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...    118   5e-30   Maylandia zebra
ref|XP_006630785.1|  PREDICTED: transmembrane 9 superfamily membe...    118   5e-30   Lepisosteus oculatus
ref|XP_008428273.1|  PREDICTED: transmembrane 9 superfamily membe...    118   5e-30   Poecilia reticulata
ref|XP_010779545.1|  PREDICTED: transmembrane 9 superfamily member 3    118   5e-30   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_998554.1|  transmembrane 9 superfamily member 3 precursor        118   5e-30   Danio rerio [leopard danio]
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3    118   5e-30   Latimeria chalumnae
ref|XP_009511961.1|  PREDICTED: transmembrane 9 superfamily member 3    118   5e-30   Phalacrocorax carbo [common cormorant]
ref|XP_007258750.1|  PREDICTED: transmembrane 9 superfamily membe...    118   5e-30   Astyanax mexicanus [blind cave fish]
ref|XP_007566966.1|  PREDICTED: transmembrane 9 superfamily member 3    118   5e-30   Poecilia formosa
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3    118   6e-30   Oreochromis niloticus
ref|XP_006263564.1|  PREDICTED: transmembrane 9 superfamily membe...    118   6e-30   
ref|XP_006157459.1|  PREDICTED: transmembrane 9 superfamily member 3    118   6e-30   
gb|KJB47461.1|  hypothetical protein B456_008G027700                    117   6e-30   Gossypium raimondii
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...    118   6e-30   Pundamilia nyererei
gb|KHG20578.1|  Tm9sf3                                                  117   6e-30   Gossypium arboreum [tree cotton]
ref|XP_003963762.1|  PREDICTED: transmembrane 9 superfamily membe...    118   6e-30   Takifugu rubripes [tiger puffer]
gb|KHG20579.1|  Tm9sf3                                                  117   6e-30   Gossypium arboreum [tree cotton]
dbj|BAB55110.1|  unnamed protein product                                118   6e-30   Homo sapiens [man]
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3    118   6e-30   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008428274.1|  PREDICTED: transmembrane 9 superfamily membe...    118   6e-30   Poecilia reticulata
gb|AAH20959.2|  TM9SF3 protein                                          118   6e-30   Homo sapiens [man]
dbj|BAC11232.1|  unnamed protein product                                118   6e-30   Homo sapiens [man]
ref|XP_007080322.1|  PREDICTED: transmembrane 9 superfamily member 3    118   6e-30   
ref|XP_008773120.1|  PREDICTED: transmembrane 9 superfamily membe...    118   7e-30   
ref|NP_001135200.1|  Transmembrane 9 superfamily member 3 precursor     118   7e-30   Salmo salar
ref|XP_010896390.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Esox lucius
gb|AAF98159.1|AF269150_1  transmembrane protein TM9SF3                  118   7e-30   Homo sapiens [man]
ref|XP_007902753.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Callorhinchus milii [Australian ghost shark]
ref|XP_004580070.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Ochotona princeps [southern American pika]
ref|XP_009951614.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Leptosomus discolor
ref|NP_064508.3|  transmembrane 9 superfamily member 3 precursor        118   7e-30   Homo sapiens [man]
ref|XP_004370030.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Trichechus manatus latirostris
ref|XP_003787418.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   
ref|XP_004892237.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   
ref|XP_004409540.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Odobenus rosmarus divergens
ref|XP_005481354.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   
ref|XP_002821075.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    118   7e-30   Pongo abelii [orang utan]
ref|XP_008830212.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Nannospalax galili
ref|XP_003399780.1|  PREDICTED: transmembrane 9 superfamily membe...    117   7e-30   
ref|XP_004616433.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Sorex araneus [Eurasian shrew]
ref|XP_005312131.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Chrysemys picta bellii
ref|XP_011285801.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   
ref|XP_008942019.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Merops nubicus
ref|XP_006756739.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   
ref|XP_004457032.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Dasypus novemcinctus
ref|XP_002936010.2|  PREDICTED: transmembrane 9 superfamily member 3    117   7e-30   Xenopus tropicalis [western clawed frog]
ref|XP_007637675.1|  PREDICTED: transmembrane 9 superfamily membe...    118   7e-30   
gb|KFU99061.1|  Transmembrane 9 superfamily member 3                    117   7e-30   Pterocles gutturalis
ref|XP_005407637.1|  PREDICTED: transmembrane 9 superfamily membe...    118   7e-30   
ref|XP_007456252.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Lipotes vexillifer [baiji]
ref|XP_010387883.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Rhinopithecus roxellana
gb|AAF21983.1|  SM-11044 binding protein                                118   7e-30   Homo sapiens [man]
ref|XP_008948979.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    118   7e-30   Pan paniscus [bonobo]
ref|XP_009976834.1|  PREDICTED: transmembrane 9 superfamily member 3    117   7e-30   Tauraco erythrolophus
ref|XP_005048681.1|  PREDICTED: transmembrane 9 superfamily member 3    117   7e-30   
ref|XP_421629.4|  PREDICTED: transmembrane 9 superfamily member 3       118   7e-30   
ref|XP_006014905.1|  PREDICTED: transmembrane 9 superfamily member 3    118   7e-30   Alligator sinensis
dbj|BAE91187.1|  unnamed protein product                                118   7e-30   Macaca fascicularis [crab eating macaque]
ref|XP_007615223.1|  PREDICTED: transmembrane 9 superfamily membe...    118   8e-30   
ref|XP_003479606.1|  PREDICTED: transmembrane 9 superfamily member 3    118   8e-30   
gb|EHB07803.1|  Transmembrane 9 superfamily member 3                    117   8e-30   Heterocephalus glaber [naked mole rat]
ref|NP_579930.1|  transmembrane 9 superfamily member 3 precursor        118   8e-30   Mus musculus [mouse]
ref|XP_005407641.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
ref|XP_008142341.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
ref|XP_849773.1|  PREDICTED: transmembrane 9 superfamily member 3...    118   8e-30   Canis lupus familiaris [dogs]
ref|XP_007441347.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
ref|XP_003255319.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
gb|ELR54176.1|  Transmembrane 9 superfamily member 3                    117   8e-30   Bos mutus
ref|XP_008641953.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
ref|XP_007053441.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
ref|XP_005520596.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
ref|XP_009916579.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   Haliaeetus albicilla
gb|AAQ89178.1|  PATY245                                                 117   8e-30   Homo sapiens [man]
ref|XP_004268440.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Orcinus orca [Orca]
ref|XP_006831254.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Chrysochloris asiatica
ref|XP_004838634.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Heterocephalus glaber [naked mole rat]
ref|XP_001101439.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   Macaca mulatta [rhesus macaque]
ref|XP_009470788.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   Nipponia nippon
ref|XP_007187499.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Balaenoptera acutorostrata scammoni
ref|XP_004680642.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Condylura cristata
ref|XP_007532693.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Erinaceus europaeus [common hedgehog]
ref|XP_010409948.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
gb|KFP32607.1|  Transmembrane 9 superfamily member 3                    117   8e-30   Colius striatus
ref|XP_004701094.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004427950.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005637634.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
ref|XP_010018436.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Nestor notabilis
ref|XP_005407639.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
gb|EHH19260.1|  hypothetical protein EGK_19936                          117   8e-30   Macaca mulatta [rhesus macaque]
gb|EPQ19715.1|  Transmembrane 9 superfamily member 3                    117   8e-30   Myotis brandtii
ref|XP_006090050.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Myotis lucifugus
ref|NP_001180146.1|  transmembrane 9 superfamily member 3 precursor     117   8e-30   Bos taurus [bovine]
ref|XP_010712721.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   Meleagris gallopavo [common turkey]
ref|XP_009574595.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Fulmarus glacialis
ref|XP_005352330.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Microtus ochrogaster [prairie voles]
ref|XP_010712722.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   Meleagris gallopavo [common turkey]
ref|XP_009705892.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Cariama cristata
ref|XP_009669621.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Struthio camelus australis
ref|XP_005416571.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   Geospiza fortis
ref|XP_005025241.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
ref|XP_005407638.1|  PREDICTED: transmembrane 9 superfamily membe...    117   8e-30   
ref|XP_004625742.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
gb|KFP68674.1|  Transmembrane 9 superfamily member 3                    117   8e-30   
ref|XP_008932762.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
ref|XP_003223180.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
gb|EDL41855.1|  mCG2375, isoform CRA_b                                  117   8e-30   
gb|AAH04799.2|  Tm9sf3 protein                                          117   8e-30   
ref|XP_005984512.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
ref|XP_005153929.1|  PREDICTED: transmembrane 9 superfamily member 3    117   8e-30   
gb|EMC79922.1|  Transmembrane 9 superfamily member 3                    117   9e-30   
gb|ERE79680.1|  transmembrane 9 superfamily member 3                    117   9e-30   
ref|XP_006116276.1|  PREDICTED: transmembrane 9 superfamily member 3    117   9e-30   
ref|XP_003061693.1|  predicted protein                                  120   9e-30   
ref|XP_004020122.1|  PREDICTED: transmembrane 9 superfamily member 3    117   9e-30   
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3    117   9e-30   
ref|XP_001917123.3|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    117   9e-30   
ref|XP_010969423.1|  PREDICTED: transmembrane 9 superfamily member 3    117   9e-30   
ref|XP_008684538.1|  PREDICTED: transmembrane 9 superfamily member 3    117   9e-30   
ref|XP_009470713.1|  PREDICTED: transmembrane 9 superfamily membe...    117   9e-30   
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                    117   9e-30   
ref|XP_009478867.1|  PREDICTED: transmembrane 9 superfamily member 3    117   9e-30   
ref|XP_001662153.1|  AAEL012016-PA                                      117   9e-30   
dbj|BAD90204.1|  mKIAA4036 protein                                      117   9e-30   
ref|XP_005025240.1|  PREDICTED: transmembrane 9 superfamily membe...    117   1e-29   
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_006992484.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_007654581.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_009966566.1|  PREDICTED: transmembrane 9 superfamily membe...    117   1e-29   
ref|XP_004077569.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
gb|ELK35693.1|  Transmembrane 9 superfamily member 3                    117   1e-29   
ref|XP_002193887.2|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
gb|AAF67014.1|AF160213_1  endomembrane protein emp70 precursor is...    117   1e-29   
ref|XP_005885527.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
dbj|BAG60075.1|  unnamed protein product                                117   1e-29   
emb|CDQ58548.1|  unnamed protein product                                117   1e-29   
ref|XP_001656277.1|  AAEL012833-PA                                      117   1e-29   
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_011259429.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3    116   1e-29   
ref|XP_008520069.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_011155183.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...    117   1e-29   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...    117   1e-29   
ref|XP_011303436.1|  PREDICTED: transmembrane 9 superfamily member 3    117   1e-29   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-29   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-29   
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    116   2e-29   
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-29   
ref|XP_002509072.1|  predicted protein                                  119   2e-29   
ref|XP_004347030.2|  transmembrane protein TM9SF3                       115   3e-29   
gb|AIC62213.1|  TM9SF3                                                  116   3e-29   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3    116   3e-29   
ref|XP_001604363.1|  PREDICTED: transmembrane 9 superfamily membe...    115   4e-29   
ref|XP_008205311.1|  PREDICTED: transmembrane 9 superfamily membe...    115   4e-29   
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3    115   4e-29   
gb|KFP89360.1|  Transmembrane 9 superfamily member 3                    115   4e-29   
