BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046D18

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008374098.1|  PREDICTED: ABC transporter E family member 2...    271   6e-87   
gb|KHG03576.1|  ABC transporter E family member 2                       274   5e-86   Gossypium arboreum [tree cotton]
ref|XP_009334167.1|  PREDICTED: ABC transporter E family member 2...    268   6e-86   Pyrus x bretschneideri [bai li]
gb|AAO32059.1|  RNase L inhibitor-like protein                          265   1e-85   Brassica rapa subsp. pekinensis [bai cai]
emb|CDP07208.1|  unnamed protein product                                276   1e-84   Coffea canephora [robusta coffee]
ref|XP_007040862.1|  RNAse l inhibitor protein 2 isoform 1              274   5e-84   
gb|KJB25121.1|  hypothetical protein B456_004G177600                    274   6e-84   Gossypium raimondii
ref|XP_010054013.1|  PREDICTED: ABC transporter E family member 2       274   7e-84   Eucalyptus grandis [rose gum]
ref|XP_011082187.1|  PREDICTED: ABC transporter E family member 2       273   1e-83   Sesamum indicum [beniseed]
ref|XP_010240626.1|  PREDICTED: ABC transporter E family member 2...    261   2e-83   Brachypodium distachyon [annual false brome]
gb|ABR18176.1|  unknown                                                 272   3e-83   Picea sitchensis
gb|AIU41641.1|  ABC transporter family protein                          272   3e-83   Hevea brasiliensis [jebe]
ref|XP_004512327.1|  PREDICTED: ABC transporter E family member 2...    272   4e-83   Cicer arietinum [garbanzo]
dbj|BAD94217.1|  RNase L inhibitor-like protein                         265   5e-83   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64099.1|  hypothetical protein M569_10682                         272   5e-83   Genlisea aurea
gb|EYU37486.1|  hypothetical protein MIMGU_mgv1a003146mg                271   7e-83   Erythranthe guttata [common monkey flower]
ref|XP_006858622.1|  hypothetical protein AMTR_s00066p00025940          271   1e-82   Amborella trichopoda
ref|XP_007222049.1|  hypothetical protein PRUPE_ppa003094mg             270   1e-82   Prunus persica
ref|XP_008221272.1|  PREDICTED: ABC transporter E family member 2       270   1e-82   Prunus mume [ume]
ref|XP_011013966.1|  PREDICTED: ABC transporter E family member 2...    270   2e-82   Populus euphratica
ref|XP_002303221.1|  RNase L inhibitor family protein                   270   2e-82   
ref|XP_006385402.1|  hypothetical protein POPTR_0003s03960g             270   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010099717.1|  ABC transporter E family member 2                  270   2e-82   
ref|XP_010690817.1|  PREDICTED: ABC transporter E family member 2       270   3e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010272250.1|  PREDICTED: ABC transporter E family member 2       270   3e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010323314.1|  PREDICTED: ABC transporter E family member 2       269   5e-82   
ref|XP_009380578.1|  PREDICTED: ABC transporter E family member 2       269   5e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409468.1|  PREDICTED: ABC transporter E family member 2...    263   7e-82   
ref|XP_004291224.1|  PREDICTED: ABC transporter E family member 2       268   7e-82   Fragaria vesca subsp. vesca
emb|CAN65893.1|  hypothetical protein VITISV_021090                     268   8e-82   Vitis vinifera
ref|XP_010275149.1|  PREDICTED: ABC transporter E family member 2...    268   9e-82   Nelumbo nucifera [Indian lotus]
gb|KDP42075.1|  hypothetical protein JCGZ_01863                         268   1e-81   Jatropha curcas
ref|XP_010436484.1|  PREDICTED: ABC transporter E family member 2...    267   1e-81   
ref|XP_002271392.1|  PREDICTED: ABC transporter E family member 2       268   1e-81   Vitis vinifera
ref|XP_009334125.1|  PREDICTED: ABC transporter E family member 2...    258   1e-81   Pyrus x bretschneideri [bai li]
ref|XP_003537713.1|  PREDICTED: ABC transporter E family member 2...    268   1e-81   Glycine max [soybeans]
ref|XP_008387874.1|  PREDICTED: ABC transporter E family member 2...    268   2e-81   
ref|XP_006430898.1|  hypothetical protein CICLE_v10011325mg             267   2e-81   
ref|XP_010536040.1|  PREDICTED: ABC transporter E family member 2       268   2e-81   Tarenaya hassleriana [spider flower]
emb|CBI29193.3|  unnamed protein product                                268   2e-81   Vitis vinifera
ref|XP_009770922.1|  PREDICTED: ABC transporter E family member 2       267   2e-81   Nicotiana sylvestris
ref|XP_002528281.1|  rnase l inhibitor, putative                        267   2e-81   
ref|XP_009602236.1|  PREDICTED: ABC transporter E family member 2...    267   2e-81   Nicotiana tomentosiformis
ref|XP_007217624.1|  hypothetical protein PRUPE_ppa015638mg             267   3e-81   Prunus persica
emb|CDX76485.1|  BnaA08g09150D                                          267   3e-81   
ref|XP_003592706.1|  RNase L inhibitor-like protein                     267   3e-81   Medicago truncatula
ref|XP_009108421.1|  PREDICTED: ABC transporter E family member 2       267   3e-81   
gb|KEH40226.1|  RNase L inhibitor ABC superfamily protein, putative     265   3e-81   Medicago truncatula
emb|CDX99388.1|  BnaC01g11640D                                          267   3e-81   
emb|CDY05197.1|  BnaC05g46060D                                          267   3e-81   
ref|XP_007216970.1|  hypothetical protein PRUPE_ppa003087mg             267   3e-81   Prunus persica
ref|XP_010439735.1|  PREDICTED: ABC transporter E family member 2...    267   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008444234.1|  PREDICTED: ABC transporter E family member 2       267   3e-81   Cucumis melo [Oriental melon]
ref|XP_004150248.1|  PREDICTED: ABC transporter E family member 2...    267   3e-81   Cucumis sativus [cucumbers]
ref|XP_006385159.1|  RNase L inhibitor family protein                   267   4e-81   
ref|XP_011028506.1|  PREDICTED: ABC transporter E family member 2       267   4e-81   Populus euphratica
gb|KDO72263.1|  hypothetical protein CISIN_1g040300mg                   266   4e-81   Citrus sinensis [apfelsine]
ref|XP_006430899.1|  hypothetical protein CICLE_v10011325mg             266   4e-81   Citrus clementina [clementine]
emb|CDX98609.1|  BnaA03g43940D                                          266   4e-81   
emb|CDY01588.1|  BnaC07g35780D                                          266   5e-81   
ref|XP_008801480.1|  PREDICTED: ABC transporter E family member 2       266   5e-81   
ref|XP_009409469.1|  PREDICTED: ABC transporter E family member 2...    266   5e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008227935.1|  PREDICTED: ABC transporter E family member 2...    266   5e-81   
gb|KJB25125.1|  hypothetical protein B456_004G177600                    266   5e-81   Gossypium raimondii
ref|XP_008227934.1|  PREDICTED: ABC transporter E family member 2...    266   6e-81   Prunus mume [ume]
ref|XP_004979432.1|  PREDICTED: ABC transporter E family member 2...    266   6e-81   Setaria italica
ref|XP_008227933.1|  PREDICTED: ABC transporter E family member 2...    266   6e-81   Prunus mume [ume]
gb|KHN05542.1|  ABC transporter E family member 2                       268   9e-81   Glycine soja [wild soybean]
ref|XP_006359955.1|  PREDICTED: ABC transporter E family member 2...    266   1e-80   Solanum tuberosum [potatoes]
ref|XP_006286029.1|  hypothetical protein CARUB_v10007560mg             265   1e-80   Capsella rubella
ref|XP_010529268.1|  PREDICTED: ABC transporter E family member 2...    265   1e-80   Tarenaya hassleriana [spider flower]
gb|AGC70150.1|  ABC transporter E family member 2 protein               265   1e-80   Cardamine hirsuta
ref|XP_006366958.1|  PREDICTED: ABC transporter E family member 2...    265   1e-80   Solanum tuberosum [potatoes]
emb|CDY09282.1|  BnaC03g63120D                                          265   2e-80   Brassica napus [oilseed rape]
ref|XP_010692184.1|  PREDICTED: ABC transporter E family member 2...    265   2e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009137000.1|  PREDICTED: ABC transporter E family member 2...    265   2e-80   Brassica rapa
ref|XP_002862248.1|  hypothetical protein ARALYDRAFT_921009             253   2e-80   
gb|KEH40227.1|  RNase L inhibitor ABC superfamily protein, putative     265   2e-80   Medicago truncatula
ref|XP_008655353.1|  PREDICTED: ABC transporter E family member 2...    263   3e-80   
emb|CAA16710.1|  RNase L inhibitor-like protein                         264   3e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002468219.1|  hypothetical protein SORBIDRAFT_01g042020          264   3e-80   Sorghum bicolor [broomcorn]
ref|XP_006662991.1|  PREDICTED: ABC transporter E family member 2...    264   3e-80   Oryza brachyantha
ref|NP_001068062.1|  Os11g0546000                                       264   4e-80   
ref|XP_008380283.1|  PREDICTED: ABC transporter E family member 2...    264   4e-80   
ref|XP_009333973.1|  PREDICTED: ABC transporter E family member 2       264   4e-80   Pyrus x bretschneideri [bai li]
ref|XP_006413992.1|  hypothetical protein EUTSA_v10024707mg             264   4e-80   Eutrema salsugineum [saltwater cress]
ref|XP_007158074.1|  hypothetical protein PHAVU_002G121800g             264   5e-80   Phaseolus vulgaris [French bean]
ref|XP_010466556.1|  PREDICTED: ABC transporter E family member 1...    253   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008655350.1|  PREDICTED: ABC transporter E family member 2...    263   5e-80   Zea mays [maize]
ref|XP_009349643.1|  PREDICTED: ABC transporter E family member 2...    264   5e-80   Pyrus x bretschneideri [bai li]
ref|NP_193656.2|  RNAse l inhibitor protein 2                           264   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008660181.1|  PREDICTED: ABC transporter E family member 2...    263   6e-80   Zea mays [maize]
gb|KEH28590.1|  RNase L inhibitor ABC domain protein                    263   1e-79   Medicago truncatula
ref|XP_008655346.1|  PREDICTED: ABC transporter E family member 2...    263   1e-79   Zea mays [maize]
ref|XP_009409466.1|  PREDICTED: ABC transporter E family member 2...    263   2e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577489.1|  PREDICTED: ABC transporter E family member 2       262   2e-79   Brachypodium distachyon [annual false brome]
ref|XP_010235001.1|  PREDICTED: ABC transporter E family member 2...    251   2e-79   Brachypodium distachyon [annual false brome]
gb|ABG66092.1|  retrotransposon protein, putative, unclassified, ...    251   3e-79   Oryza sativa Japonica Group [Japonica rice]
gb|AAM19067.1|  RNase L inhibitor-like protein                          261   3e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010917851.1|  PREDICTED: ABC transporter E family member 2       261   3e-79   Elaeis guineensis
ref|XP_002516768.1|  rnase l inhibitor, putative                        246   4e-79   
ref|XP_010915915.1|  PREDICTED: ABC transporter E family member 2...    261   5e-79   Elaeis guineensis
ref|XP_003579496.1|  PREDICTED: ABC transporter E family member 2...    261   7e-79   Brachypodium distachyon [annual false brome]
ref|XP_003580843.1|  PREDICTED: ABC transporter E family member 2...    261   8e-79   Brachypodium distachyon [annual false brome]
ref|XP_010925922.1|  PREDICTED: ABC transporter E family member 2...    260   1e-78   
ref|XP_008805333.1|  PREDICTED: ABC transporter E family member 2...    260   1e-78   Phoenix dactylifera
ref|XP_008228054.1|  PREDICTED: ABC transporter E family member 2...    259   2e-78   
ref|XP_010925920.1|  PREDICTED: ABC transporter E family member 2...    260   2e-78   
gb|AAL26702.1|  68 kDa protein HP68                                     259   2e-78   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ90466.1|  predicted protein                                      259   2e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001064667.1|  Os10g0432200                                       250   5e-78   
ref|XP_010466555.1|  PREDICTED: ABC transporter E family member 1...    252   5e-78   Camelina sativa [gold-of-pleasure]
ref|XP_007216670.1|  hypothetical protein PRUPE_ppa1027195mg            258   6e-78   Prunus persica
ref|XP_004246016.1|  PREDICTED: ABC transporter E family member 2       258   6e-78   Solanum lycopersicum
gb|EEE50999.1|  hypothetical protein OsJ_31617                          251   1e-77   Oryza sativa Japonica Group [Japonica rice]
emb|CDY60809.1|  BnaA01g37290D                                          257   2e-77   Brassica napus [oilseed rape]
ref|XP_009117623.1|  PREDICTED: ABC transporter E family member 1       256   3e-77   Brassica rapa
ref|XP_008387873.1|  PREDICTED: ABC transporter E family member 2...    257   3e-77   Malus domestica [apple tree]
ref|XP_006299034.1|  hypothetical protein CARUB_v10015171mg             255   1e-76   Capsella rubella
ref|XP_006418725.1|  hypothetical protein EUTSA_v10002453mg             254   1e-76   Eutrema salsugineum [saltwater cress]
gb|AGV54379.1|  ABC transporter E family member 2-like protein          255   1e-76   Phaseolus vulgaris [French bean]
ref|XP_008783223.1|  PREDICTED: ABC transporter E family member 2...    254   2e-76   Phoenix dactylifera
dbj|BAJ93642.1|  predicted protein                                      254   2e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010500834.1|  PREDICTED: ABC transporter E family member 1...    254   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006299795.1|  hypothetical protein CARUB_v10015991mg             254   3e-76   Capsella rubella
ref|XP_006296689.1|  hypothetical protein CARUB_v10013264mg             254   3e-76   Capsella rubella
ref|XP_008783221.1|  PREDICTED: ABC transporter E family member 2...    254   4e-76   Phoenix dactylifera
ref|XP_010465207.1|  PREDICTED: ABC transporter E family member 1...    253   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010500812.1|  PREDICTED: ABC transporter E family member 1...    254   5e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010487122.1|  PREDICTED: ABC transporter E family member 1...    253   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010465884.1|  PREDICTED: ABC transporter E family member 1...    253   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010511564.1|  PREDICTED: ABC transporter E family member 1...    252   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010465883.1|  PREDICTED: ABC transporter E family member 1...    252   2e-75   Camelina sativa [gold-of-pleasure]
gb|EEC67005.1|  hypothetical protein OsI_33716                          250   3e-75   Oryza sativa Indica Group [Indian rice]
gb|EMT04752.1|  ABC transporter E family member 2                       254   4e-75   
ref|XP_003572083.1|  PREDICTED: ABC transporter E family member 2...    250   6e-75   Brachypodium distachyon [annual false brome]
ref|NP_187973.1|  ABC transporter E family member 1                     250   7e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008365642.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    251   8e-75   
emb|CDX82529.1|  BnaA03g32920D                                          246   9e-74   
gb|EOA92610.1|  ATP-binding cassette sub-family E member 1              234   1e-73   Anas platyrhynchos [duck]
ref|XP_009135315.1|  PREDICTED: ABC transporter E family member 1...    246   3e-73   Brassica rapa
emb|CDX75723.1|  BnaC03g38060D                                          246   3e-73   
ref|XP_005088430.1|  PREDICTED: ATP-binding cassette sub-family E...    234   4e-73   
dbj|BAE87471.1|  unnamed protein product                                234   7e-73   Macaca fascicularis [crab eating macaque]
ref|XP_005031714.1|  PREDICTED: ATP-binding cassette sub-family E...    233   7e-73   
ref|XP_003589457.1|  RNase L inhibitor protein-like protein             246   8e-73   
ref|XP_005852260.1|  hypothetical protein CHLNCDRAFT_59548              234   9e-73   Chlorella variabilis
ref|XP_003288288.1|  hypothetical protein DICPUDRAFT_97974              238   3e-72   Dictyostelium purpureum
gb|EYU42264.1|  hypothetical protein MIMGU_mgv1a0213241mg               243   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_008864766.1|  ABC transporter E family member 2                  243   8e-72   Aphanomyces invadans
ref|XP_008614115.1|  ABC transporter E family member 2                  242   1e-71   Saprolegnia diclina VS20
ref|XP_009834702.1|  ABC transporter E family member 2, variant 2       240   1e-71   Aphanomyces astaci
gb|KDO32655.1|  ABC transporter E family member 2                       242   1e-71   Saprolegnia parasitica CBS 223.65
ref|XP_009834703.1|  ABC transporter E family member 2, variant 1       240   1e-71   Aphanomyces astaci
gb|ABB47665.1|  retrotransposon protein, putative, unclassified, ...    249   3e-71   Oryza sativa Japonica Group [Japonica rice]
gb|AAH16988.1|  Unknown (protein for IMAGE:4396587)                     234   3e-71   Homo sapiens [man]
gb|EFA85500.1|  RNaseL inhibitor-like protein                           240   4e-71   Heterostelium album PN500
gb|ERZ95317.1|  hypothetical protein GLOINDRAFT_312281                  229   4e-71   
gb|KFG32411.1|  putative ATP-binding cassette sub-family E member 1     228   6e-71   Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|KFZ52892.1|  ATP-binding cassette sub-family E member 1              233   6e-71   Podiceps cristatus
ref|XP_006836109.1|  hypothetical protein AMTR_s00226p00014390          240   6e-71   Amborella trichopoda
ref|XP_009834701.1|  ABC transporter E family member 2                  239   1e-70   Aphanomyces astaci
ref|XP_008903480.1|  ABC transporter E family member 2                  239   2e-70   Phytophthora parasitica INRA-310
gb|ETK89054.1|  ABC transporter E family member 2                       239   2e-70   Phytophthora parasitica
gb|EMS57600.1|  ABC transporter E family member 2                       239   3e-70   Triticum urartu
emb|CDI80211.1|  ABC transporter family protein , related               224   4e-70   Eimeria acervulina
gb|ELV10318.1|  ATP-binding cassette sub-family E member 1              234   7e-70   Tupaia chinensis
ref|XP_009518050.1|  abc transporter                                    238   7e-70   Phytophthora sojae
dbj|GAM26905.1|  hypothetical protein SAMD00019534_100800               236   1e-69   Acytostelium subglobosum LB1
ref|XP_002997210.1|  ATP-binding cassette sub-family E member 1         236   2e-69   Phytophthora infestans T30-4
ref|XP_010159708.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-69   Eurypyga helias
emb|CCA19671.1|  hypothetical protein ALNC14_058140                     236   2e-69   Albugo laibachii Nc14
emb|CAJ15800.1|  RNase L inhibitor                                      233   2e-69   Gallus gallus [bantam]
gb|EWM23869.1|  rnase l inhibitor-like protein                          237   2e-69   Nannochloropsis gaditana
ref|XP_001696778.1|  hypothetical protein CHLREDRAFT_119356             230   2e-69   Chlamydomonas reinhardtii
ref|NP_001046567.1|  Os02g0282900                                       236   2e-69   
ref|XP_011395697.1|  ABC transporter E family member 2                  236   3e-69   Auxenochlorella protothecoides
ref|XP_003773214.1|  PREDICTED: ATP-binding cassette sub-family E...    232   3e-69   
gb|KFQ20366.1|  ATP-binding cassette sub-family E member 1              233   3e-69   Merops nubicus
ref|XP_008944156.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-69   Merops nubicus
ref|XP_005648868.1|  Abce1 protein                                      234   3e-69   Coccomyxa subellipsoidea C-169
ref|XP_001913718.1|  ATP-binding cassette sub-family E member 1         223   4e-69   Entamoeba histolytica HM-1:IMSS
ref|XP_004359361.1|  RNaseL inhibitor-like protein                      235   4e-69   Cavenderia fasciculata
gb|EEC72923.1|  hypothetical protein OsI_06764                          236   6e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_002958474.1|  hypothetical protein VOLCADRAFT_121720             229   7e-69   Volvox carteri f. nagariensis
ref|XP_009205906.1|  PREDICTED: ATP-binding cassette sub-family E...    233   9e-69   Papio anubis [baboon]
gb|ABN11928.1|  putative ATP-binding cassette sub-family E member 1     228   1e-68   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|KFM79460.1|  ATP-binding cassette sub-family E member 1              234   1e-68   Stegodyphus mimosarum
ref|XP_004758181.1|  PREDICTED: ATP-binding cassette sub-family E...    232   1e-68   Mustela putorius furo [black ferret]
gb|AAH66836.1|  Abce1 protein                                           233   2e-68   Mus musculus [mouse]
emb|CAA52920.1|  2'-5' oligoadenylate binding protein                   228   2e-68   Homo sapiens [man]
ref|XP_009501163.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Phalacrocorax carbo [common cormorant]
gb|KFO70694.1|  ATP-binding cassette sub-family E member 1              233   2e-68   Cuculus canorus
ref|XP_010136758.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Buceros rhinoceros silvestris
ref|XP_008917678.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   
ref|XP_009687570.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    233   2e-68   Struthio camelus australis
ref|XP_007235762.1|  PREDICTED: ATP-binding cassette sub-family E...    227   2e-68   
ref|XP_009568558.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Cuculus canorus
gb|EHH53998.1|  hypothetical protein EGM_14727                          233   2e-68   Macaca fascicularis [crab eating macaque]
dbj|BAE89880.1|  unnamed protein product                                233   2e-68   Macaca fascicularis [crab eating macaque]
ref|XP_009278535.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Aptenodytes forsteri
gb|EHH26220.1|  hypothetical protein EGK_16133                          233   2e-68   Macaca mulatta [rhesus macaque]
ref|XP_008499007.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Calypte anna
ref|NP_001077154.1|  ATP-binding cassette sub-family E member 1         233   2e-68   Bos taurus [bovine]
ref|XP_010291764.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Phaethon lepturus
ref|XP_009889030.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Charadrius vociferus
gb|KFW96353.1|  ATP-binding cassette sub-family E member 1              233   2e-68   Phalacrocorax carbo [common cormorant]
ref|XP_009956414.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Leptosomus discolor
ref|XP_010011879.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Nestor notabilis
ref|XP_002188739.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Taeniopygia guttata
gb|AAS07031.1|  RNase L inhibitor                                       233   2e-68   Chlorocebus aethiops [African green monkey]
ref|XP_007127461.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   
ref|XP_005146619.1|  PREDICTED: ATP-binding cassette sub-family E...    233   2e-68   Melopsittacus undulatus
ref|XP_009574946.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Fulmarus glacialis
ref|XP_004606253.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Sorex araneus [Eurasian shrew]
gb|KFQ42390.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Nestor notabilis
ref|XP_005485380.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Zonotrichia albicollis
ref|XP_007189424.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Balaenoptera acutorostrata scammoni
ref|XP_003500814.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Cricetulus griseus [Chinese hamsters]
ref|XP_004485045.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    233   3e-68   Dasypus novemcinctus
ref|XP_009817785.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Gavia stellata
ref|XP_004655905.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Jaculus jaculus
ref|NP_002931.2|  ATP-binding cassette sub-family E member 1            233   3e-68   Homo sapiens [man]
ref|XP_004378910.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Trichechus manatus latirostris
ref|XP_004645502.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   
ref|XP_006906351.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Pteropus alecto