ref|XP_009868517.1|  PREDICTED: transmembrane 9 superfamily member 3    115   4e-29   
ref|XP_011499824.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-29   
dbj|BAA91362.1|  unnamed protein product                                115   5e-29   
ref|XP_001698971.1|  EMP/nonaspanin domain family protein               114   7e-29   
gb|EPS62158.1|  hypothetical protein M569_12635                         114   7e-29   
ref|XP_008471864.1|  PREDICTED: transmembrane 9 superfamily membe...    114   7e-29   
ref|XP_002025369.1|  GL11985                                            114   9e-29   
ref|XP_004932208.1|  PREDICTED: transmembrane 9 superfamily membe...    114   9e-29   
gb|KJB77693.1|  hypothetical protein B456_012G151500                    113   9e-29   
ref|XP_001353740.2|  GA10420                                            114   9e-29   
ref|XP_001630700.1|  predicted protein                                  114   9e-29   
ref|XP_008502202.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-28   
ref|XP_009895972.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-28   
ref|XP_008555159.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-28   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-28   
ref|XP_004526831.1|  PREDICTED: transmembrane 9 superfamily membe...    114   1e-28   
dbj|BAD12191.1|  SM-11044 binding protein                               113   2e-28   
gb|EFX85753.1|  hypothetical protein DAPPUDRAFT_313523                  112   2e-28   
gb|EHJ69950.1|  putative endomembrane protein emp70                     112   3e-28   
ref|XP_011431162.1|  PREDICTED: transmembrane 9 superfamily membe...    112   3e-28   
gb|EKC24508.1|  Transmembrane 9 superfamily member 3                    112   3e-28   
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341             112   3e-28   
ref|XP_002035457.1|  GM13907                                            112   4e-28   
ref|XP_002047393.1|  GJ11952                                            112   4e-28   
ref|XP_002093812.1|  GE20545                                            112   4e-28   
gb|KFM73388.1|  Transmembrane 9 superfamily member 3                    112   4e-28   
ref|NP_647979.1|  CG10590                                               112   4e-28   
ref|XP_002062013.1|  GK16877                                            112   4e-28   
ref|XP_001957525.1|  GF10453                                            111   5e-28   
ref|XP_001984443.1|  GH15015                                            111   5e-28   
ref|XP_003737486.1|  PREDICTED: uncharacterized protein LOC100897570    112   5e-28   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...    111   8e-28   
ref|XP_002596465.1|  hypothetical protein BRAFLDRAFT_286243             110   9e-28   
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152              110   1e-27   
ref|XP_004225719.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    110   1e-27   
ref|XP_008868877.1|  hypothetical protein H310_05822                    113   1e-27   
emb|CBN79799.1|  conserved unknown protein                              114   1e-27   
ref|XP_009009848.1|  hypothetical protein HELRODRAFT_184872             110   1e-27   
gb|ETK76717.1|  hypothetical protein, variant 2                         111   2e-27   
gb|ETI36485.1|  hypothetical protein, variant 1                         111   2e-27   
gb|ETK76715.1|  hypothetical protein L915_16929                         111   2e-27   
ref|XP_008895868.1|  hypothetical protein, variant 2                    111   2e-27   
gb|ELU00390.1|  hypothetical protein CAPTEDRAFT_170344                  110   2e-27   
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative     111   2e-27   
ref|XP_008895867.1|  hypothetical protein PPTG_03848                    111   2e-27   
ref|XP_001972005.1|  GG14121                                            110   2e-27   
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515             111   2e-27   
gb|ETI36484.1|  hypothetical protein F443_17408                         111   2e-27   
ref|XP_002007870.1|  GI13177                                            109   2e-27   
gb|EDL41854.1|  mCG2375, isoform CRA_a                                  117   2e-27   
gb|ELW49306.1|  Transmembrane 9 superfamily member 3                    118   3e-27   
ref|XP_010732838.1|  PREDICTED: transmembrane 9 superfamily member 3    118   4e-27   
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884              108   6e-27   
gb|EEZ99577.1|  hypothetical protein TcasGA2_TC001563                   110   6e-27   
ref|XP_002426886.1|  conserved hypothetical protein                     109   6e-27   
ref|XP_967117.1|  PREDICTED: transmembrane 9 superfamily member 3       110   7e-27   
ref|XP_009827098.1|  hypothetical protein, variant                      108   9e-27   
emb|CDY14555.1|  BnaC03g49040D                                          106   9e-27   
ref|XP_002156433.1|  PREDICTED: transmembrane 9 superfamily membe...    107   1e-26   
ref|XP_008614772.1|  hypothetical protein SDRG_10554                    108   1e-26   
ref|XP_785201.2|  PREDICTED: transmembrane 9 superfamily member 3       107   1e-26   
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative         107   1e-26   
gb|KDR11018.1|  hypothetical protein L798_14383                         107   1e-26   
ref|XP_004622652.1|  PREDICTED: transmembrane 9 superfamily membe...    108   2e-26   
gb|EWM22128.1|  transmembrane 9 superfamily member 3                    105   2e-26   
gb|AEE63341.1|  unknown                                                 108   3e-26   
gb|ENN73181.1|  hypothetical protein YQE_10235                          108   3e-26   
ref|XP_006819376.1|  PREDICTED: transmembrane 9 superfamily membe...    105   4e-26   
gb|KDO15767.1|  hypothetical protein SPRG_18692                         106   5e-26   
ref|XP_004990450.1|  endomembrane protein emp70                         105   8e-26   
gb|KDO27371.1|  hypothetical protein SPRG_06957                         105   1e-25   
emb|CDW55076.1|  Transmembrane 9 superfamily                            107   1e-25   
emb|CDS34226.1|  Transmembrane 9 superfamily                            102   2e-25   
ref|XP_001746206.1|  hypothetical protein                               102   3e-25   
dbj|GAA29282.2|  transmembrane 9 superfamily member 3                   103   4e-25   
emb|CCA19624.1|  endomembrane protein 70like protein putative           103   4e-25   
emb|CCI39563.1|  unnamed protein product                                103   4e-25   
emb|CCI39562.1|  unnamed protein product                                103   5e-25   
ref|XP_009173090.1|  hypothetical protein T265_08898                    102   5e-25   
emb|CDS07558.1|  hypothetical protein LRAMOSA01507                    99.8    2e-24   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                  99.8    2e-24   
gb|ERG85277.1|  transmembrane 9 superfamily member 3                  99.8    2e-24   
ref|XP_005768973.1|  hypothetical protein EMIHUDRAFT_60571            97.4    6e-24   
gb|EYB86903.1|  hypothetical protein Y032_0271g885                    97.8    7e-24   
emb|CEJ05344.1|  hypothetical protein RMCBS344292_19287               99.4    7e-24   
gb|EYB86904.1|  hypothetical protein Y032_0271g885                    97.8    8e-24   
gb|EYB86905.1|  hypothetical protein Y032_0271g885                    97.4    8e-24   
ref|NP_500130.1|  Protein Y41D4A.4                                    97.1    1e-23   
emb|CDH93341.1|  Y41D4A.4, isoform c                                  97.1    1e-23   
emb|CDH93340.1|  Y41D4A.4, isoform b                                  97.1    1e-23   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                    97.1    1e-23   
emb|CEJ03838.1|  hypothetical protein RMCBS344292_17813               98.6    1e-23   
emb|CEG68095.1|  hypothetical protein RMATCC62417_04417               98.6    1e-23   
emb|CDQ00788.1|  Protein Bm6514, isoform c                            96.7    2e-23   
gb|EJW85205.1|  endomembrane protein emp70                            96.7    2e-23   
emb|CEG80626.1|  hypothetical protein RMATCC62417_14930               98.2    2e-23   
ref|XP_003094144.1|  hypothetical protein CRE_13729                   95.9    3e-23   
ref|XP_002634585.1|  Hypothetical protein CBG08396                    95.9    3e-23   
emb|CDI96724.1|  Transmembrane 9 superfamily                          93.6    1e-22   
emb|CDS23908.1|  Transmembrane 9 superfamily                          93.6    1e-22   
gb|EPB84661.1|  hypothetical protein HMPREF1544_08604                 95.1    2e-22   
ref|XP_003143038.1|  endomembrane protein emp70                       93.6    2e-22   
emb|CEP16327.1|  hypothetical protein                                 94.7    2e-22   
gb|EUB64714.1|  Transmembrane 9 superfamily member                      105   2e-22   
ref|XP_002679262.1|  predicted protein                                93.2    3e-22   
gb|EEE57172.1|  hypothetical protein OsJ_07106                        90.5    7e-22   
gb|EIE90684.1|  hypothetical protein RO3G_15395                       92.8    9e-22   
gb|KFP99383.1|  Transmembrane 9 superfamily member 3                  90.9    9e-22   
gb|KFZ51498.1|  Transmembrane 9 superfamily member 3                  90.9    1e-21   
gb|KFQ54713.1|  Transmembrane 9 superfamily member 3                  90.9    1e-21   
gb|KFQ32916.1|  Transmembrane 9 superfamily member 3                  90.9    1e-21   
gb|KFV52836.1|  Transmembrane 9 superfamily member 3                  90.9    1e-21   
gb|KFW76816.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFV91617.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFO94520.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
ref|XP_001950058.1|  PREDICTED: transmembrane 9 superfamily member 3  90.5    1e-21   
gb|KFV79427.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFM06419.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|ERE79681.1|  transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFQ90694.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFP38896.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFO54227.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|EMP41799.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|EFB24098.1|  hypothetical protein PANDA_005202                     90.5    1e-21   
dbj|BAE27875.1|  unnamed protein product                              90.5    1e-21   
gb|EOA97287.1|  Transmembrane 9 superfamily member 3                  90.5    1e-21   
gb|KFU99734.1|  Transmembrane 9 superfamily member 3                  90.1    2e-21   
ref|XP_314301.3|  AGAP004882-PA                                       89.7    2e-21   
ref|XP_007122871.1|  PREDICTED: transmembrane 9 superfamily membe...  89.4    3e-21   
ref|XP_004320666.1|  PREDICTED: transmembrane 9 superfamily member 3  88.6    5e-21   
ref|XP_006749965.1|  PREDICTED: transmembrane 9 superfamily member 3  88.6    6e-21   
gb|ADE75730.1|  unknown                                               91.7    2e-20   
gb|KFV65167.1|  Transmembrane 9 superfamily member 3                  86.7    2e-20   
ref|XP_006679870.1|  hypothetical protein BATDEDRAFT_25752            86.7    2e-20   
ref|XP_002290902.1|  endomembrane protein EMP70 precusor              92.4    9e-20   
emb|CBY17963.1|  unnamed protein product                              85.5    1e-19   
gb|KFH64844.1|  hypothetical protein MVEG_09573                       88.2    1e-19   
ref|XP_002083749.1|  GD13184                                          97.4    1e-19   
gb|KHJ41501.1|  endomembrane protein 70                               86.7    2e-19   
ref|XP_002178644.1|  predicted protein                                90.5    2e-19   
gb|KFD51698.1|  hypothetical protein M513_07394                       84.3    7e-19   
gb|KFP08579.1|  Transmembrane 9 superfamily member 3                  79.7    2e-18   
ref|XP_002784348.1|  conserved hypothetical protein                   84.3    2e-18   
emb|CEF59928.1|  Nonaspanin (TM9SF) family-containing protein         78.6    4e-18   
gb|KFH41823.1|  Transmembrane 9 superfamily member-like protein       81.3    1e-16   
dbj|GAD95703.1|  multispanning membrane protein                       84.7    1e-16   
emb|CBK19843.2|  unnamed protein product                              86.7    5e-16   
ref|XP_003009674.1|  endomembrane protein EMP70                       77.0    3e-15   
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...  80.1    3e-15   
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...  80.1    3e-15   
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...  79.7    3e-15   
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...  79.7    3e-15   
ref|XP_001963658.1|  GF20175                                          79.3    4e-15   
emb|CBK24710.2|  unnamed protein product                              77.0    5e-15   
ref|XP_006694176.1|  hypothetical protein CTHT_0037530                75.9    7e-15   
ref|XP_003657042.1|  hypothetical protein THITE_2122394               75.1    9e-15   
ref|XP_008895869.1|  hypothetical protein, variant 3                  68.2    1e-14   
gb|ETK76718.1|  hypothetical protein, variant 3                       68.2    1e-14   
ref|XP_001899401.1|  Transmembrane 9 superfamily protein member 3...  66.6    1e-14   
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...  77.4    1e-14   
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...  77.4    2e-14   
gb|ETI36486.1|  hypothetical protein, variant 2                       67.8    2e-14   
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...  77.0    2e-14   
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...  77.0    2e-14   
gb|KHG03505.1|  Putative phagocytic receptor 1b                       75.5    3e-14   



>ref|XP_006385204.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
 gb|ERP63001.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
Length=113

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -1

Query  576  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  397
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  1    VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  60

Query  396  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            +YVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  61   FYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  113



>dbj|BAF01745.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=136

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  23   KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  82

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  83   YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  136



>ref|NP_001140443.1| uncharacterized protein LOC100272502 [Zea mays]
 gb|ACF83850.1| unknown [Zea mays]
Length=125

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  12   KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  71

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  72   YYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  125



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   162 bits (411),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|NP_001182857.1| uncharacterized protein LOC100501115 precursor [Zea mays]
 gb|ACR34922.1| unknown [Zea mays]
Length=195

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIY
Sbjct  82   KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIY  141

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  142  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  195



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score =   162 bits (410),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYHAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   162 bits (410),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588


 Score = 40.4 bits (93),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score =   162 bits (410),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  517  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  576

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  577  YYFVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  630


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  497  LPFGSIFIEMYFVFTSFWNYK  517



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score =   162 bits (410),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score =   162 bits (409),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY YSIY
Sbjct  519  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYFYSIY  578

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  579  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  632


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  499  LPFGSIFIEMYFVFTSFWNYK  519



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   162 bits (409),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score =   162 bits (409),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  470  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score =   162 bits (410),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYS+Y
Sbjct  479  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSVY  538

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+GFLGSNLFVRRIYRNIKCD
Sbjct  539  YYSVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGFLGSNLFVRRIYRNIKCD  592


 Score = 40.4 bits (93),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  459  LPFGSIFIEMYFVFTSFWNYK  479



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  489  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  548

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  549  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  602


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  469  LPFGSIFIEMYFVFTSFWNYK  489



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  470  KVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/114 (98%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  483  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  542

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  543  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  596


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  463  LPFGSIFIEMYFVFTSFWNYK  483



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY YSIY
Sbjct  551  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYFYSIY  610

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  611  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  664


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  531  LPFGSIFIEMYFVFTSFWNYK  551



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   162 bits (409),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  485  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  544

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  545  YYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  598


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  465  LPFGSIFIEMYFVFTSFWNYK  485



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score =   161 bits (408),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY YSIY
Sbjct  480  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYFYSIY  539

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  593


 Score = 40.8 bits (94),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  460  LPFGSIFIEMYFVFTSFWNYK  480



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  532  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVY YSIY
Sbjct  636  KVYYVYGFMLLVFMILMIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAFYVYFYSIY  695

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY+KTKMSGFFQ SFYFGYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  696  YYYMKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  749


 Score = 40.8 bits (94),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  616  LPFGSIFIEMYFVFTSFWNYK  636



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYS+Y
Sbjct  479  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSVY  538

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  592


 Score = 40.8 bits (94),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  459  LPFGSIFIEMYFVFTSFWNYK  479



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  585


 Score = 40.4 bits (93),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  527  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  586

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  587  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  640


 Score = 40.4 bits (93),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  507  LPFGSIFIEMYFVFTSFWNYK  527



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  532  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>gb|KJB79239.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=461

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  348  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  407

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  408  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  461



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  477  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590


 Score = 40.4 bits (93),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  552  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  611

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  612  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  665


 Score = 40.4 bits (93),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  532  LPFGSIFIEMYFVFTSFWNYK  552



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IY
Sbjct  469  KVYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIY  528

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  529  YYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582


 Score = 40.4 bits (93),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  449  LPFGSIFIEMYFVFTSFWNYK  469



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score =   161 bits (408),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587


 Score = 40.4 bits (93),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score =   161 bits (407),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  473  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  533  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score =   161 bits (407),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  532  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585


 Score = 40.4 bits (93),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score =   161 bits (407),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  477  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590


 Score = 40.4 bits (93),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score =   161 bits (407),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  472  KVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  585


 Score = 40.4 bits (93),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score =   162 bits (409),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  480  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  539

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  593


 Score = 40.0 bits (92),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  460  LPFGSIFIEMYFIFTSFWNYK  480



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score =   160 bits (406),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  473  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score =   161 bits (407),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  471  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  530

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  584


 Score = 40.8 bits (94),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  451  LPFGSIFIEMYFVFTSFWNYK  471



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score =   161 bits (407),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  470  KVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583


 Score = 40.4 bits (93),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score =   160 bits (406),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  477  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  537  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score =   160 bits (406),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  471  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  530

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  584


 Score = 40.4 bits (93),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  451  LPFGSIFIEMYFVFTSFWNYK  471



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score =   160 bits (406),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  473  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  586