dbj|BAE39748.1|  unnamed protein product                                233   3e-68   Mus musculus [mouse]
dbj|BAE01051.1|  unnamed protein product                                233   3e-68   Macaca fascicularis [crab eating macaque]
ref|XP_010007234.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Chaetura pelagica
gb|KFW74048.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Manacus vitellinus
ref|XP_004316570.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   
ref|XP_008142077.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Eptesicus fuscus
gb|AAC24730.1|  RNAse L inhibitor                                       233   3e-68   Mus musculus [mouse]
ref|XP_006756018.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Myotis davidii
ref|NP_001101916.1|  ATP-binding cassette sub-family E member 1         233   3e-68   Rattus norvegicus [brown rat]
gb|AAP06039.1|  SJCHGC02444 protein                                     219   3e-68   Schistosoma japonicum
gb|KFV08643.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Pterocles gutturalis
gb|KGL97849.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Charadrius vociferus
gb|KFP79450.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Apaloderma vittatum
ref|XP_005864932.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Myotis brandtii
ref|XP_001501999.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Equus caballus [domestic horse]
ref|XP_004708755.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Echinops telfairi [lesser hedgehog tenrec]
gb|KFO91191.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Buceros rhinoceros silvestris
gb|KFP06257.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Calypte anna
ref|XP_003790241.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    233   3e-68   Otolemur garnettii
gb|KFO03636.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Balearica regulorum gibbericeps
gb|KFP68620.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Cariama cristata
ref|XP_002916281.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Ailuropoda melanoleuca
ref|XP_004420936.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFP27294.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Colius striatus
gb|KFM08216.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Aptenodytes forsteri
gb|KFV99662.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Eurypyga helias
ref|XP_003417547.1|  PREDICTED: ATP-binding cassette sub-family E...    233   3e-68   Loxodonta africana [African bush elephant]
gb|KFQ81264.1|  ATP-binding cassette sub-family E member 1              233   3e-68   Phaethon lepturus
ref|XP_009010373.1|  hypothetical protein HELRODRAFT_71728              229   4e-68   Helobdella robusta
gb|KFV64493.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Picoides pubescens
gb|KFP52898.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Cathartes aura
gb|KFO64898.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Corvus brachyrhynchos
ref|XP_004263650.1|  PREDICTED: ATP-binding cassette sub-family E...    233   4e-68   Orcinus orca [Orca]
gb|KFQ10304.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Haliaeetus albicilla
ref|XP_006872330.1|  PREDICTED: ATP-binding cassette sub-family E...    233   4e-68   Chrysochloris asiatica
gb|KFZ65502.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Antrostomus carolinensis
gb|KFV40051.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Gavia stellata
gb|KFQ26608.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Mesitornis unicolor
gb|KFP70085.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Acanthisitta chloris
gb|EMC81758.1|  ATP-binding cassette sub-family E member 1              233   4e-68   
gb|KFO20588.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Fukomys damarensis [Damara mole rat]
ref|NP_001006440.1|  ATP-binding cassette sub-family E member 1         232   4e-68   Gallus gallus [bantam]
gb|KFP19938.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Egretta garzetta
gb|KGL74311.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Tinamus guttatus
emb|CAJ18353.1|  RNase L inhibitor                                      232   4e-68   Gallus gallus [bantam]
gb|KFQ15564.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Leptosomus discolor
gb|KFP36487.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Chlamydotis macqueenii
gb|KFU86169.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Chaetura pelagica
ref|XP_003205467.1|  PREDICTED: ATP-binding cassette sub-family E...    232   4e-68   Meleagris gallopavo [common turkey]
gb|KFV91778.1|  ATP-binding cassette sub-family E member 1              233   4e-68   Fulmarus glacialis
ref|XP_004336916.1|  ribonuclease L inhibitor family protein            233   4e-68   Acanthamoeba castellanii str. Neff
ref|XP_006187279.1|  PREDICTED: ATP-binding cassette sub-family E...    232   4e-68   Camelus ferus
gb|EOB04954.1|  ATP-binding cassette sub-family E member 1              233   5e-68   Anas platyrhynchos [duck]
ref|XP_003773213.1|  PREDICTED: ATP-binding cassette sub-family E...    232   5e-68   
ref|XP_004347570.2|  ATP-binding cassette sub-family E member 1         233   5e-68   
ref|XP_005864931.1|  PREDICTED: ATP-binding cassette sub-family E...    233   5e-68   
ref|XP_006131844.1|  PREDICTED: ATP-binding cassette sub-family E...    232   5e-68   
ref|XP_007666625.1|  PREDICTED: ATP-binding cassette sub-family E...    232   5e-68   
gb|ERE79301.1|  ATP-binding cassette sub-family E member 1              233   6e-68   
emb|CBK20641.2|  unnamed protein product                                232   7e-68   
ref|XP_007897363.1|  PREDICTED: ATP-binding cassette sub-family E...    232   7e-68   
emb|CBK22812.2|  unnamed protein product                                232   7e-68   
ref|XP_635627.1|  RNaseL inhibitor-like protein                         231   8e-68   
ref|XP_009977160.1|  PREDICTED: ATP-binding cassette sub-family E...    231   9e-68   
gb|ELK17524.1|  ATP-binding cassette sub-family E member 1              233   1e-67   
ref|XP_006262799.1|  PREDICTED: ATP-binding cassette sub-family E...    231   1e-67   
ref|XP_006023793.1|  PREDICTED: ATP-binding cassette sub-family E...    231   1e-67   
dbj|BAE39466.1|  unnamed protein product                                231   1e-67   
gb|KDN42288.1|  P-loop containing nucleoside triphosphate hydrola...    225   1e-67   
ref|XP_008434241.1|  PREDICTED: ATP-binding cassette sub-family E...    225   1e-67   
gb|KFV04283.1|  ATP-binding cassette sub-family E member 1              231   1e-67   
ref|XP_006648544.1|  PREDICTED: ABC transporter E family member 2...    231   1e-67   
gb|ETE67898.1|  ATP-binding cassette sub-family E member 1              230   1e-67   
gb|EPQ06893.1|  ATP-binding cassette sub-family E member 1              233   1e-67   
ref|XP_007070201.1|  PREDICTED: ATP-binding cassette sub-family E...    231   2e-67   
ref|XP_005284350.1|  PREDICTED: ATP-binding cassette sub-family E...    231   2e-67   
gb|EJU02457.1|  hemin import ATP-binding protein hmuV                   227   2e-67   
ref|XP_003221699.1|  PREDICTED: ATP-binding cassette sub-family E...    231   2e-67   
ref|XP_003058469.1|  predicted protein                                  228   2e-67   
ref|XP_005327610.1|  PREDICTED: ATP-binding cassette sub-family E...    232   2e-67   
ref|XP_005327611.1|  PREDICTED: ATP-binding cassette sub-family E...    232   2e-67   
ref|XP_004952256.1|  PREDICTED: ABC transporter E family member 2...    231   2e-67   
ref|XP_007428690.1|  PREDICTED: ATP-binding cassette sub-family E...    230   3e-67   
gb|KDQ09355.1|  hypothetical protein BOTBODRAFT_529440                  226   3e-67   
ref|XP_005105420.1|  PREDICTED: ATP-binding cassette sub-family E...    230   3e-67   
gb|ETS04026.1|  P-loop containing nucleoside triphosphate hydrola...    221   3e-67   
ref|XP_009327022.1|  PREDICTED: ATP-binding cassette sub-family E...    230   3e-67   
emb|CEI99061.1|  Putative Translation initiation factor RLI1            226   3e-67   
gb|KDD74545.1|  hypothetical protein H632_c1239p0                       230   3e-67   
ref|XP_011449756.1|  PREDICTED: ATP-binding cassette sub-family E...    230   4e-67   
gb|AEE62378.1|  unknown                                                 230   4e-67   
emb|CEG63657.1|  Putative RNAse L inhibitor                             226   5e-67   
ref|XP_002121964.1|  PREDICTED: ATP-binding cassette sub-family E...    229   5e-67   
gb|KFH72616.1|  ABC transporter E family member 2                       229   6e-67   
ref|XP_008301422.1|  PREDICTED: ATP-binding cassette sub-family E...    225   7e-67   
gb|EIE88666.1|  translation initiation factor RLI1                      228   9e-67   
ref|XP_001182876.2|  PREDICTED: ATP-binding cassette sub-family E...    229   1e-66   
gb|EXX58363.1|  Rli1p                                                   227   1e-66   
ref|XP_003746536.1|  PREDICTED: ATP-binding cassette sub-family E...    228   1e-66   
ref|XP_002153953.1|  PREDICTED: ATP-binding cassette sub-family E...    228   1e-66   
gb|AHK05659.1|  ATP-binding cassette transporter sub-family E mem...    228   2e-66   
emb|CAA53972.1|  RNase L inhibitor                                      228   2e-66   
gb|EIE87499.1|  translation initiation factor RLI1                      228   2e-66   
emb|CDQ86105.1|  unnamed protein product                                228   2e-66   
ref|XP_006629561.1|  PREDICTED: ATP-binding cassette sub-family E...    228   2e-66   
ref|XP_002676216.1|  predicted protein                                  226   2e-66   
ref|NP_001133240.1|  ATP-binding cassette sub-family E member 1         228   2e-66   
ref|XP_010886612.1|  PREDICTED: ATP-binding cassette sub-family E...    228   2e-66   
ref|XP_011129482.1|  RNase L inhibitor ATP-binding cassette domai...    228   3e-66   
ref|XP_005704280.1|  ABC transporter, sub-family E, substrate-bin...    228   3e-66   
gb|KEQ99312.1|  hypothetical protein AUEXF2481DRAFT_169586              218   3e-66   
ref|XP_009050228.1|  hypothetical protein LOTGIDRAFT_142233             222   3e-66   
gb|EKC18713.1|  ATP-binding cassette sub-family E member 1              230   3e-66   
gb|ABR25404.1|  ATP binding cassette subfamily e- member 1              212   5e-66   
ref|XP_002506706.1|  predicted protein                                  227   5e-66   
gb|EPY26442.1|  ATP-binding protein cassette, sub-family E, member 1    223   6e-66   
ref|XP_002370987.1|  ABC transporter, putative                          227   6e-66   
ref|XP_003129218.3|  PREDICTED: ATP-binding cassette sub-family E...    226   6e-66   
ref|XP_008886417.1|  ATP-binding cassette sub-family E member 1, ...    227   6e-66   
ref|XP_005995611.1|  PREDICTED: ATP-binding cassette sub-family E...    226   7e-66   
gb|EPY32255.1|  ATP-binding protein cassette, sub-family E, member 1    223   8e-66   
ref|XP_001739023.1|  hypothetical protein                               221   9e-66   
gb|EXX58362.1|  Rli1p                                                   226   1e-65   
ref|NP_998216.2|  ATP-binding cassette sub-family E member 1            226   1e-65   
gb|AAZ06362.1|  ATP-binding cassette sub-family E member 1              226   1e-65   
gb|AAH45882.1|  ATP-binding cassette, sub-family E (OABP), member 1     226   1e-65   
ref|XP_007571922.1|  PREDICTED: ATP-binding cassette sub-family E...    224   1e-65   
ref|XP_009856396.1|  hypothetical protein NEUTE1DRAFT_150244            224   1e-65   
gb|KIM70757.1|  hypothetical protein SCLCIDRAFT_168710                  221   1e-65   
ref|XP_005713641.1|  ATP-binding cassette, sub-family E (RLI), me...    226   2e-65   
emb|CEG63656.1|  Putative YALI0A17941p                                  225   2e-65   
ref|XP_001848687.1|  ATP-binding cassette sub-family E member 1         225   2e-65   
gb|KFB42639.1|  AGAP002182-PA-like protein                              225   2e-65   
emb|CDS10188.1|  Putative Translation initiation factor RLI1            225   2e-65   
ref|XP_007004107.1|  hypothetical protein TREMEDRAFT_61598              212   2e-65   
ref|XP_308004.3|  AGAP002182-PA                                         225   2e-65   
ref|XP_004079653.1|  PREDICTED: ATP-binding cassette sub-family E...    225   2e-65   
gb|KFD69133.1|  hypothetical protein M514_18710                         226   2e-65   
ref|XP_005811478.1|  PREDICTED: ATP-binding cassette sub-family E...    225   2e-65   
ref|NP_001005628.1|  ATP-binding cassette, sub-family E (OABP), m...    225   2e-65   
ref|XP_968009.1|  PREDICTED: ATP-binding cassette sub-family E me...    225   3e-65   
ref|XP_004575910.1|  PREDICTED: ATP-binding cassette sub-family E...    225   3e-65   
ref|XP_005754138.1|  PREDICTED: ATP-binding cassette sub-family E...    224   3e-65   
ref|XP_009497210.1|  ABC transporter E family member 2                  225   3e-65   
ref|XP_003885554.1|  RNase L inhibitor, related                         225   3e-65   
gb|AFU72276.1|  ATP-binding cassette sub-family E member 1-like p...    216   3e-65   
ref|XP_003456493.1|  PREDICTED: ATP-binding cassette sub-family E...    224   3e-65   
ref|XP_001660605.1|  AAEL010059-PA                                      225   3e-65   
ref|XP_008183576.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    225   3e-65   
emb|CEP07445.1|  hypothetical protein                                   224   3e-65   
ref|XP_010749699.1|  PREDICTED: ATP-binding cassette sub-family E...    224   4e-65   
emb|CDH54417.1|  translation initiation factor rli1                     224   5e-65   
ref|XP_006689503.1|  hypothetical protein CANTEDRAFT_116344             218   5e-65   
emb|CBN79208.1|  RNase L inhibitor-like protein                         224   6e-65   
gb|KGG51205.1|  hypothetical protein DI09_41p170                        224   6e-65   
gb|ETN57992.1|  ATP-binding cassette sub-family E member 1              225   6e-65   
ref|XP_007272504.1|  translation initiation factor rli1                 224   7e-65   
ref|XP_004990715.1|  ABC transporter ABCE1                              224   8e-65   
gb|EPZ31898.1|  ABC transporter E family member 2                       224   8e-65   
gb|KIJ36745.1|  hypothetical protein M422DRAFT_50884                    218   1e-64   
ref|XP_002424051.1|  ATP-binding cassette subfamily E, member 1         223   1e-64   
gb|AAH95592.1|  ATP-binding cassette, sub-family E (OABP), member 1     223   1e-64   
ref|XP_963869.3|  translation initiation factor RLI1                    223   1e-64   
ref|NP_001080761.1|  ATP-binding cassette, sub-family E (OABP), m...    223   1e-64   
ref|XP_003978457.1|  PREDICTED: ATP-binding cassette sub-family E...    223   1e-64   
dbj|BAF92783.1|  RNase L inhibitor protein homolog                      210   1e-64   
ref|XP_003652202.1|  hypothetical protein THITE_2113416                 221   2e-64   
ref|XP_003701716.1|  PREDICTED: ATP-binding cassette sub-family E...    223   2e-64   
gb|EJW79146.1|  ABC transporter E family member 2                       216   2e-64   
gb|KDR80083.1|  hypothetical protein GALMADRAFT_1178266                 218   2e-64   
ref|XP_003394142.1|  PREDICTED: ATP-binding cassette sub-family E...    222   2e-64   
ref|XP_003487517.1|  PREDICTED: ATP-binding cassette sub-family E...    222   2e-64   
ref|XP_009549958.1|  ABC transporter                                    214   2e-64   
emb|CBY40205.1|  unnamed protein product                                223   2e-64   
gb|ENH77045.1|  translation initiation factor rli1                      223   3e-64   
dbj|BAF92784.1|  RNase L inhibitor protein homolog                      209   3e-64   
ref|XP_003348295.1|  hypothetical protein SMAC_02792                    222   3e-64   
ref|XP_009649388.1|  translation initiation factor RLI1                 222   3e-64   
ref|XP_008323898.1|  PREDICTED: ATP-binding cassette sub-family E...    222   3e-64   
gb|EPB83194.1|  translation initiation factor RLI1                      222   3e-64   
gb|AAS07030.1|  RNase L inhibitor                                       222   3e-64   
gb|KHJ78640.1|  hypothetical protein OESDEN_21737                       210   3e-64   
ref|XP_002773331.1|  68 kDa protein, putative                           222   3e-64   
ref|XP_003690922.1|  PREDICTED: ATP-binding cassette sub-family E...    222   4e-64   
ref|XP_011498090.1|  PREDICTED: ATP-binding cassette sub-family E...    222   4e-64   
gb|EPY24337.1|  ATP-binding protein cassette, sub-family E, member 1    222   4e-64   
ref|XP_001913806.1|  RNAseL inhibitor-like protein                      223   4e-64   
gb|KEP55020.1|  translation initiation factor RLI1                      222   4e-64   
ref|XP_011135124.1|  PREDICTED: ATP-binding cassette sub-family E...    222   4e-64   
gb|EUC65514.1|  translation initiation factor RLI1                      222   4e-64   
gb|KIJ99905.1|  hypothetical protein K443DRAFT_154965                   217   5e-64   
ref|XP_003572542.1|  PREDICTED: ABC transporter E family member 2...    221   5e-64   
emb|CAF92703.1|  unnamed protein product                                222   6e-64   
ref|XP_008594495.1|  ABC transporter                                    222   6e-64   
gb|KGQ10400.1|  Translation initiation factor RLI1                      222   6e-64   
dbj|BAF92781.1|  RNase L inhibitor protein homolog                      208   6e-64   
dbj|GAN01144.1|  translation initiation factor RLI1                     221   6e-64   
gb|EGI58223.1|  ATP-binding cassette sub-family E member 1              221   6e-64   
ref|NP_499717.1|  Protein ABCE-1                                        221   6e-64   
dbj|BAF92782.1|  RNase L inhibitor protein homolog                      208   6e-64   
ref|XP_011066035.1|  PREDICTED: ATP-binding cassette sub-family E...    221   7e-64   
ref|XP_007513426.1|  predicted protein                                  221   7e-64   
ref|XP_011163484.1|  PREDICTED: ATP-binding cassette sub-family E...    221   7e-64   
gb|EFX66734.1|  hypothetical protein DAPPUDRAFT_189585                  221   7e-64   
gb|EYE91200.1|  ABC transporter family protein                          216   7e-64   
ref|XP_462080.1|  DEHA2G12518p                                          221   8e-64   
gb|KIL00315.1|  hypothetical protein PAXRUDRAFT_98052                   219   8e-64   
ref|XP_002069035.1|  GK12286                                            221   8e-64   
gb|EPY39338.1|  ATP-binding protein cassette, sub-family E, member 1    222   8e-64   
gb|ADO33033.1|  pixie                                                   221   8e-64   
gb|KIM46884.1|  hypothetical protein M413DRAFT_63725                    219   9e-64   
ref|XP_001734610.1|  ABC transporter                                    222   9e-64   
ref|XP_003856882.1|  ABC transporter domain-containing protein          221   9e-64   
ref|XP_006670777.1|  RNase L inhibitor of the ABC superfamily, pu...    222   9e-64   
emb|CCW71791.1|  unnamed protein product                                222   1e-63   
dbj|BAF92785.1|  RNase L inhibitor protein homolog                      207   1e-63   
emb|CCO27826.1|  ATP-binding cassette sub-family E member 1 AltNa...    221   1e-63   
ref|XP_011201626.1|  PREDICTED: ATP-binding cassette sub-family E...    221   1e-63   
gb|KFD56208.1|  hypothetical protein M513_02986                         227   1e-63   
ref|XP_011350339.1|  PREDICTED: ATP-binding cassette sub-family E...    221   1e-63   
ref|XP_002786412.1|  68 kDa protein, putative                           221   1e-63   
ref|XP_004525604.1|  PREDICTED: ATP-binding cassette sub-family E...    221   1e-63   
ref|XP_011350337.1|  PREDICTED: ATP-binding cassette sub-family E...    220   2e-63   
ref|XP_011196211.1|  PREDICTED: ATP-binding cassette sub-family E...    220   2e-63   
gb|KIO14364.1|  hypothetical protein M404DRAFT_121664                   218   2e-63   
ref|XP_001608142.1|  PREDICTED: ATP-binding cassette sub-family E...    220   2e-63   
gb|KIN01923.1|  hypothetical protein OIDMADRAFT_28055                   219   2e-63   
gb|KDE07666.1|  translation initiation factor RLI1                      220   2e-63   
ref|XP_007372354.1|  putative ATP-binding cassette sub-family E m...    214   2e-63   
gb|EPQ67119.1|  iron-sulfur protein                                     215   2e-63   
ref|XP_007596669.1|  translation initiation factor RLI1                 220   2e-63   
gb|KHJ75542.1|  ABC transporter, ATP-binding protein                    210   2e-63   
gb|EFN63715.1|  ATP-binding cassette sub-family E member 1              218   2e-63   
ref|XP_002047872.1|  GJ13683                                            220   2e-63   
ref|XP_001984558.1|  GH14962                                            220   2e-63   
emb|CCW63353.1|  unnamed protein product                                221   3e-63   
gb|ESL11583.1|  ribonuclease L inhibitor                                220   3e-63   
ref|XP_002093378.1|  GE21271                                            220   3e-63   
ref|XP_002009032.1|  GI11489                                            220   3e-63   
ref|NP_648272.1|  pixie, isoform A                                      220   3e-63   
ref|XP_001956850.1|  GF10137                                            220   3e-63   
ref|XP_001556918.1|  hypothetical protein BC1G_04634                    219   3e-63   
gb|EKG01052.1|  ribonuclease L inhibitor, putative,ATP-binding ca...    220   3e-63   
ref|XP_001421010.1|  predicted protein                                  219   3e-63   
ref|XP_004202772.1|  Piso0_001629                                       219   3e-63   
gb|KIJ09767.1|  hypothetical protein PAXINDRAFT_172366                  216   3e-63   
emb|CCD52271.1|  similar to ATP-binding cassette sub-family E mem...    219   3e-63   
gb|KHC40377.1|  translation initiation factor RLI1                      219   3e-63   
ref|XP_005183309.1|  PREDICTED: ATP-binding cassette sub-family E...    219   3e-63   
ref|XP_721532.1|  RNAse L inhibitor-type ATP binding cassette pro...    219   4e-63   
ref|XP_002416987.1|  ABC-family memebr, APTPase, iron-sulfur prot...    219   4e-63   
emb|CCF38800.1|  translation initiation factor RLI1                     219   4e-63   
gb|EPY39001.1|  ATP-binding protein cassette, sub-family E, member 1    223   4e-63   
ref|NP_001036911.1|  ribonuclease L inhibitor homolog                   219   4e-63   
emb|CCA67966.1|  probable RLI1-protein promoting preinitiation co...    219   4e-63   
emb|CCI47858.1|  unnamed protein product                                222   4e-63   
emb|CCF52067.1|  probable RLI1-Protein promoting preinitiation co...    219   5e-63   
dbj|GAC99212.1|  RNase L inhibitor                                      219   5e-63   
gb|KIL65454.1|  hypothetical protein M378DRAFT_77004                    217   5e-63   
emb|CEJ95089.1|  Putative ATP-binding cassette sub-family E member 1    219   5e-63   
ref|XP_011300503.1|  PREDICTED: ATP-binding cassette sub-family E...    219   5e-63   
ref|XP_004202149.1|  Piso0_001629                                       219   5e-63   
gb|EHJ73926.1|  ribonuclease L inhibitor-like protein                   219   5e-63   
emb|CBQ73757.1|  probable RLI1-Protein promoting preinitiation co...    219   6e-63   
ref|XP_011389740.1|  putative protein promoting preinitiation com...    219   6e-63   
ref|XP_007771151.1|  hemin import ATP-binding protein hmuV              216   6e-63   
emb|CBY13441.1|  unnamed protein product                                219   7e-63   
dbj|GAK64634.1|  RNAse l inhibitor-type atp binding cassette protein    218   7e-63   
gb|EMR81784.1|  putative translation initiation factor rli1 protein     219   7e-63   
gb|EST04914.1|  RNAse L inhibitor                                       218   7e-63   
emb|CCM04394.1|  predicted protein                                      218   8e-63   
ref|XP_001354175.2|  GA19033                                            218   8e-63   
gb|KDN69856.1|  putative ABC transporter                                218   8e-63   
ref|XP_007882292.1|  hypothetical protein PFL1_06558                    218   8e-63   