 Score = 40.4 bits (93),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score =   160 bits (406),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  532  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585


 Score = 40.4 bits (93),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score =   160 bits (405),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  473  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  533  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score =   160 bits (405),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  473  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  533  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score =   160 bits (405),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  473  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  533  YYSVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score =   160 bits (405),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  473  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  533  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   160 bits (405),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 114/114 (100%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  477  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKM+GFFQ+SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIY+NIKCD
Sbjct  537  YYHVKTKMTGFFQISFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYKNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score =   160 bits (406),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  473  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  533  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  586


 Score = 40.4 bits (93),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score =   161 bits (407),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  474  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587


 Score = 40.0 bits (92),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWNYK  474



>gb|KJB47459.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=400

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YS+Y
Sbjct  287  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYMYSVY  346

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  347  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  400



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   160 bits (405),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score =   160 bits (405),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YS+Y
Sbjct  477  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYMYSVY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  590


 Score = 40.4 bits (93),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   160 bits (405),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSF SAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFSSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   160 bits (405),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  475  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score =   160 bits (405),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score =   160 bits (405),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score =   160 bits (404),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score =   160 bits (404),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  477  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  537  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score =   160 bits (404),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  468  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  527

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  528  YYNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  581


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  448  LPFGSIFIEMYFVFTSFWNYK  468



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   160 bits (405),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSF SAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFSSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score =   160 bits (405),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  501  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  560

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  561  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  614


 Score = 40.4 bits (93),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  481  LPFGSIFIEMYFVFTSFWNYK  501



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  475  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score =   160 bits (406),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  478  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  591


 Score = 39.7 bits (91),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  458  LPFGSIFIEMYFIFTSFWNYK  478



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  YYNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  470  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  530  YYHMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST++YVYLYSIY
Sbjct  470  KVYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSLYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFC+GLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YYYVKTKMSGFFQTSFYFGYTLMFCMGLGILCGAVGYLGSNLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  473  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  533  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  479  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  538

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  539  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  592


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  459  LPFGSIFIEMYFVFTSFWNYK  479



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  480  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  539

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  540  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  593


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  460  LPFGSIFIEMYFVFTSFWNYK  480



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score =   160 bits (404),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  480  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  539

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  540  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  593


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  460  LPFGSIFIEMYFVFTSFWNYK  480



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IY
Sbjct  472  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  532  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHW+WTSFFSAASTA+YVYLY+IY
Sbjct  469  KVYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENYHWRWTSFFSAASTALYVYLYAIY  528

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  529  YYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  449  LPFGSIFIEMYFVFTSFWNYK  469



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IY
Sbjct  458  KVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIY  517

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  518  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  571


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  438  LPFGSIFIEMYFVFTSFWNYK  458



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IY
Sbjct  472  KVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  532  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IY
Sbjct  472  KVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  532  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587


 Score = 40.4 bits (93),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>gb|AAL07091.2| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=461

 Score =   159 bits (403),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  348  KVYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  407

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  408  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  461


 Score = 40.8 bits (94),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  328  LPFGSIFIEMYFVFTSFWNYK  348



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score =   159 bits (403),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHW+WTSFFSAASTA+YVYLY+IY
Sbjct  469  KVYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENYHWRWTSFFSAASTALYVYLYAIY  528

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  529  YYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582


 Score = 40.8 bits (94),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  449  LPFGSIFIEMYFVFTSFWNYK  469



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score =   159 bits (402),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  481  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  540

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  541  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  594


 Score = 40.8 bits (94),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  461  LPFGSIFIEMYFVFTSFWNYK  481



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   159 bits (402),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  479  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  538

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  539  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  592


 Score = 40.4 bits (93),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  459  LPFGSIFIEMYFVFTSFWNYK  479



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   159 bits (402),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  445  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  504

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  505  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  558


 Score = 40.8 bits (94),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  425  LPFGSIFIEMYFVFTSFWNYK  445



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score =   159 bits (402),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  503  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  562

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  563  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  616


 Score = 40.8 bits (94),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  483  LPFGSIFIEMYFVFTSFWNYK  503



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score =   159 bits (401),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  473  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  533  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   159 bits (401),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  482  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  541

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  542  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  595


 Score = 40.8 bits (94),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  462  LPFGSIFIEMYFVFTSFWNYK  482



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score =   159 bits (401),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  478  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  538  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  591


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score =   159 bits (401),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  478  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  591


 Score = 40.4 bits (93),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  481  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIY  540

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  541  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  594


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  461  LPFGSIFIEMYFVFTSFWNYK  481



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  484  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  543

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  544  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  597


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  464  LPFGSIFIEMYFVFTSFWNYK  484



>emb|CDY12876.1| BnaA09g13980D [Brassica napus]
Length=564

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  451  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  510

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  511  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  564


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  431  LPFGSIFIEMYFVFTSFWNYK  451



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST+VYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY+KTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYYMKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  534  YFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST+VYVYLYSIY
Sbjct  478  KVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSVYVYLYSIY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  YYYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  591


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  477  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>emb|CDY54577.1| BnaCnng27330D [Brassica napus]
Length=513

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  400  KVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  459

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  460  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  513


 Score = 40.4 bits (93),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  380  LPFGSIFIEMYFVFTSFWNYK  400



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  482  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIY  541

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  542  YYHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSKLFVRRIYRNIKCD  595


 Score = 40.8 bits (94),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  462  LPFGSIFIEMYFVFTSFWNYK  482



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score =   158 bits (400),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  481  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  540

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  541  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  594


 Score = 40.4 bits (93),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  461  LPFGSIFIEMYFVFTSFWNYK  481



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  474  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  534  YFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score =   158 bits (400),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YSIY
Sbjct  482  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYIYSIY  541

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  542  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  595


 Score = 40.4 bits (93),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  462  LPFGSIFIEMYFVFTSFWNYK  482



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/114 (97%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  477  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YFYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  514  KVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  573

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  574  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  627


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  494  LPFGSIFIEMYFVFTSFWNYK  514



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   158 bits (400),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYV+LYSIY
Sbjct  474  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVFLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  478  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS  FVRRIYRNIKCD
Sbjct  538  YYNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTFFVRRIYRNIKCD  591


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST+VYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  439  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  498

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  499  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  552


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  419  LPFGSIFIEMYFVFTSFWNYK  439



>ref|XP_006392091.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29377.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=471

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  358  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  417

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  418  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  471


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  338  LPFGSIFIEMYFVFTSFWNYK  358



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score =   158 bits (399),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIY
Sbjct  467  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFLSAASTALYVYLYSIY  526

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  527  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  580


 Score = 40.8 bits (94),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  447  LPFGSIFIEMYFVFTSFWNYK  467



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score =   158 bits (399),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  457  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  516

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  517  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  570


 Score = 40.8 bits (94),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  437  LPFGSIFIEMYFVFTSFWNYK  457



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score =   157 bits (398),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIY
Sbjct  485  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFLSAASTALYVYLYSIY  544

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  545  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  598


 Score = 40.8 bits (94),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  465  LPFGSIFIEMYFVFTSFWNYK  485



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score =   157 bits (398),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  476  KVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589


 Score = 40.4 bits (93),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  456  LPFGSIFIEMYFVFTSFWNYK  476



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score =   157 bits (398),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  532  YYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score =   157 bits (398),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  475  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  YYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score =   157 bits (397),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  532  YYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score =   157 bits (397),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  477  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ  FYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  537  YYYVKTKMSGFFQTGFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_001785033.1| predicted protein [Physcomitrella patens]
 gb|EDQ50148.1| predicted protein, partial [Physcomitrella patens]
Length=325

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL IVTVCVTIVGTYFLLNAENYHWQWTSF SAASTA YVYLYS+Y
Sbjct  212  KVYYVYGFMLLVFIILTIVTVCVTIVGTYFLLNAENYHWQWTSFLSAASTAGYVYLYSVY  271

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+Y+KTKMSGFFQ+SFYFGYTLMFCLGLGI CGAVG+LGS++FVRRIYRNIKCD
Sbjct  272  YFYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGYLGSSMFVRRIYRNIKCD  325



>emb|CAN77106.1| hypothetical protein VITISV_037096 [Vitis vinifera]
Length=600

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            +VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVY YSIY
Sbjct  487  EVYYVYGFMLLVFMILMIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAFYVYFYSIY  546

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY+KTKMSGFFQ SFYFGYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  547  YYYMKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  600



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score =   157 bits (397),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  477  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  537  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  590


 Score = 40.8 bits (94),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   157 bits (397),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSF SAASTAVYVYLYS+Y
Sbjct  478  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFLSAASTAVYVYLYSVY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  538  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  591


 Score = 40.8 bits (94),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score =   157 bits (397),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  472  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  532  YYHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585


 Score = 40.8 bits (94),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  452  LPFGSIFIEMYFVFTSFWNYK  472



>gb|AFX67030.1| endomembrane protein emp70, partial [Solanum tuberosum]
Length=346

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSA STAVYVYLYS+Y
Sbjct  233  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAFSTAVYVYLYSVY  292

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  293  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  346



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score =   157 bits (397),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVT+CVTIVG+YFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  478  KVYYVYGFMLLVFLILVIVTICVTIVGSYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS+LF+RRIYRNIKCD
Sbjct  538  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSSLFIRRIYRNIKCD  591


 Score = 40.8 bits (94),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score =   157 bits (396),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  455  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  514

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  515  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  568


 Score = 40.8 bits (94),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  435  LPFGSIFIEMYFVFTSFWNYK  455



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   157 bits (396),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSA STAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAFSTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>emb|CDY33319.1| BnaAnng04300D [Brassica napus]
Length=544