>ref|XP_008374098.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Malus domestica]
Length=251

 Score =   271 bits (692),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  117  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  176

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEGRPS+DCIAN PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  177  ATYLADRVIVYEGRPSIDCIANCPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  236

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  237  DREQKAAGSYYYLDD  251



>gb|KHG03576.1| ABC transporter E family member 2 [Gossypium arboreum]
Length=410

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  276  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  335

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDCIAN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  336  ATYLADRVIVYEGKPSVDCIANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  395

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  396  DREQKSAGSYYYLDD  410


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  25   GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  83

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  84   LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  137



>ref|XP_009334167.1| PREDICTED: ABC transporter E family member 2-like isoform X6 
[Pyrus x bretschneideri]
Length=251

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  117  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  176

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  177  ATYLADRVIVYEGKPSIDCTANCPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  236

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  237  DREQKAAGSYYYLDD  251



>gb|AAO32059.1| RNase L inhibitor-like protein [Brassica rapa subsp. pekinensis]
Length=176

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADI+LIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  42   GELQRVALALCLGKPADIHLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  101

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIAN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  102  ATYLADRVIVYEGQPSIDCIANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  161

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  162  DREQKSAGSYYYLDD  176



>emb|CDP07208.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 135/135 (100%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEGRPS+DC+ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  532  ATYLADRVIVYEGRPSIDCVANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>ref|XP_007040862.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao]
 gb|EOY25363.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao]
Length=605

 Score =   274 bits (701),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGKPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|KJB25121.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=605

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGKPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010054013.1| PREDICTED: ABC transporter E family member 2 [Eucalyptus grandis]
 gb|KCW78398.1| hypothetical protein EUGRSUZ_D02563 [Eucalyptus grandis]
Length=605

 Score =   274 bits (700),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINK+DSTK
Sbjct  531  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKVDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 5/127 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++      
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFKVAETPQ  338

Query  427  DSTKDRE  407
            + T+D E
Sbjct  339  EVTEDVE  345



>ref|XP_011082187.1| PREDICTED: ABC transporter E family member 2 [Sesamum indicum]
Length=606

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  532  ATYLADRVIVYEGKPSIDCVANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P V  +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>ref|XP_010240626.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Brachypodium distachyon]
Length=251

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR+AL LCLG+PADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  117  GELQRMALCLCLGQPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  176

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+VYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  177  ATYLADKVVVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  236

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  237  DREQKSAGSYYYLDD  251



>gb|ABR18176.1| unknown [Picea sitchensis]
Length=605

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEGRPSVDC+AN+PQSL TGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGRPSVDCVANTPQSLQTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  591  DREQKNAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFIFCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|AIU41641.1| ABC transporter family protein [Hevea brasiliensis]
Length=605

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/135 (97%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEGRPSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGRPSVDCAANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_004512327.1| PREDICTED: ABC transporter E family member 2-like [Cicer arietinum]
Length=606

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAF+VEHDFIM
Sbjct  472  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAKKTAFIVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  532  ATYLADRVIVYEGKPSIDCIANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  592  DREQKNAGSYYYLDD  606


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR D   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLSGFVPTENLRFREDSLTFK  332



>dbj|BAD94217.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
Length=357

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  223  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  282

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  283  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  342

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  343  DREQKSAGSYYYLDD  357



>gb|EPS64099.1| hypothetical protein M569_10682, partial [Genlisea aurea]
Length=608

 Score =   272 bits (695),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  474  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  533

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  534  ATYLADRVIVYEGKPSLDCVANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  593

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  594  DREQKSAGSYYYLDD  608


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  223  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  281

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P V  +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  282  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  335



>gb|EYU37486.1| hypothetical protein MIMGU_mgv1a003146mg [Erythranthe guttata]
Length=605

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGKPSIDCTANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  591  DREQKNAGSYYYLDD  605


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD  QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVRQRLKAAQVI-RSLLRPTSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P V  +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda]
 gb|ERN20089.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda]
Length=606

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  532  ATYLADRVIVYEGKPSVDCTANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D +    G+P +  +   P S+  G+N+FL+      ++ FR +   ++   N  
Sbjct  280  LDYLSDFICCLYGKPGIYGVVTLPFSVREGINIFLAGFVPTENLRFRDEYLTFKVAENPQ  339

Query  427  DSTKD  413
            +S ++
Sbjct  340  ESAEE  344



>ref|XP_007222049.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica]
 gb|EMJ23248.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica]
Length=605

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGKPSIDCVANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008221272.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
 ref|XP_008221273.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
 ref|XP_008221274.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
Length=605

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGKPSIDCVANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_011013966.1| PREDICTED: ABC transporter E family member 2-like [Populus euphratica]
 ref|XP_011013967.1| PREDICTED: ABC transporter E family member 2-like [Populus euphratica]
Length=605

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGQPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKTAGSYYYLDD  605


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L A     VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRANSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLSGFVPTENLRFRDESLTFK  332



>ref|XP_002303221.1| RNase L inhibitor family protein [Populus trichocarpa]
 gb|EEE78200.1| RNase L inhibitor family protein [Populus trichocarpa]
Length=611

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  477  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  536

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  537  ATYLADRVIVYEGQPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  596

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  597  DREQKTAGSYYYLDD  611


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L A     VVEHD  +
Sbjct  226  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRANSYVIVVEHDLSV  284

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  285  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLSGFVPTENLRFRDESLTFK  338



>ref|XP_006385402.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa]
 gb|ERP63199.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa]
Length=605

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGQPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKTAGSYYYLDD  605


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L A     VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRANSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLSGFVPTENLRFRDESLTFK  332



>ref|XP_010099717.1| ABC transporter E family member 2 [Morus notabilis]
 gb|EXB80294.1| ABC transporter E family member 2 [Morus notabilis]
Length=605

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEGRPS+DC ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGRPSIDCTANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010690817.1| PREDICTED: ABC transporter E family member 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690818.1| PREDICTED: ABC transporter E family member 2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGTPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AG+YYYLDD
Sbjct  591  DREQKSAGTYYYLDD  605


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQSAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010272250.1| PREDICTED: ABC transporter E family member 2 [Nelumbo nucifera]
 ref|XP_010272251.1| PREDICTED: ABC transporter E family member 2 [Nelumbo nucifera]
Length=605

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGKPSIDCTANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010323314.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
 ref|XP_010323315.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
Length=605

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PS+DC+AN+PQSLLTGMNLFLSHL+ITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGTPSIDCVANAPQSLLTGMNLFLSHLNITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_009380578.1| PREDICTED: ABC transporter E family member 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380579.1| PREDICTED: ABC transporter E family member 2 [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   269 bits (688),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIAN+PQSL++GMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGKPSVDCIANAPQSLVSGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P    +   P S+  G+N+FL+
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLA  314



>ref|XP_009409468.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=410

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  276  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  335

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG PS+DC AN+PQSL++GMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  336  ATYLADKVIVYEGMPSIDCTANAPQSLVSGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  395

Query  415  DREQKNAGSYYYLD  374
            DREQK AGSYYYLD
Sbjct  396  DREQKAAGSYYYLD  409


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  25   GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  83

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  84   LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  137



>ref|XP_004291224.1| PREDICTED: ABC transporter E family member 2 [Fragaria vesca 
subsp. vesca]
Length=604

 Score =   268 bits (686),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  470  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHLDITFRRDPTN+RPRINK++STK
Sbjct  530  ATYLADRVIVYEGKPSIDCTANCPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKMNSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  590  DREQKNAGSYYYLDD  604


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVCIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>emb|CAN65893.1| hypothetical protein VITISV_021090 [Vitis vinifera]
Length=599

 Score =   268 bits (686),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  525  ATYLADRVIVYEGQPSVDCTANTPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  584

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  585  DREQKSAGSYYYLDD  599


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  214  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  272

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  273  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLTFK  326



>ref|XP_010275149.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
 ref|XP_010275150.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
 ref|XP_010275151.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
Length=605

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN+PQSLLTGMNLFLSHL+ITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGKPSVDCSANAPQSLLTGMNLFLSHLNITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKTAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|KDP42075.1| hypothetical protein JCGZ_01863 [Jatropha curcas]
Length=605

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VYEG+PSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINK DSTK
Sbjct  531  ATYLADRVVVYEGQPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKKDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKTAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAEVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P    +   P S+  G+N+FL+
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLA  314



>ref|XP_010436484.1| PREDICTED: ABC transporter E family member 2-like [Camelina sativa]
Length=566

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  432  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  491

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  492  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  551

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  552  DREQKNAGSYYYLDD  566


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 66/119 (55%), Gaps = 5/119 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQHAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDST  419
              YL+D +  +        +A +PQ     +  +  +   T  +   N+R R+++ + T
Sbjct  279  LDYLSDFICFF----FCSKVAETPQESAEEIQSYARYKYPTMTKTQGNFRLRVSEGEFT  333



>ref|XP_002271392.1| PREDICTED: ABC transporter E family member 2 [Vitis vinifera]
Length=605

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSVDCTANTPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLTFK  332



>ref|XP_009334125.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009334160.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Pyrus x bretschneideri]
Length=268

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 131/152 (86%), Gaps = 17/152 (11%)
 Frame = -3

Query  775  GEVQRVALALCLGK-----------------PADIYLIDEPSAYLDSEQRIVASKVIKRF  647
            GE+QRVAL LCLGK                 PADIYLIDEPSAYLDSEQRIVASKVIKRF
Sbjct  117  GELQRVALCLCLGKISFDEYILMSASIYSMQPADIYLIDEPSAYLDSEQRIVASKVIKRF  176

Query  646  ILHAKKTAFVVEHDFIMATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFR  467
            ILHAKKTAFVVEHDFIMATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHLDITFR
Sbjct  177  ILHAKKTAFVVEHDFIMATYLADRVIVYEGKPSIDCTANCPQSLLTGMNLFLSHLDITFR  236

Query  466  RDPTNYRPRINKLDSTKDREQKNAGSYYYLDD  371
            RDPTNYRPRINKL+STKDREQK AGSYYYLDD
Sbjct  237  RDPTNYRPRINKLESTKDREQKAAGSYYYLDD  268



>ref|XP_003537713.1| PREDICTED: ABC transporter E family member 2-like [Glycine max]
Length=606

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIAN+PQSLL+GMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  532  ATYLADRVIVYEGQPSIDCIANTPQSLLSGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR D   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDDSLTFK  332



>ref|XP_008387874.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Malus 
domestica]
Length=605

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGKPSIDCTANCPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44138.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=584

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  450  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  509

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC+AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  510  ATYLADRVIVYEGQPSVDCVANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  569

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  570  DRDQKAAGSYYYLDD  584


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  199  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  257

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   +R
Sbjct  258  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFR  311



>ref|XP_010536040.1| PREDICTED: ABC transporter E family member 2 [Tarenaya hassleriana]
 ref|XP_010536048.1| PREDICTED: ABC transporter E family member 2 [Tarenaya hassleriana]
Length=605

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC ANSPQSLL+GMNLFLSHL+ITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANSPQSLLSGMNLFLSHLNITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRQNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>emb|CBI29193.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  491  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  550

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  551  ATYLADRVIVYEGQPSVDCTANTPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  610

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  611  DREQKSAGSYYYLDD  625


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  240  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  298

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  299  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLTFK  352



>ref|XP_009770922.1| PREDICTED: ABC transporter E family member 2 [Nicotiana sylvestris]
 ref|XP_009770923.1| PREDICTED: ABC transporter E family member 2 [Nicotiana sylvestris]
Length=606

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  472  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PS+DC+AN+PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  532  ATYLADRVIVYEGTPSIDCVANAPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communis]
 gb|EEF34119.1| rnase l inhibitor, putative [Ricinus communis]
Length=591

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  457  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  516

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  517  ATYLADRVIVYEGKPSLDCTANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  576

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  577  DRDQKAAGSYYYLDD  591


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  206  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAARVI-RSLLKPNSYVIVVEHDLSV  264

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   +R
Sbjct  265  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLTFR  318



>ref|XP_009602236.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602237.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602238.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=606

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  472  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PS+DC+AN+PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  532  ATYLADRVIVYEGTPSIDCVANAPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>ref|XP_007217624.1| hypothetical protein PRUPE_ppa015638mg [Prunus persica]
 gb|EMJ18823.1| hypothetical protein PRUPE_ppa015638mg [Prunus persica]
Length=601

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  467  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  526

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIANSPQSLLTGMNLFLS LDITFRRDPTNYRPRINKL+STK
Sbjct  527  ATYLADKVIVYEGKPSVDCIANSPQSLLTGMNLFLSQLDITFRRDPTNYRPRINKLNSTK  586

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  587  DREQKAAGSYYYLDD  601


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + ADIY+ DEPS+YLD +QR+ A+KVI R ++       VVEHD  +
Sbjct  220  GELQRFAIAFLALQKADIYMFDEPSSYLDVKQRLKAAKVI-RSLIRPDSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDHICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>emb|CDX76485.1| BnaA08g09150D [Brassica napus]
Length=605

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIAN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCIANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_003592706.1| RNase L inhibitor-like protein [Medicago truncatula]
 ref|XP_003636730.1| RNase L inhibitor-like protein [Medicago truncatula]
 gb|AES62957.1| RNase L inhibitor ABC domain protein [Medicago truncatula]
Length=606

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAF+VEHDFIM
Sbjct  472  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFIVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  532  ATYLADRVIVYEGQPSIDCTANCPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  592  DREQKNAGSYYYLDD  606


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P    +   P S+  G+N+FLS
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLS  314



>ref|XP_009108421.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
 ref|XP_009108422.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
 ref|XP_009108424.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIAN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCIANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       V EHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVEEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|KEH40226.1| RNase L inhibitor ABC superfamily protein, putative [Medicago 
truncatula]
Length=527

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAF+VEHDFIM
Sbjct  393  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFIVEHDFIM  452

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PS++C AN PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  453  ATYLADKVIVYEGQPSINCTANCPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  512

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  513  DREQKNAGSYYYLDD  527


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  141  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSFVIVVEHDLSV  199

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P V  +   P S+  G+N+FLS
Sbjct  200  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLS  235



>emb|CDX99388.1| BnaC01g11640D [Brassica napus]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>emb|CDY05197.1| BnaC05g46060D [Brassica napus]
 emb|CDX78930.1| BnaA01g09970D [Brassica napus]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_007216970.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica]
 ref|XP_008227942.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
 ref|XP_008227943.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
 gb|EMJ18169.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLG+PADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGRPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGKPSIDCTANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L A     VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRANSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010439735.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
 ref|XP_010439736.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Camelina 
sativa]
 ref|XP_010449372.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
 ref|XP_010449373.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Camelina 
sativa]
 ref|XP_010449374.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  591  DREQKNAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQHAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008444234.1| PREDICTED: ABC transporter E family member 2 [Cucumis melo]
 ref|XP_008444235.1| PREDICTED: ABC transporter E family member 2 [Cucumis melo]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN PQSLLTGMNLFLSHLDITFRRDPTNYRPRINK+DS K
Sbjct  531  ATYLADRVIVYEGQPSVDCTANCPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKVDSAK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_004150248.1| PREDICTED: ABC transporter E family member 2-like [Cucumis sativus]
 ref|XP_004162070.1| PREDICTED: ABC transporter E family member 2-like [Cucumis sativus]
 gb|KGN54000.1| hypothetical protein Csa_4G252930 [Cucumis sativus]
Length=605

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC AN PQSLLTGMNLFLSHLDITFRRDPTNYRPRINK+DS K
Sbjct  531  ATYLADRVIVYEGQPSVDCTANCPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKVDSAK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006385159.1| RNase L inhibitor family protein [Populus trichocarpa]
 gb|ERP62956.1| RNase L inhibitor family protein [Populus trichocarpa]
Length=603

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  469  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A+YLADRVIVYEG+PSVDC ANSPQSLLTGMNLFLSHLDITFRRDP+NYRPRINKL+STK
Sbjct  529  ASYLADRVIVYEGQPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPSNYRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  589  DREQKAAGSYYYLDD  603


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  218  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  276

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  277  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLSGFVPTENLRFRDESLTFK  330



>ref|XP_011028506.1| PREDICTED: ABC transporter E family member 2 [Populus euphratica]
Length=605

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A+YLADRVIVYEG+PSVDC ANSPQSLLTGMNLFLSHLDITFRRDP+NYRPRINKL+STK
Sbjct  531  ASYLADRVIVYEGQPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPSNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLSGFVPTENLRFRDESLTFK  332



>gb|KDO72263.1| hypothetical protein CISIN_1g040300mg [Citrus sinensis]
Length=605

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC+AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGQPSVDCVANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  591  DRDQKAAGSYYYLDD  605


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   +R
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFR  332



>ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 ref|XP_006430900.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 ref|XP_006482353.1| PREDICTED: ABC transporter E family member 2-like [Citrus sinensis]
 gb|ESR44139.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44140.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=605

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSVDC+AN+PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  531  ATYLADRVIVYEGQPSVDCVANAPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  591  DRDQKAAGSYYYLDD  605


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   +R
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFR  332



>emb|CDX98609.1| BnaA03g43940D [Brassica napus]
Length=605

 Score =   266 bits (681),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCVANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLTFK  332



>emb|CDY01588.1| BnaC07g35780D [Brassica napus]
Length=605

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCVANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008801480.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801482.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801483.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801484.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
Length=605

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIAN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGKPSVDCIANAPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_009409469.1| PREDICTED: ABC transporter E family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008227935.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Prunus mume]
Length=589

 Score =   266 bits (680),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL +CLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  455  GELQRVALCVCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  514

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIANSPQSLLTGMNLFLS LDITFRRDPTNYRPRINKL+STK
Sbjct  515  ATYLADKVIVYEGKPSVDCIANSPQSLLTGMNLFLSQLDITFRRDPTNYRPRINKLNSTK  574

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  575  DREQKAAGSYYYLDD  589


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + ADIY+ DEPS+YLD +QR+ A+KVI R ++       VVEHD  +
Sbjct  208  GELQRFAIAFLALQKADIYMFDEPSSYLDVKQRLKAAKVI-RSLIGPDSYVIVVEHDLSV  266

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  267  LDYLSDHICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  320