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  431  KVYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  490

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  491  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  544



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score =   156 bits (395),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVG YFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIIVTMCVTIVGAYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY+KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  535  YYYMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_010272575.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nelumbo 
nucifera]
Length=466

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            +VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  353  QVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIY  412

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  413  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  466



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score =   156 bits (395),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIY
Sbjct  483  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIY  542

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  543  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  596


 Score = 40.4 bits (93),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  463  LPFGSIFIEMYFVFTSFWNYK  483



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score =   156 bits (395),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIY
Sbjct  479  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIY  538

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  539  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  592


 Score = 40.8 bits (94),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  459  LPFGSIFIEMYFVFTSFWNYK  479



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  462  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  521

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  522  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  575



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   156 bits (394),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSA STAVYVYLYS+Y
Sbjct  475  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAFSTAVYVYLYSVY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score =   156 bits (394),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVG YFLLNAENYHWQWTSFFSAASTAVYVYLYS+Y
Sbjct  522  KVYYVYGFMLLVFLILIIVTMCVTIVGAYFLLNAENYHWQWTSFFSAASTAVYVYLYSVY  581

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYY+KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  582  YYYMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  635


 Score = 40.8 bits (94),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  502  LPFGSIFIEMYFVFTSFWNYK  522



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score =   156 bits (394),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIY
Sbjct  481  KVYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIY  540

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  541  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  594


 Score = 40.8 bits (94),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  461  LPFGSIFIEMYFVFTSFWNYK  481



>emb|CDY44834.1| BnaCnng11900D [Brassica napus]
Length=547

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/114 (96%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  434  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  493

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  494  YYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  547



>ref|XP_009615816.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=106

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = -1

Query  501  GTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCL  322
            GTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYT+MFCL
Sbjct  19   GTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCL  78

Query  321  GLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            GLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  79   GLGILCGAVGYLGSNLFVRRIYRNIKCD  106



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   154 bits (390),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL IVTVCVTIVGTYFLLNAENYHWQWTSF SAASTA YVYLYS+Y
Sbjct  477  KVYYVYGFMLLVFIILTIVTVCVTIVGTYFLLNAENYHWQWTSFLSAASTAGYVYLYSVY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+Y+KTKMSGFFQ+SFYFGYTLMFCLGLGI CGAVG+LGS++FVRRIYRNIKCD
Sbjct  537  YFYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGYLGSSMFVRRIYRNIKCD  590


 Score = 41.2 bits (95),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW+ +
Sbjct  457  LPFGSIFIEMYFVFTSFWQYK  477



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   155 bits (391),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIV  YFLLNAENYHWQWTSFFSAASTAVYVY YSIY
Sbjct  475  KVYYVYGFMLLVFLILIIVTVCVTIVSIYFLLNAENYHWQWTSFFSAASTAVYVYFYSIY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSG FQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  535  YYYVKTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_011092339.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Sesamum 
indicum]
Length=460

 Score =   154 bits (390),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIV  YFLLNAENYHWQWTSFFSAASTAVYVY YSIY
Sbjct  347  KVYYVYGFMLLVFLILIIVTVCVTIVSIYFLLNAENYHWQWTSFFSAASTAVYVYFYSIY  406

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSG FQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  407  YYYVKTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  460


 Score = 40.8 bits (94),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  327  LPFGSIFIEMYFVFTSFWNYK  347



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score =   153 bits (387),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YV  YS+Y
Sbjct  445  KVYYVYGFMLLVFVILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVLFYSVY  504

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS+LFV+RIYRNIK D
Sbjct  505  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSDLFVKRIYRNIKLD  558


 Score = 40.8 bits (94),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  425  LPFGSIFIEMYFVFTSFWNYK  445



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score =   153 bits (386),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVYLYS+Y
Sbjct  474  KVYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAAYVYLYSVY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLM C+GLG LCGAVG+LGS++FVRRIYRNIKCD
Sbjct  534  YYFMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGYLGSSVFVRRIYRNIKCD  587


 Score = 40.8 bits (94),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score =   152 bits (384),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIY
Sbjct  470  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  530  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score =   152 bits (384),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIY
Sbjct  470  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  530  YYYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score =   152 bits (383),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  475  KVYYVYGFMLLVFLILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  YYNVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  588


 Score = 40.8 bits (94),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  455  LPFGSIFIEMYFVFTSFWNYK  475



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score =   151 bits (381),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIY
Sbjct  470  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  530  YYYVKTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583


 Score = 40.8 bits (94),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>ref|XP_003592977.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=446

 Score =   150 bits (380),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIY
Sbjct  333  KVYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIY  392

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YYYVKTKMSGFFQ SFYFGYT MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  393  YYYVKTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  446


 Score = 40.8 bits (94),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  313  LPFGSIFIEMYFVFTSFWNYK  333



>ref|NP_001146830.1| uncharacterized protein LOC100280437 [Zea mays]
 gb|ACL54836.1| unknown [Zea mays]
Length=106

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  501  GTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCL  322
            GTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCL
Sbjct  19   GTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCL  78

Query  321  GLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            GLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  79   GLGILCGAIGYLGSTLFVRRIYRNIKCD  106



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score =   147 bits (371),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVYLYS+Y
Sbjct  473  KVYYVYGFMLLVFLILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAAYVYLYSVY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY++KTKMSGFFQ SFYFGYTLM C+GLG LCGAVG+LGS++FVRRIYRNIKCD
Sbjct  533  YYFMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGYLGSSVFVRRIYRNIKCD  586


 Score = 40.8 bits (94),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  453  LPFGSIFIEMYFVFTSFWNYK  473



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score =   146 bits (369),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 5/114 (4%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGT     AENYHWQWTSFFSAASTA+YVY YSIY
Sbjct  470  KVYYVYGFMLLVFVILIIVTICVTIVGT-----AENYHWQWTSFFSAASTALYVYFYSIY  524

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  525  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  578


 Score = 40.8 bits (94),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  450  LPFGSIFIEMYFVFTSFWNYK  470



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score =   145 bits (366),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 6/120 (5%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYF------LLNAENYHWQWTSFFSAASTAvyv  418
            KVYYVYGFMLLVFLIL++VTVCVTIVGTYF      LLNAENY+WQWTSF SAASTAVYV
Sbjct  479  KVYYVYGFMLLVFLILVVVTVCVTIVGTYFAXXXXXLLNAENYNWQWTSFLSAASTAVYV  538

Query  417  ylysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YLYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVG++GSNLFVRRIYRNIKCD
Sbjct  539  YLYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGYMGSNLFVRRIYRNIKCD  598


 Score = 40.8 bits (94),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  459  LPFGSIFIEMYFVFTSFWNYK  479



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score =   142 bits (358),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL I+TVCVTIVGTYFLLNAENYHWQWTSF +AASTA+YV+LY+++
Sbjct  497  KVYYVYGFMLLVFLILAIMTVCVTIVGTYFLLNAENYHWQWTSFCAAASTALYVFLYAVH  556

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y++VKTKM+GFFQ  FYFGYTLMFCLGL I+ GA+G+LGS +FVRRIYRNIKCD
Sbjct  557  YFFVKTKMTGFFQTCFYFGYTLMFCLGLSIMTGALGYLGSAIFVRRIYRNIKCD  610


 Score = 40.0 bits (92),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  477  LPFGSIFIEMYFIFTSFWNYK  497



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -1

Query  573  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  394
            YYVYGF+LLVF++LIIVTVCVTIVGTY+LLNAENYHWQWTSFFSAASTA+YVYLY+IYYY
Sbjct  473  YYVYGFLLLVFIVLIIVTVCVTIVGTYYLLNAENYHWQWTSFFSAASTALYVYLYAIYYY  532

Query  393  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            + KT MSG  Q SFYFGYTLMFCLG+GILCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  533  HAKTSMSGLLQTSFYFGYTLMFCLGVGILCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score =   140 bits (352),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  573  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  394
            Y+VYGFMLLVF+ILIIVTVCVTIV TYFLLNAENYHWQWTSFFSAASTA YVYLYSIYYY
Sbjct  472  YHVYGFMLLVFIILIIVTVCVTIVATYFLLNAENYHWQWTSFFSAASTAFYVYLYSIYYY  531

Query  393  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y KT+M G FQ S YFGYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  532  YAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  583


 Score = 38.5 bits (88),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFW  588
            LPFGSIFIEMYF+F+SFW
Sbjct  449  LPFGSIFIEMYFIFSSFW  466



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -1

Query  573  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  394
            YYVYGF+LLVF++LIIVT+CVTIVGTY+LLNAENY+WQWTSFFSAASTA+YVYLY+IYYY
Sbjct  473  YYVYGFLLLVFIVLIIVTICVTIVGTYYLLNAENYNWQWTSFFSAASTALYVYLYAIYYY  532

Query  393  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            + KTKMSG  Q SFYFGYTLMFCLG+GILCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  533  HSKTKMSGLLQTSFYFGYTLMFCLGVGILCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score =   140 bits (354),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGF LLVF+IL+IVT+CVT+VGTYFLLNAENYHW WTSF SAASTA YVY+YSIY
Sbjct  516  KVYYVYGFFLLVFMILMIVTLCVTVVGTYFLLNAENYHWHWTSFISAASTAFYVYVYSIY  575

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+  KTKM+GFFQ  FYFGYT MFCLGLG++CGAVG+ G+N FVRRIYRNIKCD
Sbjct  576  YFIFKTKMTGFFQTCFYFGYTAMFCLGLGLMCGAVGYFGANAFVRRIYRNIKCD  629