>gb|KJB25125.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=614

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 134/144 (93%), Gaps = 9/144 (6%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL---------SHLDITFRRDPTNYRP  443
            ATYLADRVIVYEG+PSVDCIANSPQSLLTGMNLFL         SHLDITFRRDPTNYRP
Sbjct  531  ATYLADRVIVYEGKPSVDCIANSPQSLLTGMNLFLSVSFAAVAPSHLDITFRRDPTNYRP  590

Query  442  RINKLDSTKDREQKNAGSYYYLDD  371
            RINKLDSTKDREQK+AGSYYYLDD
Sbjct  591  RINKLDSTKDREQKSAGSYYYLDD  614


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008227934.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Prunus mume]
Length=599

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL +CLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALCVCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIANSPQSLLTGMNLFLS LDITFRRDPTNYRPRINKL+STK
Sbjct  525  ATYLADKVIVYEGKPSVDCIANSPQSLLTGMNLFLSQLDITFRRDPTNYRPRINKLNSTK  584

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  585  DREQKAAGSYYYLDD  599


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + ADIY+ DEPS+YLD +QR+ A+KVI R ++       VVEHD  +
Sbjct  218  GELQRFAIAFLALQKADIYMFDEPSSYLDVKQRLKAAKVI-RSLIGPDSYVIVVEHDLSV  276

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  277  LDYLSDHICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  330



>ref|XP_004979432.1| PREDICTED: ABC transporter E family member 2-like [Setaria italica]
Length=604

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DCIAN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGRPSIDCIANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008227933.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Prunus mume]
Length=601

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL +CLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  467  GELQRVALCVCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  526

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIANSPQSLLTGMNLFLS LDITFRRDPTNYRPRINKL+STK
Sbjct  527  ATYLADKVIVYEGKPSVDCIANSPQSLLTGMNLFLSQLDITFRRDPTNYRPRINKLNSTK  586

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  587  DREQKAAGSYYYLDD  601


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + ADIY+ DEPS+YLD +QR+ A+KVI R ++       VVEHD  +
Sbjct  220  GELQRFAIAFLALQKADIYMFDEPSSYLDVKQRLKAAKVI-RSLIGPDSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDHICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|KHN05542.1| ABC transporter E family member 2 [Glycine soja]
Length=684

 Score =   268 bits (684),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  550  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAKKTAFVVEHDFIM  609

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIAN+PQSLL+GMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  610  ATYLADRVIVYEGQPSIDCIANTPQSLLSGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  669

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  670  DREQKSAGSYYYLDD  684


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR D   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDDSLTFK  332



>ref|XP_006359955.1| PREDICTED: ABC transporter E family member 2-like [Solanum tuberosum]
Length=606

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  472  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PS+DC+AN+PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  532  ATYLADRVIVYEGTPSIDCVANAPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD  QR+ A++V+ R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVRQRLKAAQVV-RSLLRPDSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>ref|XP_006286029.1| hypothetical protein CARUB_v10007560mg [Capsella rubella]
 gb|EOA18927.1| hypothetical protein CARUB_v10007560mg [Capsella rubella]
Length=605

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010529268.1| PREDICTED: ABC transporter E family member 2-like [Tarenaya hassleriana]
Length=605

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC ANSPQSLL+GMNLFLSHL+ITFRRDPTNYRPRINKL STK
Sbjct  531  ATYLADRVIVYEGQPSLDCTANSPQSLLSGMNLFLSHLNITFRRDPTNYRPRINKLGSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|AGC70150.1| ABC transporter E family member 2 protein [Cardamine hirsuta]
Length=605

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006366958.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Solanum tuberosum]
 ref|XP_006366959.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Solanum tuberosum]
 ref|XP_006366960.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Solanum tuberosum]
Length=605

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PS+DC AN+PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGTPSIDCNANAPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>emb|CDY09282.1| BnaC03g63120D [Brassica napus]
Length=595

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  461  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  520

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DCIAN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  521  ATYLADRVIVYEGQPSIDCIANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  580

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AG YYYLDD
Sbjct  581  DREQKSAGLYYYLDD  595


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  210  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  268

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  269  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  322



>ref|XP_010692184.1| PREDICTED: ABC transporter E family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=605

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VYEG PSVDC AN+PQSLL GMNLFLSHLDITFRRDPTNYRPRINK+DSTK
Sbjct  531  ATYLADRVVVYEGTPSVDCTANTPQSLLNGMNLFLSHLDITFRRDPTNYRPRINKVDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AG+YYYLDD
Sbjct  591  DREQKFAGTYYYLDD  605


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   +  +IY+ DEPS+YLD +QR+ A+KVI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAMQSGEIYMFDEPSSYLDVKQRLKAAKVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_009137000.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137001.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137002.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137003.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
Length=605

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 133/135 (99%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPADIYLIDEPSAYLDSEQRIVASK IKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKAIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC+AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCVANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLTFK  332



>ref|XP_002862248.1| hypothetical protein ARALYDRAFT_921009 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38506.1| hypothetical protein ARALYDRAFT_921009 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  91   GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  150

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+S K
Sbjct  151  ATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESIK  210

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  211  DKEQKTAGSYYYLDD  225



>gb|KEH40227.1| RNase L inhibitor ABC superfamily protein, putative [Medicago 
truncatula]
Length=607

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAF+VEHDFIM
Sbjct  473  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFIVEHDFIM  532

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PS++C AN PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  533  ATYLADKVIVYEGQPSINCTANCPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  592

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  593  DREQKNAGSYYYLDD  607


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSFVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P V  +   P S+  G+N+FLS
Sbjct  280  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLS  315



>ref|XP_008655353.1| PREDICTED: ABC transporter E family member 2 isoform X3 [Zea 
mays]
 ref|XP_008655356.1| PREDICTED: ABC transporter E family member 2 isoform X3 [Zea 
mays]
 ref|XP_008655358.1| PREDICTED: ABC transporter E family member 2 isoform X3 [Zea 
mays]
 tpg|DAA45214.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
Length=550

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  416  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  475

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  476  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  535

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  536  DREQKSAGSYYYLDD  550


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  166  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  224

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  225  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  278



>emb|CAA16710.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 emb|CAB78923.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
Length=600

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  466  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  525

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  526  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  585

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  586  DREQKSAGSYYYLDD  600


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_002468219.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor]
 gb|EER95217.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor]
Length=604

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006662991.1| PREDICTED: ABC transporter E family member 2-like [Oryza brachyantha]
Length=604

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+I++ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIFMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|NP_001068062.1| Os11g0546000 [Oryza sativa Japonica Group]
 gb|ABA94220.1| ATP-binding cassette sub-family E member 1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28425.1| Os11g0546000 [Oryza sativa Japonica Group]
Length=604

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+I++ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIFMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008380283.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
 ref|XP_008380284.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
Length=605

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+ S+DC AN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQASIDCTANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQHAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_009333973.1| PREDICTED: ABC transporter E family member 2 [Pyrus x bretschneideri]
 ref|XP_009333974.1| PREDICTED: ABC transporter E family member 2 [Pyrus x bretschneideri]
Length=605

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+ S+DC AN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQASIDCTANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQHAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006413992.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum]
 gb|ESQ55445.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum]
Length=605

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_007158074.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris]
 gb|ESW30068.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris]
Length=606

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRI A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIHAAKVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY G+PS+DCIANSPQSLL+GMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  532  ATYLADRVIVYAGQPSIDCIANSPQSLLSGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  592  DREQKSAGSYYYLDD  606


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR D   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDDSLTFK  332



>ref|XP_010466556.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=251

 Score =   253 bits (646),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  117  GERQRVAITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  176

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P+V C A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  177  ATYLADKVIVYEGQPAVKCTAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  236

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  237  DREQKLAGSYYFLDD  251



>ref|XP_008655350.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Zea 
mays]
Length=553

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  419  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  478

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  479  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  538

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  539  DREQKSAGSYYYLDD  553


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  169  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  227

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  228  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  281



>ref|XP_009349643.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349644.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349645.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349646.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
Length=605

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+ S+DC AN+PQSLLTGMNLFLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQASIDCTANAPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P    +   P S+  G+N+FL+
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLA  314



>ref|NP_193656.2| RNAse l inhibitor protein 2 [Arabidopsis thaliana]
 sp|Q8LPJ4.1|AB2E_ARATH RecName: Full=ABC transporter E family member 2; Short=ABC transporter 
ABCE.2; Short=AtABCE2; AltName: Full=RNase L inhibitor-like 
protein 2; Short=AtRLI2; Short=AthaRLI2 [Arabidopsis 
thaliana]
 gb|AAM20548.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 gb|AAN15617.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 dbj|BAE99009.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 gb|AEE84160.1| RNAse l inhibitor protein 2 [Arabidopsis thaliana]
Length=605

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC AN PQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADRVIVYEGQPSIDCTANCPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  591  DREQKSAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008660181.1| PREDICTED: ABC transporter E family member 2-like [Zea mays]
 gb|AFW88470.1| hypothetical protein ZEAMMB73_854523 [Zea mays]
Length=604

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGRPSIDCSANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>gb|KEH28590.1| RNase L inhibitor ABC domain protein [Medicago truncatula]
Length=600

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRV L LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  466  GELQRVYLCLCLGKPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAKKTAFVVEHDFIM  525

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+DC ANSPQSLLTGMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  526  ATYLADRVIVYEGQPSIDCTANSPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  585

Query  415  DREQKNAGSYYYLDD  371
            DREQK AG+YYYLDD
Sbjct  586  DREQKLAGTYYYLDD  600


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + A+IY+ DEPS+YLD +QR+ A++V++  + H      VVEHD  +
Sbjct  216  GELQRFAIAGIAIQNAEIYMFDEPSSYLDVKQRLKAAQVVRSLLRH-NSYVIVVEHDLSV  274

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G P V  +   P S+  G+N+FLS      ++ FR D   ++
Sbjct  275  LDYLSDFICCLYGTPGVYGVVTLPFSVREGINIFLSGFVPTENLRFREDSLTFK  328



>ref|XP_008655346.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Zea 
mays]
 tpg|DAA45212.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
 tpg|DAA45213.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
Length=604

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  530  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_009409466.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=605

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG PS+DC AN+PQSL++GMNLFLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGMPSIDCTANAPQSLVSGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLD  374
            DREQK AGSYYYLD
Sbjct  591  DREQKAAGSYYYLD  604


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_003577489.1| PREDICTED: ABC transporter E family member 2 [Brachypodium distachyon]
Length=604

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGR S+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  530  ATYLADKVIVYEGRASIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  590  DREQKNAGSYYYLDD  604


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L +     VVEHD  +
Sbjct  220  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRSNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010235001.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Brachypodium distachyon]
Length=249

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVAL LCLGKPADIYLIDEPSA LDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  117  GERQRVALCLCLGKPADIYLIDEPSASLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  176

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+V+EGRPSVDC AN+PQSL +GMN FLSHLDITFRRDPTNYRPRINKL STK
Sbjct  177  ATYLADKVVVFEGRPSVDCTANAPQSLQSGMNKFLSHLDITFRRDPTNYRPRINKLGSTK  236

Query  415  DREQKNAGSYYYL  377
            DREQK+ GSYYYL
Sbjct  237  DREQKSEGSYYYL  249



>gb|ABG66092.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG97766.1| unnamed protein product [Oryza sativa Japonica Group]
Length=249

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            G++QRVAL +CLGKPADIYLIDEPSA LDSEQR+VASKVIKRFI+HAKKTAF+VEHDFIM
Sbjct  117  GQLQRVALCICLGKPADIYLIDEPSASLDSEQRLVASKVIKRFIMHAKKTAFIVEHDFIM  176

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+VDC AN+PQSLL+GMN FLSHL+ITFRRDPTN+RPRINKLDS K
Sbjct  177  ATYLADRVIVYEGQPAVDCTANAPQSLLSGMNKFLSHLEITFRRDPTNFRPRINKLDSAK  236

Query  415  DREQKNAGSYYYL  377
            DREQK+AGSYYYL
Sbjct  237  DREQKSAGSYYYL  249



>gb|AAM19067.1| RNase L inhibitor-like protein [Oryza sativa Japonica Group]
Length=604

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVAICLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDP NYRPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPPNYRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+I++ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVRNAEIFMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010917851.1| PREDICTED: ABC transporter E family member 2 [Elaeis guineensis]
Length=605

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSV+C AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGKPSVNCTANAPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_002516768.1| rnase l inhibitor, putative [Ricinus communis]
 gb|EEF45666.1| rnase l inhibitor, putative [Ricinus communis]
Length=126

 Score =   246 bits (629),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 123/126 (98%), Gaps = 1/126 (1%)
 Frame = -3

Query  748  LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVI  569
            +CL +PADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVI
Sbjct  2    VCL-QPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVI  60

Query  568  VYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTKDREQKNAGS  389
            VYEGRPSVDC ANSPQSLLTGMNLFLSHLDITFRRDPTNYRP+INKLDSTKDREQK AGS
Sbjct  61   VYEGRPSVDCTANSPQSLLTGMNLFLSHLDITFRRDPTNYRPKINKLDSTKDREQKAAGS  120

Query  388  YYYLDD  371
            YYYLDD
Sbjct  121  YYYLDD  126



>ref|XP_010915915.1| PREDICTED: ABC transporter E family member 2-like [Elaeis guineensis]
Length=605

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG PSVDC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGEPSVDCAANAPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 71/125 (57%), Gaps = 5/125 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++      
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFKVAETPQ  338

Query  427  DSTKD  413
            +S +D
Sbjct  339  ESAED  343



>ref|XP_003579496.1| PREDICTED: ABC transporter E family member 2-like [Brachypodium 
distachyon]
Length=604

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+VYEGRPSVDC AN+P+SL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  530  ATYLADKVVVYEGRPSVDCTANAPESLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+ GSYYYLDD
Sbjct  590  DREQKSVGSYYYLDD  604


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAARVI-RSLLRTNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>ref|XP_003580843.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Brachypodium distachyon]
Length=604

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR+AL LCLG+PADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRMALCLCLGQPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+VYEGRPS+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  530  ATYLADKVVVYEGRPSIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  590  DREQKSAGSYYYLDD  604


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L A     VVEHD  +
Sbjct  220  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRANSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010925922.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Elaeis guineensis]
 ref|XP_010925923.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Elaeis guineensis]
Length=599

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+ SVDC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  525  ATYLADKVIVYEGQASVDCTANAPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKLDSTK  584

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  585  DREQKAAGSYYYLDD  599


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  214  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  272

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P    +   P S+  G+N+FL+
Sbjct  273  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLA  308



>ref|XP_008805333.1| PREDICTED: ABC transporter E family member 2-like [Phoenix dactylifera]
 ref|XP_008805406.1| PREDICTED: ABC transporter E family member 2-like [Phoenix dactylifera]
Length=605

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGQPSVDCSANAPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  591  DRDQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLGPSSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_008228054.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
Length=574

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVAL LCLG+PADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  440  GEQQRVALCLCLGQPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  499

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIANSPQSLL GMNLFLS LDITFRRDPTNYRPRINKL+S K
Sbjct  500  ATYLADKVIVYEGKPSVDCIANSPQSLLGGMNLFLSQLDITFRRDPTNYRPRINKLNSIK  559

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  560  DREQKAAGSYYYLDD  574


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + ADIY+ DEPS++LD +QR+ A+KVI R +        VVEHD  +
Sbjct  194  GELQRFAIAVVAMQNADIYIFDEPSSFLDVKQRLKAAKVI-RSLTRPDSYVIVVEHDLSV  252

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  253  LDYLSDHICCLYGKPRAYGVVTLPFSVREGINIFLSGFIPTENLRFRDESLTFK  306



>ref|XP_010925920.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010925921.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Elaeis guineensis]
Length=605

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+ SVDC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGQASVDCTANAPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKAAGSYYYLDD  605


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P    +   P S+  G+N+FL+
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLA  314



>gb|AAL26702.1| 68 kDa protein HP68 [Triticum aestivum]
Length=604

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG  S+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  530  ATYLADKVIVYEGLASIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  590  DREQKNAGSYYYLDD  604


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L +     VVEHD  +
Sbjct  220  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAARVI-RSLLRSNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>dbj|BAJ90466.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91099.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86517.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG  S+DC AN+PQSL++GMN FLSHLDITFRRDPTNYRPRINKL+STK
Sbjct  530  ATYLADKVIVYEGLASIDCTANAPQSLVSGMNKFLSHLDITFRRDPTNYRPRINKLESTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQKNAGSYYYLDD
Sbjct  590  DREQKNAGSYYYLDD  604


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L +     VVEHD  +
Sbjct  220  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAARVI-RSLLRSNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|NP_001064667.1| Os10g0432200 [Oryza sativa Japonica Group]
 dbj|BAF26581.1| Os10g0432200, partial [Oryza sativa Japonica Group]
Length=309

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            G++QRVAL +CLGKPADIYLIDEPSA LDSEQR+VASKVIKRFI+HAKKTAF+VEHDFIM
Sbjct  177  GQLQRVALCICLGKPADIYLIDEPSASLDSEQRLVASKVIKRFIMHAKKTAFIVEHDFIM  236

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+VDC AN+PQSLL+GMN FLSHL+ITFRRDPTN+RPRINKLDS K
Sbjct  237  ATYLADRVIVYEGQPAVDCTANAPQSLLSGMNKFLSHLEITFRRDPTNFRPRINKLDSAK  296

Query  415  DREQKNAGSYYYL  377
            DREQK+AGSYYYL
Sbjct  297  DREQKSAGSYYYL  309



>ref|XP_010466555.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=367

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  233  GERQRVAITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  292

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P+V C A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  293  ATYLADKVIVYEGQPAVKCTAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  352

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  353  DREQKLAGSYYFLDD  367


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 7/117 (6%)
 Frame = -3

Query  718  LIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGRPSVDC  539
            + DEPS+YLD  QR+ A++VI+  + H      VVEHD  +  YL+D V    G+P+   
Sbjct  1    MFDEPSSYLDVRQRLKAAQVIRSLLRH-DNYIIVVEHDLSVLDYLSDFVCCLYGKPTAYG  59

Query  538  IANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKLDSTKDREQKNAGSYYY  380
            +   P S+  G+N+FLS      ++ FR +   +  +++      D E K+   Y Y
Sbjct  60   VVTLPFSVREGINVFLSGFIPTENLRFREESLTF--KVSDTPQESDGEVKSYARYKY  114



>ref|XP_007216670.1| hypothetical protein PRUPE_ppa1027195mg [Prunus persica]
 gb|EMJ17869.1| hypothetical protein PRUPE_ppa1027195mg [Prunus persica]
Length=601

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVAL LCLG+PADIYL+DEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  467  GEQQRVALCLCLGQPADIYLVDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  526

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PSVDCIANSPQSLL GMNLFLS LDITFRRDPTNYRPRINKL+S K
Sbjct  527  ATYLADKVIVYEGKPSVDCIANSPQSLLGGMNLFLSQLDITFRRDPTNYRPRINKLNSIK  586

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  587  DREQKAAGSYYYLDD  601


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + ADIY+ DEPS++LD +QR+ A+KVI R ++       VVEHD  +
Sbjct  221  GELQRFAIAVLAMQNADIYIFDEPSSFLDVKQRLKAAKVI-RSLIRPDSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FLS      ++ FR D   ++
Sbjct  280  LDYLSDHICCLYGKPRAYGVVTLPFSVREGINIFLSGFIPTENLRFRDDSLTFK  333



>ref|XP_004246016.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
 ref|XP_010325625.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
Length=606

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILH KKTAFVVEHDFIM
Sbjct  472  GELQRVALTLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHTKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A YLADRVIVYEG PS+DC+AN+PQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+S K
Sbjct  532  AAYLADRVIVYEGTPSMDCVANAPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESAK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  592  DREQKLAGSYYYLDD  606


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD  QR+ A+ V+ R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVRQRLKAAHVV-RSLLRPDSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  280  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  333



>gb|EEE50999.1| hypothetical protein OsJ_31617 [Oryza sativa Japonica Group]
Length=384

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            G++QRVAL +CLGKPADIYLIDEPSA LDSEQR+VASKVIKRFI+HAKKTAF+VEHDFIM
Sbjct  252  GQLQRVALCICLGKPADIYLIDEPSASLDSEQRLVASKVIKRFIMHAKKTAFIVEHDFIM  311

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+VDC AN+PQSLL+GMN FLSHL+ITFRRDPTN+RPRINKLDS K
Sbjct  312  ATYLADRVIVYEGQPAVDCTANAPQSLLSGMNKFLSHLEITFRRDPTNFRPRINKLDSAK  371

Query  415  DREQKNAGSYYYL  377
            DREQK+AGSYYYL
Sbjct  372  DREQKSAGSYYYL  384


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI  644
            GE+QRV +A    + AD+Y+ DEPS+YLD +QR+ A++VIK  +
Sbjct  64   GELQRVGIAAAALQSADVYMFDEPSSYLDVKQRLNAARVIKSLL  107



>emb|CDY60809.1| BnaA01g37290D [Brassica napus]
Length=603

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRV + LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GESQRVGITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+ C+A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPSIKCMAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  589  DREQKSAGSYYYLDD  603


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K A+IY+ DEPS++LD  QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAAVFIKKAEIYMFDEPSSFLDVRQRLKAAQVV-RSLLRPDSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P+   +   P S+  G+N+FL+      ++ FR +   +  ++++ 
Sbjct  279  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--KVSET  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQESDGEVKSYARYKY  352



>ref|XP_009117623.1| PREDICTED: ABC transporter E family member 1 [Brassica rapa]
Length=603

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRV + LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GESQRVGITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PS+ C+A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPSIKCMAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AGSYYYLDD
Sbjct  589  DREQKSAGSYYYLDD  603


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K A+IY+ DEPS++LD  QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAAVFIKKAEIYMFDEPSSFLDVRQRLKAAQVI-RSLLRPDSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D +    G+P+   +   P S+  G+N+FL+      ++ FR +   +  ++++ 
Sbjct  279  LDYLSDFICCLYGKPTAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--KVSET  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQESDGEVKSYARYKY  352



>ref|XP_008387873.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Malus 
domestica]
Length=622

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 131/152 (86%), Gaps = 17/152 (11%)
 Frame = -3

Query  775  GEVQRVALALCLGK-----------------PADIYLIDEPSAYLDSEQRIVASKVIKRF  647
            GE+QRVAL LCLGK                 PADIYLIDEPSAYLDSEQRIVASKVIKRF
Sbjct  471  GELQRVALCLCLGKISFDEYILMSASIYSMQPADIYLIDEPSAYLDSEQRIVASKVIKRF  530

Query  646  ILHAKKTAFVVEHDFIMATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFR  467
            ILHAKKTAFVVEHDFIMATYLADRVIVYEG+PS+DC AN PQSLLTGMNLFLSHLDITFR
Sbjct  531  ILHAKKTAFVVEHDFIMATYLADRVIVYEGKPSIDCTANCPQSLLTGMNLFLSHLDITFR  590

Query  466  RDPTNYRPRINKLDSTKDREQKNAGSYYYLDD  371
            RDPTNYRPRINKL+STKDREQK AGSYYYLDD
Sbjct  591  RDPTNYRPRINKLESTKDREQKAAGSYYYLDD  622


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_006299034.1| hypothetical protein CARUB_v10015171mg [Capsella rubella]
 gb|EOA31932.1| hypothetical protein CARUB_v10015171mg [Capsella rubella]
Length=604

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GEMQRVAITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P++ C A+SPQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKLDSTK
Sbjct  530  ATYLADKVIVYEGQPALKCTAHSPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  590  DREQKVAGSYYFLDD  604


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K A IY+ DEPS+YLD  QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIASVFLKKAVIYMFDEPSSYLDVRQRVKAAQVI-RSLLRYDNYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D V    G+P+   +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  279  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLSGFIPTENLRFRDESLTFK  332



>ref|XP_006418725.1| hypothetical protein EUTSA_v10002453mg [Eutrema salsugineum]
 gb|ESQ37161.1| hypothetical protein EUTSA_v10002453mg [Eutrema salsugineum]
Length=599

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDS+QRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  465  GEKQRVAITLCLGKPADIYLIDEPSAHLDSQQRITASKVIKRFILHAKKTAFIVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+PSV C+ANSPQSLLTGMNLFLSHL+ITFRRDPTN+RPRINKL+S K
Sbjct  525  ATYLADRVIVYEGQPSVKCVANSPQSLLTGMNLFLSHLNITFRRDPTNFRPRINKLESLK  584

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  585  DREQKAAGSYYFLDD  599


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 74/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K A IY+ DEPS+YLD  QR+ A++VI R +L       VVEHD  +
Sbjct  220  GELQRFAIAAVFLKKAVIYMFDEPSSYLDVRQRLKAAQVI-RSLLRPDSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P+   +   P S+  G+N+FL+      ++ FR +   ++     L
Sbjct  279  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTFKVSDTSL  338

Query  427  DSTKDREQKNAGSYYY  380
            +S  D E K+   Y Y
Sbjct  339  ES--DGEVKSYARYKY  352



>gb|AGV54379.1| ABC transporter E family member 2-like protein [Phaseolus vulgaris]
Length=606

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLD EQ I A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALCLCLGKPADIYLIDEPSAYLDFEQGIHAAKVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY G+PS+DCIANSPQSLL GMNLFLSHLDITFRRDPTN+RPRINKLDSTK
Sbjct  532  ATYLADRVIVYAGQPSIDCIANSPQSLLFGMNLFLSHLDITFRRDPTNFRPRINKLDSTK  591

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  592  DREQKFAGSYYYLDD  606



>ref|XP_008783223.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Phoenix dactylifera]
Length=605

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+ S+DC AN+PQSL++GMN FLSHL+ITFRRDPTNYRPRINKLDSTK
Sbjct  531  ATYLADKVIVYEGKASLDCTANAPQSLVSGMNRFLSHLNITFRRDPTNYRPRINKLDSTK  590

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  591  DRDQKAAGSYYYLDD  605


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  220  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>dbj|BAJ93642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLG+PA+IYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  470  GELQRVALCLCLGQPAEIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+VYEGRPS++C A +PQSL +GMN FLSHLDITFRRDPTNYRPRINK+DSTK
Sbjct  530  ATYLADKVVVYEGRPSIECTACTPQSLASGMNRFLSHLDITFRRDPTNYRPRINKMDSTK  589

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  590  DREQKAAGSYYYLDD  604


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L +     VVEHD  +
Sbjct  220  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRSNSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  279  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  332



>ref|XP_010500834.1| PREDICTED: ABC transporter E family member 1 isoform X2 [Camelina 
sativa]
 ref|XP_010500842.1| PREDICTED: ABC transporter E family member 1 isoform X2 [Camelina 
sativa]
Length=603

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  589  DKEQKAAGSYYYLDD  603


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R++  
Sbjct  279  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQETDGEVKSYARYKY  352



>ref|XP_006299795.1| hypothetical protein CARUB_v10015991mg [Capsella rubella]
 gb|EOA32693.1| hypothetical protein CARUB_v10015991mg [Capsella rubella]
Length=603

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRIAASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  589  DKEQKAAGSYYYLDD  603


 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R++  
Sbjct  279  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E ++   Y Y
Sbjct  337  TQETDEEVESYARYKY  352



>ref|XP_006296689.1| hypothetical protein CARUB_v10013264mg [Capsella rubella]
 gb|EOA29587.1| hypothetical protein CARUB_v10013264mg [Capsella rubella]
Length=603

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRIAASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  589  DKEQKAAGSYYYLDD  603


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R++  
Sbjct  279  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  TQETDEEVKSYARYKY  352



>ref|XP_008783221.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Phoenix dactylifera]
Length=632

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  498  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  557

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+ S+DC AN+PQSL++GMN FLSHL+ITFRRDPTNYRPRINKLDSTK
Sbjct  558  ATYLADKVIVYEGKASLDCTANAPQSLVSGMNRFLSHLNITFRRDPTNYRPRINKLDSTK  617

Query  415  DREQKNAGSYYYLDD  371
            DR+QK AGSYYYLDD
Sbjct  618  DRDQKAAGSYYYLDD  632


 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  247  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSYVIVVEHDLSV  305

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  306  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  359



>ref|XP_010465207.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
 ref|XP_010465208.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=603

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPAVRCIAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  589  DKEQKAAGSYYYLDD  603


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R++  
Sbjct  279  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQETDGEAKSYARYKY  352



>ref|XP_010500812.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
 ref|XP_010500818.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
 ref|XP_010500826.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
Length=629

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  495  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  554

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  555  ATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  614

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  615  DKEQKAAGSYYYLDD  629


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  246  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  304

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R++  
Sbjct  305  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSDT  362

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  363  PQETDGEVKSYARYKY  378



>ref|XP_010487122.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
 ref|XP_010487123.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=603

 Score =   253 bits (646),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V C+A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADRVIVYEGQPAVRCVAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  589  DKEQKAAGSYYYLDD  603


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R++  
Sbjct  279  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQETDGEVKSYARYKY  352



>ref|XP_010465884.1| PREDICTED: ABC transporter E family member 1-like isoform X2 
[Camelina sativa]
 ref|XP_010465885.1| PREDICTED: ABC transporter E family member 1-like isoform X2 
[Camelina sativa]
Length=605

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  471  GERQRVAITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFVVEHDFIM  530

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P++ C A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  531  ATYLADKVIVYEGQPALKCTAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  590

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  591  DREQKLAGSYYYLDD  605


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K A IY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFLKKATIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DNYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P+   +   P S+  G+N+FL+      ++ FR +   +  +++  
Sbjct  279  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFIPTENLRFREESLTF--KVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQEGDGEVKSYARYKY  352



>ref|XP_010511564.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
 ref|XP_010511572.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=599

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  465  GERQRVAITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P+V C A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  525  ATYLADKVIVYEGQPAVKCTAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  584

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  585  DREQKLAGSYYFLDD  599


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+AL   + A IY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  214  GELQRFAIALVFLQKAVIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DNYIIVVEHDLSV  272

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G P+   +   P S+  G+N+FL+      ++ FR +   +  +++  
Sbjct  273  LDYLSDFVCCLYGIPTAYGVVTLPFSVREGINVFLAGFIPTENLRFREESLTF--KVSDT  330

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  331  PQECDGEVKSYARYKY  346



>ref|XP_010465883.1| PREDICTED: ABC transporter E family member 1-like isoform X1 
[Camelina sativa]
Length=621

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI ASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  487  GERQRVAITLCLGKPADIYLIDEPSAYLDSEQRITASKVIKRFILHAKKTAFVVEHDFIM  546

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P++ C A+SPQSLL+GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  547  ATYLADKVIVYEGQPALKCTAHSPQSLLSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  606

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  607  DREQKLAGSYYYLDD  621


 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K A IY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  236  GELQRFAIAAVFLKKATIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DNYVIVVEHDLSV  294

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P+   +   P S+  G+N+FL+      ++ FR +   +  +++  
Sbjct  295  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFIPTENLRFREESLTF--KVSDT  352

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  353  PQEGDGEVKSYARYKY  368



>gb|EEC67005.1| hypothetical protein OsI_33716 [Oryza sativa Indica Group]
Length=555

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            G++QRVAL +CLGKPADIYLIDEPSA LDSEQR+VASKVIKRFI+HAKKTAF+VEHDFIM
Sbjct  423  GQLQRVALCICLGKPADIYLIDEPSASLDSEQRLVASKVIKRFIMHAKKTAFIVEHDFIM  482

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+VDC AN+PQSLL+GMN FLSHL+ITFRRDPTN+RPRINKLDS K
Sbjct  483  ATYLADRVIVYEGQPAVDCTANAPQSLLSGMNKFLSHLEITFRRDPTNFRPRINKLDSAK  542

Query  415  DREQKNAGSYYYL  377
            DREQK+AGSYYYL
Sbjct  543  DREQKSAGSYYYL  555


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI  644
            GE+QRV +A    + AD+Y+ DEPS+YLD +QR+ A++VIK  +
Sbjct  220  GELQRVGIAAAALQSADVYMFDEPSSYLDVKQRLNAARVIKSLL  263



>gb|EMT04752.1| ABC transporter E family member 2 [Aegilops tauschii]
Length=755

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLG+PA+IYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  621  GELQRVALCLCLGQPAEIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  680

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A YLAD+V+VYEGRPSV+C A +PQSL++GMN FLSHLDITFRRDPTNYRPRINK+DSTK
Sbjct  681  AAYLADKVVVYEGRPSVECTACTPQSLVSGMNRFLSHLDITFRRDPTNYRPRINKMDSTK  740

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYYYLDD
Sbjct  741  DREQKAAGSYYYLDD  755


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L +     VVEHD  +
Sbjct  371  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRSNSYVIVVEHDLSV  429

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  430  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  483



>ref|XP_003572083.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Brachypodium distachyon]
Length=600

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVAL LCLGKPADIYLIDEPSA LDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  468  GERQRVALCLCLGKPADIYLIDEPSASLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  527