 Score = 36.6 bits (83),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIE YFVFTS W  +
Sbjct  496  LPFGSIFIETYFVFTSIWNYK  516



>ref|XP_009631163.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=468

 Score =   136 bits (343),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  573  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  394
            Y+VYGFMLLVF+ILIIVTVCVTIV TYFLL+AENYHWQWTSF+SAASTA YVYLYSIYYY
Sbjct  357  YHVYGFMLLVFIILIIVTVCVTIVATYFLLSAENYHWQWTSFYSAASTACYVYLYSIYYY  416

Query  393  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y KT+M G FQ S YFGYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  417  YAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  468


 Score = 38.5 bits (88),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFW  588
            LPFGSIFIEMYF+F+SFW
Sbjct  334  LPFGSIFIEMYFIFSSFW  351



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score =   136 bits (343),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -1

Query  573  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  394
            Y+VYGFMLLVF+ILIIVTVCVTIV TYFLL+AENYHWQWTSF+SAASTA YVYLYSIYYY
Sbjct  472  YHVYGFMLLVFIILIIVTVCVTIVATYFLLSAENYHWQWTSFYSAASTACYVYLYSIYYY  531

Query  393  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y KT+M G FQ S YFGYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  532  YAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  583


 Score = 38.5 bits (88),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 16/18 (89%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFW  588
            LPFGSIFIEMYF+F+SFW
Sbjct  449  LPFGSIFIEMYFIFSSFW  466



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGF LLVFLILIIVT+CVTIV +YFLLNAENYHW WTSF + AST++YV+LYS++
Sbjct  478  KVYYVYGFFLLVFLILIIVTICVTIVASYFLLNAENYHWHWTSFGAGASTSLYVFLYSVH  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y++ KTKM+GFFQ +FYFGYTLMFC+GL ++CGAVG LG+ +FVRRIYRNIKCD
Sbjct  538  YFFWKTKMTGFFQTAFYFGYTLMFCVGLSVMCGAVGHLGAGVFVRRIYRNIKCD  591


 Score = 40.8 bits (94),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  458  LPFGSIFIEMYFVFTSFWNYK  478



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score =   129 bits (325),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGF LLVFLIL+IVTVCVTIVGTYFLLNAENYHW WT+F + AST++YV LYS++
Sbjct  476  KVYYVYGFFLLVFLILLIVTVCVTIVGTYFLLNAENYHWHWTAFSAGASTSLYVMLYSVH  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+ +KTKM+GFFQ +FYFGYTLMFCLGL I+CGA+G+LGS  FVRRI+RN+K D
Sbjct  536  YFVMKTKMTGFFQTAFYFGYTLMFCLGLSIMCGAIGYLGSLAFVRRIFRNVKVD  589


 Score = 40.0 bits (92),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  456  LPFGSIFIEMYFIFTSFWNYK  476



>gb|KFO35950.1| Phosphoinositide 3-kinase adapter protein 1 [Fukomys damarensis]
Length=1303

 Score =   129 bits (323),  Expect(2) = 2e-33, Method: Composition-based stats.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579   KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
             K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  1190  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  1249

Query  399   yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
             YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  1250  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  1303


 Score = 40.4 bits (93),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  641   LPFGSIFIEMYFVFTSFW  588
             LPFGSIFIEMYF+FTSFW
Sbjct  1170  LPFGSIFIEMYFIFTSFW  1187



>gb|KDD76545.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=572

 Score =   127 bits (318),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGF LLVF+IL++VT+CVT+V TYFLLNAENYHW W SF + AST++YV+LYS++
Sbjct  459  KVYYVYGFFLLVFIILLVVTLCVTVVATYFLLNAENYHWHWASFGAGASTSIYVWLYSVH  518

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y++VKTKM+GFFQ +FYFGYTLMFC+GL ++CG+VG+LG++ FVRRIY+NIKCD
Sbjct  519  YFFVKTKMTGFFQTTFYFGYTLMFCIGLSVMCGSVGYLGASAFVRRIYKNIKCD  572


 Score = 40.8 bits (94),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  439  LPFGSIFIEMYFVFTSFWNYK  459



>gb|ETN57960.1| hypothetical protein AND_010453 [Anopheles darlingi]
Length=1505

 Score =   125 bits (315),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  579   KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
             K+YYVYGFMLLVFLILIIVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  1392  KIYYVYGFMLLVFLILIIVTVCVTIVCTYFLLNAEDYRWQWTSFMSAASTAIYVYMYSFY  1451

Query  399   yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
             Y++ KTKM G FQ SFYFGY  +F   LG++CG VG+ G+N+FVR+IY N+K D
Sbjct  1452  YFFFKTKMYGLFQTSFYFGYMALFSGALGMICGTVGYFGTNIFVRKIYSNVKID  1505


 Score = 40.4 bits (93),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  641   LPFGSIFIEMYFVFTSFW  588
             LPFGSIFIEMYF+FTSFW
Sbjct  1372  LPFGSIFIEMYFIFTSFW  1389



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score =   124 bits (311),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYY+YGF+LLV LIL++VTVCVTIVGTYFLLNAENYHWQWT+F  +AST+ YV+LYS++
Sbjct  483  KVYYIYGFLLLVVLILLVVTVCVTIVGTYFLLNAENYHWQWTAFGMSASTSFYVFLYSVH  542

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+  KTKM+G FQ  FYFGYT MFCLGL +LCGAVG++ +  FVR IYRN+KCD
Sbjct  543  YFLFKTKMTGLFQTCFYFGYTSMFCLGLALLCGAVGYMAAAAFVRTIYRNVKCD  596


 Score = 40.8 bits (94),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  463  LPFGSIFIEMYFVFTSFWNYK  483



>gb|AAX96186.1| Endomembrane protein 70 [Oryza sativa Japonica Group]
Length=570

 Score =   121 bits (304),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIY
Sbjct  474  KVYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAV  295
            YY+VKTKMSGFFQ SFYFGYTLMFCLGLGILCG V
Sbjct  534  YYHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGTV  568


 Score = 40.8 bits (94),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  454  LPFGSIFIEMYFVFTSFWNYK  474



>ref|XP_004335868.1| endomembrane protein EMP70 precursor isolog, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13855.1| endomembrane protein EMP70 precursor isolog, putative [Acanthamoeba 
castellanii str. Neff]
Length=591

 Score =   124 bits (310),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K YYVYGFMLLV++ILIIVTVCVTIV TYFLLN+E+Y WQWTSF SAASTA YV+LYS+Y
Sbjct  478  KYYYVYGFMLLVYVILIIVTVCVTIVSTYFLLNSEDYRWQWTSFLSAASTAGYVFLYSVY  537

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y+Y+KTKMSGFFQ  FYFGY  MFCLGL  LCGA+GF+G+++FVRRIY  IK D
Sbjct  538  YFYMKTKMSGFFQTVFYFGYMAMFCLGLATLCGAIGFIGTSMFVRRIYTMIKGD  591


 Score = 37.0 bits (84),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWE  585
            LPFGSIFIEMYF+FTSF++
Sbjct  460  LPFGSIFIEMYFIFTSFYK  478



>ref|XP_010101151.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
 gb|EXB87369.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
Length=609

 Score =   120 bits (300),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/93 (99%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY
Sbjct  469  KVYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIY  528

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  301
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG
Sbjct  529  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCG  561


 Score = 40.8 bits (94),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  449  LPFGSIFIEMYFVFTSFWNYK  469



>ref|XP_008282853.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Stegastes partitus]
Length=624

 Score =   119 bits (297),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  511  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  570

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  571  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624


 Score = 40.0 bits (92),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  491  LPFGSIFIEMYFIFTSFWAYK  511



>gb|KJB47460.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=571

 Score =   118 bits (295),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YS+Y
Sbjct  477  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYMYSVY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGA  298
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG 
Sbjct  537  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGE  570


 Score = 40.4 bits (93),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_006799085.1| PREDICTED: transmembrane 9 superfamily member 3-like [Neolamprologus 
brichardi]
Length=624

 Score =   118 bits (296),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  511  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  570

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  571  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624


 Score = 40.0 bits (92),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  491  LPFGSIFIEMYFIFTSFWAYK  511



>ref|XP_008057299.1| PREDICTED: transmembrane 9 superfamily member 3 [Tarsius syrichta]
Length=359

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  246  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  305

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  306  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  359


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  226  LPFGSIFIEMYFIFTSFWAYK  246



>emb|CDQ61092.1| unnamed protein product [Oncorhynchus mykiss]
Length=640

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  527  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  586

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  587  YYFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYVGTSAFVRKIYTNVKID  640


 Score = 40.0 bits (92),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFW  588
            LPFGSIFIEMYF+FTSFW
Sbjct  507  LPFGSIFIEMYFIFTSFW  524



>ref|XP_005795250.1| PREDICTED: transmembrane 9 superfamily member 3-like [Xiphophorus 
maculatus]
Length=586

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|XP_004559661.1| PREDICTED: transmembrane 9 superfamily member 3-like [Maylandia 
zebra]
Length=624

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  511  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  570

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  571  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  491  LPFGSIFIEMYFIFTSFWAYK  511



>ref|XP_006630785.1| PREDICTED: transmembrane 9 superfamily member 3-like [Lepisosteus 
oculatus]
Length=586

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|XP_008428273.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Poecilia 
reticulata]
Length=586

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|XP_010779545.1| PREDICTED: transmembrane 9 superfamily member 3 [Notothenia coriiceps]
Length=586