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+V+EGRPSVDC AN+PQSL +GMN FLSHLDITFRRDPTNYRPRINKL STK
Sbjct  528  ATYLADKVVVFEGRPSVDCTANAPQSLQSGMNKFLSHLDITFRRDPTNYRPRINKLGSTK  587

Query  415  DREQKNAGSYYYL  377
            DREQK+ GSYYYL
Sbjct  588  DREQKSEGSYYYL  600


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + A+IY+ DEPS YLD +QR+ A++VI R +L       VVEHD  +
Sbjct  218  GELQRFAIAGIAAQSAEIYMFDEPSVYLDVKQRLKAAQVI-RSLLRTNSYVIVVEHDLSV  276

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              Y++D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  277  LDYMSDFICCLYGKPGAYGVVTLPFSVREGINVFLAGFVPTENLRFRNESLTFK  330



>ref|NP_187973.1| ABC transporter E family member 1 [Arabidopsis thaliana]
 sp|Q9LID6.1|AB1E_ARATH RecName: Full=ABC transporter E family member 1; Short=ABC transporter 
ABCE.1; Short=AtABCE1; AltName: Full=RNase L inhibitor-like 
protein 1; Short=AtRLI1; Short=AthaRLI1 [Arabidopsis 
thaliana]
 dbj|BAB01911.1| RNase L inhibitor [Arabidopsis thaliana]
 gb|AAO41992.1| putative RNase L inhibitor protein [Arabidopsis thaliana]
 gb|AAO50575.1| putative RNase L inhibitor protein [Arabidopsis thaliana]
 gb|AEE75386.1| ABC transporter E family member 1 [Arabidopsis thaliana]
Length=603

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYLIDEPSA+LDSEQRI ASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG+P+V CIA+SPQSLL+GMN FLSHL+ITFRRDPTN+RPRINKL+S K
Sbjct  529  ATYLADRVIVYEGQPAVKCIAHSPQSLLSGMNHFLSHLNITFRRDPTNFRPRINKLESIK  588

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AGSYYYLDD
Sbjct  589  DKEQKTAGSYYYLDD  603


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 74/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS+YLD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRH-DSYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P    +   P S+  G+N+FL+      ++ FR +   +  R+++ 
Sbjct  279  LDYLSDFVCCLYGKPGAYGVVTLPFSVREGINVFLAGFIPTENLRFRDESLTF--RVSET  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  TQENDGEVKSYARYKY  352



>ref|XP_008365642.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter E family member 
2-like [Malus domestica]
Length=657

 Score =   251 bits (641),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+Q VAL LCLG+PADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKK+AFVVEHDFIM
Sbjct  466  GEMQSVALCLCLGQPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKSAFVVEHDFIM  525

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+G+P+VDC A SP+SLLTGMNLFLS LDITFRRDPTNYRPRINKL+STK
Sbjct  526  ATYLADRVIVYDGKPAVDCTAISPRSLLTGMNLFLSQLDITFRRDPTNYRPRINKLNSTK  585

Query  415  DREQKNAGSYYYLDD  371
            DREQK AG+YYYLDD
Sbjct  586  DREQKAAGTYYYLDD  600


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR  +A+   + AD+Y+ DEPS+YLD +QR+ A++VI R ++       VVEHD  +
Sbjct  222  GELQRFXIAVSAMQSADVYMFDEPSSYLDVKQRLKAARVI-RSLIRPDSYVIVVEHDLSI  280

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D      G+P    +   P S+  G+N+F S      ++ FR +   ++
Sbjct  281  LDYLSDHXCCLYGKPGAYGVVTPPFSVREGINIFFSGFVPTENLRFRDESLTFK  334



>emb|CDX82529.1| BnaA03g32920D [Brassica napus]
Length=556

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYL+DEPSA+LDSEQRI ASKVIKRFILHAKKTAFVVEHDF+M
Sbjct  422  GERQRVAITLCLGKPADIYLLDEPSAHLDSEQRITASKVIKRFILHAKKTAFVVEHDFMM  481

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P V C A+SPQSL +GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  482  ATYLADKVIVYEGQPGVKCTAHSPQSLSSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  541

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  542  DREQKLAGSYYFLDD  556



>gb|EOA92610.1| ATP-binding cassette sub-family E member 1 [Anas platyrhynchos]
Length=172

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  38   GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVMKRFILHAKKTAFVVEHDFIM  97

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  98   ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  157

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  158  DVEQKKSGNYFFLDD  172



>ref|XP_009135315.1| PREDICTED: ABC transporter E family member 1-like [Brassica rapa]
Length=603

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYL+DEPSA+LDSEQRI ASKVIKRFILHAKKTAFVVEHDF+M
Sbjct  469  GERQRVAITLCLGKPADIYLLDEPSAHLDSEQRITASKVIKRFILHAKKTAFVVEHDFMM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P V C A+SPQSL +GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADKVIVYEGQPGVKCTAHSPQSLTSGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  589  DREQKLAGSYYFLDD  603


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 72/136 (53%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS +LD  QR+ A+ VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVCLKKADIYVFDEPSNFLDVRQRLKAADVIRSLLKH-DNYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P+   +   P S+  G+N+FL+      ++ FR +   +  +++  
Sbjct  279  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFVPTENLRFRDESLTF--KVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQGSDGEVKSYARYKY  352



>emb|CDX75723.1| BnaC03g38060D [Brassica napus]
Length=603

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRVA+ LCLGKPADIYL+DEPSA+LDSEQRI ASKVIKRFILHAKKTAFVVEHDF+M
Sbjct  469  GERQRVAITLCLGKPADIYLLDEPSAHLDSEQRITASKVIKRFILHAKKTAFVVEHDFMM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+P V C A+SPQSL +GMNLFLSHL+ITFRRDPTN+RPRINKL+STK
Sbjct  529  ATYLADKVIVYEGQPGVKCTAHSPQSLASGMNLFLSHLNITFRRDPTNFRPRINKLESTK  588

Query  415  DREQKNAGSYYYLDD  371
            DREQK AGSYY+LDD
Sbjct  589  DREQKLAGSYYFLDD  603


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 73/136 (54%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    K ADIY+ DEPS +LD  QR+ A++VI+  + H      VVEHD  +
Sbjct  220  GELQRFAIAAVCLKKADIYVFDEPSNFLDVRQRLKAAEVIRSLLRH-DNYVIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G+P+   +   P S+  G+N+FL+      ++ FR +   +  +++  
Sbjct  279  LDYLSDFVCCLYGKPTAYGVVTLPFSVREGINVFLAGFVPTENLRFRDESLTF--KVSDT  336

Query  427  DSTKDREQKNAGSYYY  380
                D E K+   Y Y
Sbjct  337  PQESDGEVKSYARYKY  352



>ref|XP_005088430.1| PREDICTED: ATP-binding cassette sub-family E member 1-like, partial 
[Mesocricetus auratus]
Length=217

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  83   GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  142

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  143  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  202

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  203  DVEQKKSGNYFFLDD  217



>dbj|BAE87471.1| unnamed protein product [Macaca fascicularis]
Length=219

 Score =   234 bits (596),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  85   GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  144

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  145  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  204

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  205  DVEQKKSGNYFFLDD  219



>ref|XP_005031714.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Anas 
platyrhynchos]
Length=209

 Score =   233 bits (595),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  75   GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVMKRFILHAKKTAFVVEHDFIM  134

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  135  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  194

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  195  DVEQKKSGNYFFLDD  209



>ref|XP_003589457.1| RNase L inhibitor protein-like protein, partial [Medicago truncatula]
Length=670

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 128/137 (93%), Gaps = 2/137 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAF+VEHDFIM
Sbjct  486  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFIVEHDFIM  545

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVYEG+PS++C AN PQSLLTGMNLFLSHLDITFRRDPTN+RPRINKL+STK
Sbjct  546  ATYLADKVIVYEGQPSINCTANCPQSLLTGMNLFLSHLDITFRRDPTNFRPRINKLESTK  605

Query  415  DREQKNA--GSYYYLDD  371
            DREQKN   G+   LDD
Sbjct  606  DREQKNVCLGNNGGLDD  622


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++V+ R +L       VVEHD  +
Sbjct  234  GELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVV-RSLLRPNSFVIVVEHDLSV  292

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P V  +   P S+  G+N+FLS
Sbjct  293  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLS  328


 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -3

Query  733  PADIYLIDEPSAYLDSEQRIVASK  662
            PADIYLIDEPSAYLDSEQRIVA+K
Sbjct  647  PADIYLIDEPSAYLDSEQRIVAAK  670



>ref|XP_005852260.1| hypothetical protein CHLNCDRAFT_59548 [Chlorella variabilis]
 gb|EFN60158.1| hypothetical protein CHLNCDRAFT_59548 [Chlorella variabilis]
Length=249

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLG+PA++YLIDEPSAYLDSEQRI+A+KVIKRFI+H+KKTAF+VEHDFIM
Sbjct  115  GELQRVAITLCLGQPANVYLIDEPSAYLDSEQRILAAKVIKRFIMHSKKTAFIVEHDFIM  174

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A YLADRVIVYEG+PS +  A +PQSLLTGMN FL +L+ITFRRDPTNYRPRINK +STK
Sbjct  175  AAYLADRVIVYEGQPSKEATARTPQSLLTGMNTFLKNLEITFRRDPTNYRPRINKKESTK  234

Query  415  DREQKNAGSYYYLDD  371
            DREQK AG++YYL+D
Sbjct  235  DREQKLAGTFYYLED  249



>ref|XP_003288288.1| hypothetical protein DICPUDRAFT_97974 [Dictyostelium purpureum]
 gb|EGC35200.1| hypothetical protein DICPUDRAFT_97974 [Dictyostelium purpureum]
Length=404

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLG+PADIYLIDEPSAYLDSEQRIV SKVIKRFILHA K+ F+VEHDFIM
Sbjct  266  GELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIVVSKVIKRFILHAGKSGFIVEHDFIM  325

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+G P V C+AN+PQSLL+GMN FL  L+ITFRRDPTNYRPRINKL+S K
Sbjct  326  ATYLADRVIVYDGIPGVKCVANAPQSLLSGMNTFLKALEITFRRDPTNYRPRINKLNSIK  385

Query  415  DREQKNAGSYYYLDD  371
            D EQKNAG+Y++LDD
Sbjct  386  DMEQKNAGNYFFLDD  400


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 79/136 (58%), Gaps = 9/136 (7%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + AD+Y+ DEPS+YLD +QR+ A++VI R ++ A+K   VVEHD  +
Sbjct  21   GELQRFAIAVAGVQNADVYMFDEPSSYLDVKQRLKAAQVI-RSLIEAQKYIIVVEHDLSV  79

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D +    G P    +   P S+  G+N+FL+      ++ FR++   ++      
Sbjct  80   LDYLSDFICCLYGAPGAYGVVTLPFSVREGINIFLAGYIPTENMRFRKEALTFKFS----  135

Query  427  DSTKDREQKNAGSYYY  380
            ++ ++ E K   +Y Y
Sbjct  136  ETAENEEIKKHCNYKY  151



>gb|EYU42264.1| hypothetical protein MIMGU_mgv1a0213241mg, partial [Erythranthe 
guttata]
Length=568

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE QRV L LCLGK ADIYLIDEPSAYLDSEQRI+ASKVIKRFI H+KKTAFVVEHDFIM
Sbjct  435  GESQRVELCLCLGKAADIYLIDEPSAYLDSEQRIMASKVIKRFIYHSKKTAFVVEHDFIM  494

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIV++G+ SVDCIANSPQSLLTGMN FL HLDITFRRDPTNYRPRINK+DSTK
Sbjct  495  ATYLADKVIVFDGQASVDCIANSPQSLLTGMNKFLLHLDITFRRDPTNYRPRINKMDSTK  554

Query  415  DREQKNAGSYYYL  377
            D+EQK+AG++YYL
Sbjct  555  DKEQKSAGTFYYL  567


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + AD+Y+ DEPS+YLD +QR+ A++VI R +L  K    VVEHD  +
Sbjct  185  GELQRFAIAERSIQRADVYMFDEPSSYLDVKQRLKAAQVI-RSLLSPKSYIIVVEHDLSI  243

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+  V  +   P S+  G+N+FLS      ++ FR +   ++
Sbjct  244  LDYLSDFICCLYGKEGVYGVVTLPFSVREGINVFLSGFIPTENLRFREESFTFK  297



>ref|XP_008864766.1| ABC transporter E family member 2 [Aphanomyces invadans]
 gb|ETW06691.1| ABC transporter E family member 2 [Aphanomyces invadans]
Length=629

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGK ADIYLIDEPSAYLDSEQRI+ASKVIKRFILH+KKTAFVVEHDFIM
Sbjct  495  GELQRVAIVLCLGKAADIYLIDEPSAYLDSEQRIIASKVIKRFILHSKKTAFVVEHDFIM  554

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+GRP V+C A SPQSLL+GMN+FL  L+ITFRRDPTNYRPRINKL+S K
Sbjct  555  ATYLADRVIVYKGRPGVECTAQSPQSLLSGMNMFLKQLEITFRRDPTNYRPRINKLNSVK  614

Query  415  DREQKNAGSYYYLDD  371
            D EQKN G+Y+++DD
Sbjct  615  DTEQKNTGNYFFMDD  629


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (52%), Gaps = 14/141 (10%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKT-AFVVEHDFI  599
            GE+QR A+     + ADIY+ DEPS+YLD  QR+ A+ VI+  +     +    VEHD  
Sbjct  221  GELQRFAICSVAVQQADIYMFDEPSSYLDVRQRLKAALVIRSMVEGNHSSYCICVEHDLC  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINK  431
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   +     K
Sbjct  281  VLDYLSDFICVLYGSPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRQEELTF-----K  335

Query  430  LDSTKDREQ----KNAGSYYY  380
            L  T D  Q     +A +Y Y
Sbjct  336  LAQTADEMQLKDDTSANTYVY  356



>ref|XP_008614115.1| ABC transporter E family member 2 [Saprolegnia diclina VS20]
 gb|EQC32614.1| ABC transporter E family member 2 [Saprolegnia diclina VS20]
Length=628

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI+ASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  494  GELQRVAIVLCLGKPADIYLIDEPSAYLDSEQRIIASKVIKRFILHAKKTAFVVEHDFIM  553

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+GRP V+C A +PQSLL+GMN+FL  L+ITFRRDPTN+RPRINKL+S K
Sbjct  554  ATYLADRVIVYKGRPGVECTARTPQSLLSGMNMFLKQLEITFRRDPTNFRPRINKLNSVK  613

Query  415  DREQKNAGSYYYLDD  371
            D EQK+ G+Y+++DD
Sbjct  614  DTEQKSTGNYFFMDD  628


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 74/141 (52%), Gaps = 14/141 (10%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKT-AFVVEHDFI  599
            GE+QR A+     + ADIY+ DEPS+YLD  QR+ A+ VI+  +  +  +    VEHD  
Sbjct  221  GELQRFAICSIAVQQADIYMFDEPSSYLDVRQRLKAALVIRSMVEGSHLSYCICVEHDLC  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINK  431
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   +     K
Sbjct  281  VLDYLSDYICVLYGSPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRQEELTF-----K  335

Query  430  LDSTKDREQKN----AGSYYY  380
            L  T D  Q N    A +Y Y
Sbjct  336  LAQTADELQGNDNSSANTYTY  356



>ref|XP_009834702.1| ABC transporter E family member 2, variant 2 [Aphanomyces astaci]
 gb|ETV75572.1| ABC transporter E family member 2, variant 2 [Aphanomyces astaci]
Length=531

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGK ADIYLIDEPSAYLDSEQRI+ASKVIKRFILH+KKTAFVVEHDFIM
Sbjct  397  GELQRVAIVLCLGKAADIYLIDEPSAYLDSEQRIIASKVIKRFILHSKKTAFVVEHDFIM  456

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+GRP V+C A SPQSLL+GMN+FL  L+ITFRRDPTN+RPRINKL+S K
Sbjct  457  ATYLADRVIVYKGRPGVECTAQSPQSLLSGMNMFLKQLEITFRRDPTNFRPRINKLNSVK  516

Query  415  DREQKNAGSYYYLDD  371
            D EQK+ G+Y+++DD
Sbjct  517  DTEQKSTGNYFFMDD  531


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 77/142 (54%), Gaps = 16/142 (11%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF--VVEHDF  602
            GE+QR A+     + ADIY+ DEPS+YLD  QR+ A+ VI R ++  + +++   VEHD 
Sbjct  123  GELQRFAICSVAVQQADIYMFDEPSSYLDVRQRLKAALVI-RSMVEGQHSSYCICVEHDL  181