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 40.0 bits (92),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|NP_998554.1| transmembrane 9 superfamily member 3 precursor [Danio rerio]
 gb|AAH46021.1| Transmembrane 9 superfamily member 3 [Danio rerio]
Length=586

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|XP_005997314.1| PREDICTED: transmembrane 9 superfamily member 3 [Latimeria chalumnae]
Length=587

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 40.0 bits (92),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_009511961.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phalacrocorax 
carbo]
 ref|XP_009806564.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Gavia stellata]
 ref|XP_010146260.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Eurypyga helias]
Length=194

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  81   KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  140

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  141  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  194


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  61   LPFGSIFIEMYFIFTSFWAYK  81



>ref|XP_007258750.1| PREDICTED: transmembrane 9 superfamily member 3-like [Astyanax 
mexicanus]
Length=587

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_007566966.1| PREDICTED: transmembrane 9 superfamily member 3 [Poecilia formosa]
Length=586

 Score =   118 bits (296),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|XP_003441118.1| PREDICTED: transmembrane 9 superfamily member 3 [Oreochromis 
niloticus]
Length=586

 Score =   118 bits (296),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>ref|XP_006263564.1| PREDICTED: transmembrane 9 superfamily member 3-like [Alligator 
mississippiensis]
Length=511

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  398  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  457

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  458  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  511


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  378  LPFGSIFIEMYFIFTSFWAYK  398



>ref|XP_006157459.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Tupaia 
chinensis]
Length=577

 Score =   118 bits (296),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  464  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  523

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  524  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  577


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  444  LPFGSIFIEMYFIFTSFWAYK  464



>gb|KJB47461.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=576

 Score =   117 bits (294),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 89/93 (96%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YS+Y
Sbjct  477  KVYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYMYSVY  536

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  301
            YYYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG
Sbjct  537  YYYVKTKMSGFFQTSFYFGYTLMFCLGLGILCG  569


 Score = 40.4 bits (93),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  457  LPFGSIFIEMYFVFTSFWNYK  477



>ref|XP_005735123.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pundamilia 
nyererei]
 ref|XP_005927107.1| PREDICTED: transmembrane 9 superfamily member 3-like [Haplochromis 
burtoni]
Length=586

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>gb|KHG20578.1| Tm9sf3 [Gossypium arboreum]
Length=639

 Score =   117 bits (293),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYS+Y
Sbjct  503  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSVY  562

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILC  304
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILC
Sbjct  563  YYSVKTKMSGFFQTSFYFGYTLMFCLGLGILC  594


 Score = 40.4 bits (93),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  483  LPFGSIFIEMYFVFTSFWNYK  503



>ref|XP_003963762.1| PREDICTED: transmembrane 9 superfamily member 3-like [Takifugu 
rubripes]
Length=586

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>gb|KHG20579.1| Tm9sf3 [Gossypium arboreum]
Length=626

 Score =   117 bits (293),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            KVYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYS+Y
Sbjct  503  KVYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSVY  562

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILC  304
            YY VKTKMSGFFQ SFYFGYTLMFCLGLGILC
Sbjct  563  YYSVKTKMSGFFQTSFYFGYTLMFCLGLGILC  594


 Score = 40.4 bits (93),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYFVFTSFW  +
Sbjct  483  LPFGSIFIEMYFVFTSFWNYK  503



>dbj|BAB55110.1| unnamed protein product [Homo sapiens]
 dbj|BAC11397.1| unnamed protein product [Homo sapiens]
Length=329

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  216  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  275

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  276  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  329


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  196  LPFGSIFIEMYFIFTSFWAYK  216



>ref|XP_008320400.1| PREDICTED: transmembrane 9 superfamily member 3 [Cynoglossus 
semilaevis]
Length=585

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  472  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  532  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYVGTSAFVRKIYTNVKID  585


 Score = 40.0 bits (92),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  452  LPFGSIFIEMYFIFTSFWAYK  472



>ref|XP_008428274.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Poecilia 
reticulata]
Length=545

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>gb|AAH20959.2| TM9SF3 protein, partial [Homo sapiens]
Length=521

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  408  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  467

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  468  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  521


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  388  LPFGSIFIEMYFIFTSFWAYK  408



>dbj|BAC11232.1| unnamed protein product [Homo sapiens]
Length=399

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  286  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  345

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  346  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  399


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  266  LPFGSIFIEMYFIFTSFWAYK  286



>ref|XP_007080322.1| PREDICTED: transmembrane 9 superfamily member 3 [Panthera tigris 
altaica]
Length=608

 Score =   118 bits (295),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  495  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  554

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  555  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  608


 Score = 39.7 bits (91),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  475  LPFGSIFIEMYFIFTSFWAYK  495



>ref|XP_008773120.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Rattus 
norvegicus]
Length=598

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  485  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  544

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  545  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  598


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  465  LPFGSIFIEMYFIFTSFWAYK  485



>ref|NP_001135200.1| Transmembrane 9 superfamily member 3 precursor [Salmo salar]
 gb|ACI33193.1| Transmembrane 9 superfamily member 3 precursor [Salmo salar]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYVGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_010896390.1| PREDICTED: transmembrane 9 superfamily member 3 [Esox lucius]
Length=586

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  473  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  532

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YYFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYVGTSAFVRKIYTNVKID  586


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  453  LPFGSIFIEMYFIFTSFWAYK  473



>gb|AAF98159.1|AF269150_1 transmembrane protein TM9SF3 [Homo sapiens]
Length=589

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  476  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  536  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  589


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  456  LPFGSIFIEMYFIFTSFWAYK  476



>ref|XP_007902753.1| PREDICTED: transmembrane 9 superfamily member 3 [Callorhinchus 
milii]
Length=585

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS Y
Sbjct  472  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFY  531

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  532  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  585


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  452  LPFGSIFIEMYFIFTSFWAYK  472



>ref|XP_004580070.1| PREDICTED: transmembrane 9 superfamily member 3 [Ochotona princeps]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_009951614.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Leptosomus 
discolor]
 ref|XP_010281856.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phaethon 
lepturus]
Length=395

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  282  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  341

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  342  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  395


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  262  LPFGSIFIEMYFIFTSFWAYK  282



>ref|NP_064508.3| transmembrane 9 superfamily member 3 precursor [Homo sapiens]
 ref|XP_009457308.1| PREDICTED: transmembrane 9 superfamily member 3 [Pan troglodytes]
 sp|Q9HD45.2|TM9S3_HUMAN RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=EP70-P-iso; AltName: Full=SM-11044-binding protein; Flags: 
Precursor [Homo sapiens]
 gb|EAW49972.1| SM-11044 binding protein, isoform CRA_a [Homo sapiens]
 gb|EAW49974.1| SM-11044 binding protein, isoform CRA_a [Homo sapiens]
 gb|AAI36790.1| Transmembrane 9 superfamily member 3 [Homo sapiens]
 gb|AAI36789.1| Transmembrane 9 superfamily member 3 [Homo sapiens]
 tpg|DAA64544.1| TPA_exp: dinucleotide oxidase disulfide thiol exchanger 3 superfamily 
member 3 [Homo sapiens]
Length=589

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  476  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  535

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  536  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  589


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  456  LPFGSIFIEMYFIFTSFWAYK  476



>ref|XP_004370030.1| PREDICTED: transmembrane 9 superfamily member 3 [Trichechus manatus 
latirostris]
 ref|XP_007938194.1| PREDICTED: transmembrane 9 superfamily member 3 [Orycteropus 
afer afer]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_003787418.1| PREDICTED: transmembrane 9 superfamily member 3 [Otolemur garnettii]
Length=541

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  428  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  487

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  488  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  541


 Score = 40.0 bits (92),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  408  LPFGSIFIEMYFIFTSFWAYK  428



>ref|XP_004892237.1| PREDICTED: transmembrane 9 superfamily member 3 [Heterocephalus 
glaber]
Length=569

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  456  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  515

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  516  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  569


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  436  LPFGSIFIEMYFIFTSFWAYK  456



>ref|XP_004409540.1| PREDICTED: transmembrane 9 superfamily member 3 [Odobenus rosmarus 
divergens]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_005481354.1| PREDICTED: transmembrane 9 superfamily member 3 [Zonotrichia 
albicollis]
Length=581

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  468  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  527

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  528  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  581


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  448  LPFGSIFIEMYFIFTSFWAYK  468



>ref|XP_002821075.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Pongo abelii]
Length=588

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  475  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  535  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  588


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  455  LPFGSIFIEMYFIFTSFWAYK  475



>ref|XP_008830212.1| PREDICTED: transmembrane 9 superfamily member 3 [Nannospalax 
galili]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_003399780.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus 
terrestris]
 ref|XP_003493708.1| PREDICTED: transmembrane 9 superfamily member 3-like [Bombus 
impatiens]
Length=584

 Score =   117 bits (294),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFMLLVF+IL+IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA YVY+YS Y
Sbjct  471  KIYYVYGFMLLVFVILMIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAGYVYIYSFY  530

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            Y++ KTKM G FQ +FYFGY  +F L LGI+CG VG++G+N FVR+IY  +K D
Sbjct  531  YFFFKTKMYGLFQTAFYFGYMALFSLALGIMCGTVGYVGTNAFVRKIYSTVKID  584


 Score = 40.0 bits (92),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  451  LPFGSIFIEMYFIFTSFWAYK  471



>ref|XP_004616433.1| PREDICTED: transmembrane 9 superfamily member 3 [Sorex araneus]
Length=545

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>ref|XP_005312131.1| PREDICTED: transmembrane 9 superfamily member 3 [Chrysemys picta 
bellii]
Length=583

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  470  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  529

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  530  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  583


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  450  LPFGSIFIEMYFIFTSFWAYK  470



>ref|XP_011285801.1| PREDICTED: transmembrane 9 superfamily member 3 [Felis catus]
Length=561

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  448  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  507

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  508  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  561


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  428  LPFGSIFIEMYFIFTSFWAYK  448



>ref|XP_008942019.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Merops 
nubicus]
 ref|XP_010161341.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Caprimulgus 
carolinensis]
 ref|XP_010075805.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pterocles 
gutturalis]
Length=448

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  335  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  394

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  395  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  448


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  315  LPFGSIFIEMYFIFTSFWAYK  335



>ref|XP_006756739.1| PREDICTED: transmembrane 9 superfamily member 3 [Myotis davidii]
Length=401

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  288  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  347

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  348  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  401


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  268  LPFGSIFIEMYFIFTSFWAYK  288



>ref|XP_004457032.1| PREDICTED: transmembrane 9 superfamily member 3 [Dasypus novemcinctus]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_002936010.2| PREDICTED: transmembrane 9 superfamily member 3 [Xenopus (Silurana) 
tropicalis]
Length=579

 Score =   117 bits (294),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  466  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  525

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  526  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  579


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  446  LPFGSIFIEMYFIFTSFWAYK  466



>ref|XP_007637675.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2, partial 
[Cricetulus griseus]
Length=568

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  455  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  514

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  515  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  568


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  435  LPFGSIFIEMYFIFTSFWAYK  455



>gb|KFU99061.1| Transmembrane 9 superfamily member 3, partial [Pterocles gutturalis]
Length=449

 Score =   117 bits (294),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  336  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  395

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  396  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  449


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  316  LPFGSIFIEMYFIFTSFWAYK  336



>ref|XP_005407637.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Chinchilla 
lanigera]
Length=594

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  481  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  540

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  541  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  594


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  461  LPFGSIFIEMYFIFTSFWAYK  481



>ref|XP_007456252.1| PREDICTED: transmembrane 9 superfamily member 3 [Lipotes vexillifer]
Length=588

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  475  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  534

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  535  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  588


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  455  LPFGSIFIEMYFIFTSFWAYK  475



>ref|XP_010387883.1| PREDICTED: transmembrane 9 superfamily member 3 [Rhinopithecus 
roxellana]
Length=587

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>gb|AAF21983.1| SM-11044 binding protein [Homo sapiens]
Length=578

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  465  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  524

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  525  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  578


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  445  LPFGSIFIEMYFIFTSFWAYK  465



>ref|XP_008948979.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Pan paniscus]
Length=545

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>ref|XP_009976834.1| PREDICTED: transmembrane 9 superfamily member 3 [Tauraco erythrolophus]
Length=266

 Score =   117 bits (294),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  153  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  212

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  213  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  266


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  133  LPFGSIFIEMYFIFTSFWAYK  153



>ref|XP_005048681.1| PREDICTED: transmembrane 9 superfamily member 3 [Ficedula albicollis]
Length=601

 Score =   117 bits (294),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  488  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  547

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  548  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  601


 Score = 40.0 bits (92),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  468  LPFGSIFIEMYFIFTSFWAYK  488



>ref|XP_421629.4| PREDICTED: transmembrane 9 superfamily member 3 [Gallus gallus]
Length=575

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  462  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  521

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  522  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  575


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  442  LPFGSIFIEMYFIFTSFWAYK  462



>ref|XP_006014905.1| PREDICTED: transmembrane 9 superfamily member 3 [Alligator sinensis]
Length=563

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  450  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  509

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  510  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  563


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  430  LPFGSIFIEMYFIFTSFWAYK  450



>dbj|BAE91187.1| unnamed protein product [Macaca fascicularis]
Length=487

 Score =   118 bits (295),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  374  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  433

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  434  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487


 Score = 39.7 bits (91),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  354  LPFGSIFIEMYFIFTSFWAYK  374



>ref|XP_007615223.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Cricetulus 
griseus]
Length=487

 Score =   118 bits (295),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  374  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  433

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  434  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  354  LPFGSIFIEMYFIFTSFWAYK  374



>ref|XP_003479606.1| PREDICTED: transmembrane 9 superfamily member 3 [Cavia porcellus]
Length=600

 Score =   118 bits (295),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  487  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  546

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  547  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  600


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  467  LPFGSIFIEMYFIFTSFWAYK  487



>gb|EHB07803.1| Transmembrane 9 superfamily member 3, partial [Heterocephalus 
glaber]
 gb|EHH64915.1| hypothetical protein EGM_18247, partial [Macaca fascicularis]
Length=555

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  442  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  501

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  502  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  555


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  422  LPFGSIFIEMYFIFTSFWAYK  442



>ref|NP_579930.1| transmembrane 9 superfamily member 3 precursor [Mus musculus]
 ref|XP_005063661.1| PREDICTED: transmembrane 9 superfamily member 3 [Mesocricetus 
auratus]
 ref|XP_006231475.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Rattus 
norvegicus]
 sp|Q9ET30.1|TM9S3_MOUSE RecName: Full=Transmembrane 9 superfamily member 3; Flags: Precursor 
[Mus musculus]
 gb|AAF98160.1|AF269151_1 transmembrane protein TM9SF3 [Mus musculus]
Length=587

 Score =   118 bits (295),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_005407641.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X5 [Chinchilla 
lanigera]
Length=567

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  454  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  513

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  514  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  567


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  434  LPFGSIFIEMYFIFTSFWAYK  454



>ref|XP_008142341.1| PREDICTED: transmembrane 9 superfamily member 3 [Eptesicus fuscus]
Length=545

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>ref|XP_849773.1| PREDICTED: transmembrane 9 superfamily member 3 isoformX1 [Canis 
lupus familiaris]
Length=587

 Score =   118 bits (295),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  474  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  533

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  534  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  454  LPFGSIFIEMYFIFTSFWAYK  474



>ref|XP_007441347.1| PREDICTED: transmembrane 9 superfamily member 3-like [Python 
bivittatus]
Length=487

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  374  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  433

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  434  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  354  LPFGSIFIEMYFIFTSFWAYK  374



>ref|XP_003255319.1| PREDICTED: transmembrane 9 superfamily member 3 [Nomascus leucogenys]
 ref|XP_003904109.1| PREDICTED: transmembrane 9 superfamily member 3 [Papio anubis]
 ref|XP_003922396.1| PREDICTED: transmembrane 9 superfamily member 3 [Saimiri boliviensis 
boliviensis]
 ref|XP_004049917.1| PREDICTED: transmembrane 9 superfamily member 3 [Gorilla gorilla 
gorilla]
 ref|XP_004669974.1| PREDICTED: transmembrane 9 superfamily member 3 [Jaculus jaculus]
 ref|XP_004749641.1| PREDICTED: transmembrane 9 superfamily member 3 [Mustela putorius 
furo]
 ref|XP_004794746.1| PREDICTED: transmembrane 9 superfamily member 3 [Mustela putorius 
furo]
 ref|XP_005335337.1| PREDICTED: transmembrane 9 superfamily member 3 [Ictidomys tridecemlineatus]
 ref|XP_006174470.1| PREDICTED: transmembrane 9 superfamily member 3 [Camelus ferus]
 ref|XP_006210638.1| PREDICTED: transmembrane 9 superfamily member 3 [Vicugna pacos]
 ref|XP_006880138.1| PREDICTED: transmembrane 9 superfamily member 3 [Elephantulus 
edwardii]
 ref|XP_006925981.1| PREDICTED: transmembrane 9 superfamily member 3 [Pteropus alecto]
 ref|XP_008573585.1| PREDICTED: transmembrane 9 superfamily member 3 [Galeopterus 
variegatus]
 ref|XP_010616424.1| PREDICTED: transmembrane 9 superfamily member 3 [Fukomys damarensis]
 ref|XP_010616425.1| PREDICTED: transmembrane 9 superfamily member 3 [Fukomys damarensis]
 ref|XP_010587390.1| PREDICTED: transmembrane 9 superfamily member 3 [Loxodonta africana]
 ref|XP_011372281.1| PREDICTED: transmembrane 9 superfamily member 3 [Pteropus vampyrus]
 dbj|BAB55369.1| unnamed protein product [Homo sapiens]
 gb|EAW49973.1| SM-11044 binding protein, isoform CRA_b [Homo sapiens]
 gb|ELK00879.1| Transmembrane 9 superfamily member 3 [Pteropus alecto]
Length=545

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>gb|ELR54176.1| Transmembrane 9 superfamily member 3, partial [Bos mutus]
Length=555

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  442  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  501

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  502  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  555


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  422  LPFGSIFIEMYFIFTSFWAYK  442



>ref|XP_008641953.1| PREDICTED: transmembrane 9 superfamily member 3 [Corvus brachyrhynchos]
 ref|XP_010409955.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Corvus 
cornix cornix]
Length=545

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>ref|XP_007053441.1| PREDICTED: transmembrane 9 superfamily member 3 [Chelonia mydas]
Length=545

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 39.7 bits (91),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



>ref|XP_005520596.1| PREDICTED: transmembrane 9 superfamily member 3 [Pseudopodoces 
humilis]
Length=545

 Score =   117 bits (294),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -1

Query  579  KVYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiy  400
            K+YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS Y
Sbjct  432  KIYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFY  491

Query  399  yyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  238
            YY+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  492  YYFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545


 Score = 40.0 bits (92),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = -2

Query  641  LPFGSIFIEMYFVFTSFWELQ  579
            LPFGSIFIEMYF+FTSFW  +
Sbjct  412  LPFGSIFIEMYFIFTSFWAYK  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375