Query  601  IMATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRIN  434
             +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   +     
Sbjct  182  CVLDYLSDFICVLYGAPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRQEELTF-----  236

Query  433  KLDSTKDREQ----KNAGSYYY  380
            KL  T D  Q     +A +Y Y
Sbjct  237  KLAQTADEMQLKDDTSANTYTY  258



>gb|KDO32655.1| ABC transporter E family member 2 [Saprolegnia parasitica CBS 
223.65]
Length=628

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI+ASKVIKRFILHAKKTAFVVEHDFIM
Sbjct  494  GELQRVAIVLCLGKPADIYLIDEPSAYLDSEQRIIASKVIKRFILHAKKTAFVVEHDFIM  553

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+GRP V+C A +PQSLL+GMN+FL  L+ITFRRDPTN+RPRINKL+S K
Sbjct  554  ATYLADRVIVYKGRPGVECTARTPQSLLSGMNMFLKQLEITFRRDPTNFRPRINKLNSVK  613

Query  415  DREQKNAGSYYYLDD  371
            D EQK+ G+Y+++DD
Sbjct  614  DTEQKSTGNYFFMDD  628


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 73/137 (53%), Gaps = 6/137 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKT-AFVVEHDFI  599
            GE+QR A+     + ADIY+ DEPS+YLD  QR+ A+ VI+  +  +  +    VEHD  
Sbjct  221  GELQRFAICSIAVQKADIYMFDEPSSYLDVRQRLKAALVIRSMVEGSHLSYCICVEHDLC  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINK  431
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   ++     
Sbjct  281  VLDYLSDYICVLYGSPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRQEELTFK-LAQT  339

Query  430  LDSTKDREQKNAGSYYY  380
             D  K  +  +A +Y Y
Sbjct  340  ADELKGNDDSSANTYTY  356



>ref|XP_009834703.1| ABC transporter E family member 2, variant 1 [Aphanomyces astaci]
 gb|ETV75571.1| ABC transporter E family member 2, variant 1 [Aphanomyces astaci]
Length=538

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGK ADIYLIDEPSAYLDSEQRI+ASKVIKRFILH+KKTAFVVEHDFIM
Sbjct  404  GELQRVAIVLCLGKAADIYLIDEPSAYLDSEQRIIASKVIKRFILHSKKTAFVVEHDFIM  463

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+GRP V+C A SPQSLL+GMN+FL  L+ITFRRDPTN+RPRINKL+S K
Sbjct  464  ATYLADRVIVYKGRPGVECTAQSPQSLLSGMNMFLKQLEITFRRDPTNFRPRINKLNSVK  523

Query  415  DREQKNAGSYYYLDD  371
            D EQK+ G+Y+++DD
Sbjct  524  DTEQKSTGNYFFMDD  538


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 77/138 (56%), Gaps = 8/138 (6%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF--VVEHDF  602
            GE+QR A+     + ADIY+ DEPS+YLD  QR+ A+ VI R ++  + +++   VEHD 
Sbjct  130  GELQRFAICSVAVQQADIYMFDEPSSYLDVRQRLKAALVI-RSMVEGQHSSYCICVEHDL  188

Query  601  IMATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRIN  434
             +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   ++    
Sbjct  189  CVLDYLSDFICVLYGAPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRQEELTFK-LAQ  247

Query  433  KLDSTKDREQKNAGSYYY  380
              D  + ++  +A +Y Y
Sbjct  248  TADEMQLKDDTSANTYTY  265



>gb|ABB47665.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47666.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1682

 Score =   249 bits (637),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 128/133 (96%), Gaps = 0/133 (0%)
 Frame = -3

Query  775   GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
             G++QRVAL +CLGKPADIYLIDEPSA LDSEQR+VASKVIKRFI+HAKKTAF+VEHDFIM
Sbjct  1550  GQLQRVALCICLGKPADIYLIDEPSASLDSEQRLVASKVIKRFIMHAKKTAFIVEHDFIM  1609

Query  595   ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
             ATYLADRVIVYEG+P+VDC AN+PQSLL+GMN FLSHL+ITFRRDPTN+RPRINKLDS K
Sbjct  1610  ATYLADRVIVYEGQPAVDCTANAPQSLLSGMNKFLSHLEITFRRDPTNFRPRINKLDSAK  1669

Query  415   DREQKNAGSYYYL  377
             DREQK+AGSYYYL
Sbjct  1670  DREQKSAGSYYYL  1682


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  775   GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI  644
             GE+QRV +A    + AD+Y+ DEPS+YLD +QR+ A++VIK  +
Sbjct  1347  GELQRVGIAAAALQSADVYMFDEPSSYLDVKQRLNAARVIKSLL  1390



>gb|AAH16988.1| Unknown (protein for IMAGE:4396587), partial [Homo sapiens]
Length=345

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  211  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  270

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  271  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  330

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  331  DVEQKKSGNYFFLDD  345



>gb|EFA85500.1| RNaseL inhibitor-like protein [Polysphondylium pallidum PN500]
Length=603

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLG+PADIYLIDEPSAYLDSEQRI+ASKVIKRFILHA+K+ F+VEHDFIM
Sbjct  465  GELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIIASKVIKRFILHARKSGFIVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG P+V CIAN+PQSLLTGMN FL  LDITFRRDPTNYRPRINKL+S K
Sbjct  525  ATYLADRVIVYEGVPAVHCIANAPQSLLTGMNQFLKTLDITFRRDPTNYRPRINKLESVK  584

Query  415  DREQKNAGSYYYLD  374
            D+EQK+ G+Y++LD
Sbjct  585  DKEQKSNGNYFFLD  598


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 10/129 (8%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + ADI++ DEPS+YLD +QR+ A++VI R ++       VVEHD  +
Sbjct  219  GELQRFAIAVVCVQNADIFMFDEPSSYLDVKQRLKAAQVI-RSLIQPTNYIIVVEHDLSV  277

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G      +   P S+  G+N+FL+      ++ FR++   +     K 
Sbjct  278  LDYLSDFVCCLYGSAGAYGVVTLPFSVREGINIFLNGFIKTENMRFRKEALTF-----KF  332

Query  427  DSTKDREQK  401
              T D E++
Sbjct  333  SETADTEEE  341



>gb|ERZ95317.1| hypothetical protein GLOINDRAFT_312281 [Rhizophagus irregularis 
DAOM 181602]
Length=225

 Score =   229 bits (584),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ L LGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILH+KKTAFVVEHDFIM
Sbjct  89   GELQRVAIVLALGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHSKKTAFVVEHDFIM  148

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV++YEG PSV+  A +PQSLL+GMN FL  L+ITFRRDPTN+RPRINKL+S  
Sbjct  149  ATYLADRVVLYEGMPSVEATATTPQSLLSGMNKFLKSLEITFRRDPTNFRPRINKLNSQN  208

Query  415  DREQKNAGSYYYLD  374
            D+EQK++G+Y++L+
Sbjct  209  DQEQKSSGNYFFLE  222



>gb|KFG32411.1| putative ATP-binding cassette sub-family E member 1, partial 
[Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=210

 Score =   228 bits (582),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL + LGKPADIYLIDEPSAYLDSEQRI+A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  75   GELQRVALIVALGKPADIYLIDEPSAYLDSEQRIMAARVIKRFILHAKKTAFVVEHDFIM  134

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG P V+C+A SP +L++GMN FL  L+ITFRRDPTN+RPRINK++S K
Sbjct  135  ATYLADRVIVYEGEPGVECVARSPDNLVSGMNRFLKSLEITFRRDPTNFRPRINKMESVK  194

Query  415  DREQKNAGSYYYLDD  371
            D+EQK  G+Y+ LDD
Sbjct  195  DKEQKLMGNYFMLDD  209



>gb|KFZ52892.1| ATP-binding cassette sub-family E member 1, partial [Podiceps 
cristatus]
Length=362

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  228  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  287

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  288  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  347

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  348  DVEQKKSGNYFFLDD  362


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -3

Query  721  YLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGRPSVD  542
            ++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +  YL+D +    G PS  
Sbjct  1    FMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAY  59

Query  541  CIANSPQSLLTGMNLFL  491
             +   P S+  G+N+FL
Sbjct  60   GVVTMPFSVREGINIFL  76



>ref|XP_006836109.1| hypothetical protein AMTR_s00226p00014390 [Amborella trichopoda]
 gb|ERM98962.1| hypothetical protein AMTR_s00226p00014390 [Amborella trichopoda]
Length=605

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSAYLDSEQRIVASKVIK FILH+KKTAFVVEHDFIM
Sbjct  473  GELQRVALCLCLGKPADIYLIDEPSAYLDSEQRIVASKVIKSFILHSKKTAFVVEHDFIM  532

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+VIVY G+PSV+C AN+P+ LLTGMN FLSHLD+T RRD T+YRPRINKLDSTK
Sbjct  533  ATYLADKVIVYAGKPSVECTANAPEELLTGMNRFLSHLDVTLRRDTTSYRPRINKLDSTK  592

Query  415  DREQKNAGSYYY  380
            DREQK AG+YYY
Sbjct  593  DREQKAAGTYYY  604


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + ADIY+ DEPS+YLD +QRI A++VI R +L       VVEHD  +
Sbjct  221  GELQRFAIAVVAVQNADIYMFDEPSSYLDVKQRIKAAQVI-RSLLRPNSYVIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
              YL+D +    G+P V  +   P S+  G+N+FL+
Sbjct  280  LDYLSDFICCLYGKPGVYGVVTLPFSVREGINIFLA  315



>ref|XP_009834701.1| ABC transporter E family member 2 [Aphanomyces astaci]
 gb|ETV75570.1| ABC transporter E family member 2 [Aphanomyces astaci]
Length=629

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGK ADIYLIDEPSAYLDSEQRI+ASKVIKRFILH+KKTAFVVEHDFIM
Sbjct  495  GELQRVAIVLCLGKAADIYLIDEPSAYLDSEQRIIASKVIKRFILHSKKTAFVVEHDFIM  554

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+GRP V+C A SPQSLL+GMN+FL  L+ITFRRDPTN+RPRINKL+S K
Sbjct  555  ATYLADRVIVYKGRPGVECTAQSPQSLLSGMNMFLKQLEITFRRDPTNFRPRINKLNSVK  614

Query  415  DREQKNAGSYYYLDD  371
            D EQK+ G+Y+++DD
Sbjct  615  DTEQKSTGNYFFMDD  629


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (52%), Gaps = 14/141 (10%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKT-AFVVEHDFI  599
            GE+QR A+     + ADIY+ DEPS+YLD  QR+ A+ VI+  +     +    VEHD  
Sbjct  221  GELQRFAICSVAVQQADIYMFDEPSSYLDVRQRLKAALVIRSMVEGQHSSYCICVEHDLC  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINK  431
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   +     K
Sbjct  281  VLDYLSDFICVLYGAPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRQEELTF-----K  335

Query  430  LDSTKDREQ----KNAGSYYY  380
            L  T D  Q     +A +Y Y
Sbjct  336  LAQTADEMQLKDDTSANTYTY  356



>ref|XP_008903480.1| ABC transporter E family member 2 [Phytophthora parasitica INRA-310]
 gb|ETI49163.1| ABC transporter E family member 2 [Phytophthora parasitica P1569]
 gb|ETL95633.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETM48828.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETN10962.1| ABC transporter E family member 2 [Phytophthora parasitica INRA-310]
 gb|ETO77898.1| ABC transporter E family member 2 [Phytophthora parasitica P1976]
 gb|ETP46880.1| ABC transporter E family member 2 [Phytophthora parasitica P10297]
Length=626

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  492  GELQRVAIILCLGKPADIYLIDEPSAYLDSEQRILAAKVIKRFILHAKKTAFVVEHDFIM  551

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VY+G+P ++C A++PQSLLTGMN FL  L+ITFRRDPTNYRPRINK DS K
Sbjct  552  ATYLADRVVVYDGKPGIECTAHAPQSLLTGMNTFLKQLEITFRRDPTNYRPRINKYDSVK  611

Query  415  DREQKNAGSYYYLDD  371
            D EQKN+G+++++DD
Sbjct  612  DVEQKNSGNFFFMDD  626


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI-LHAKKTAFVVEHDFI  599
            GE+QR A+A+   + ADIY+ DEPS+YLD  QR+ A+ VI+  +  +A+     VEHD  
Sbjct  221  GELQRFAIAVVAVQNADIYMFDEPSSYLDVRQRLKAALVIRSMVDDNARSYVICVEHDLS  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  281  VLDYLSDFICVLYGTPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRTEELTFK  335



>gb|ETK89054.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETL42461.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETP18933.1| ABC transporter E family member 2 [Phytophthora parasitica CJ01A1]
Length=626

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  492  GELQRVAIILCLGKPADIYLIDEPSAYLDSEQRILAAKVIKRFILHAKKTAFVVEHDFIM  551

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VY+G+P ++C A++PQSLLTGMN FL  L+ITFRRDPTNYRPRINK DS K
Sbjct  552  ATYLADRVVVYDGKPGIECTAHAPQSLLTGMNTFLKQLEITFRRDPTNYRPRINKYDSVK  611

Query  415  DREQKNAGSYYYLDD  371
            D EQKN+G+++++DD
Sbjct  612  DVEQKNSGNFFFMDD  626


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI-LHAKKTAFVVEHDFI  599
            GE+QR A+A+   + ADIY+ DEPS+YLD  QR+ A+ VI+  +  +A+     VEHD  
Sbjct  221  GELQRFAIAVVAVQNADIYMFDEPSSYLDVRQRLKAALVIRSMVDDNARSYVICVEHDLS  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  281  VLDYLSDFICVLYGTPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRTEELTFK  335



>gb|EMS57600.1| ABC transporter E family member 2 [Triticum urartu]
Length=632

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 129/164 (79%), Gaps = 29/164 (18%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLG+PA+IYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAF+VEHDFIM
Sbjct  469  GELQRVALCLCLGQPAEIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFIVEHDFIM  528

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS------------------------  488
            A YLAD+V+VYEGRPSV+C A +PQSL++GMN FLS                        
Sbjct  529  AAYLADKVVVYEGRPSVECTACTPQSLVSGMNRFLSVWTKSIAYKKLSAMRRALSNPGWS  588

Query  487  -----HLDITFRRDPTNYRPRINKLDSTKDREQKNAGSYYYLDD  371
                 HLDITFRRDPTNYRPRINK+DSTKDREQK AGSYYYLDD
Sbjct  589  LLTSKHLDITFRRDPTNYRPRINKMDSTKDREQKAAGSYYYLDD  632


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R +L +     VVEHD  +
Sbjct  219  GELQRFAIAVVAVQSAEIYMFDEPSSYLDVKQRLKAAQVI-RSLLRSNSYVIVVEHDLSV  277

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  278  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFRDESLTFK  331



>emb|CDI80211.1| ABC transporter family protein , related [Eimeria acervulina]
Length=146

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL + LGKPADIYLIDEPSAYLDSEQRI ASKVIKR+ILHAKKTAFVVEHDFIM
Sbjct  11   GELQRVALIVALGKPADIYLIDEPSAYLDSEQRIAASKVIKRYILHAKKTAFVVEHDFIM  70

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G P VDC A++P+SL+ GMN FL  L+ITFRRDPTN+RPRINKL+S K
Sbjct  71   ATYLADRVIVFDGDPGVDCRASTPESLVNGMNKFLRLLNITFRRDPTNFRPRINKLESCK  130

Query  415  DREQKNAGSYYYLDD  371
            D+EQK AG+++ LDD
Sbjct  131  DKEQKLAGNFFVLDD  145



>gb|ELV10318.1| ATP-binding cassette sub-family E member 1 [Tupaia chinensis]
Length=466

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  332  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  391

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  392  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  451

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  452  DVEQKKSGNYFFLDD  466


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  107  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  165

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  166  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  200



>ref|XP_009518050.1| abc transporter, partial [Phytophthora sojae]
 gb|EGZ30775.1| abc transporter [Phytophthora sojae]
Length=626

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  492  GELQRVAIILCLGKPADIYLIDEPSAYLDSEQRILAAKVIKRFILHAKKTAFVVEHDFIM  551

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VY+G+P ++C A+SPQSLLTGMN FL  L+ITFRRDPTNYRPRINK DS K
Sbjct  552  ATYLADRVVVYDGQPGIECTAHSPQSLLTGMNQFLKQLEITFRRDPTNYRPRINKYDSVK  611

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+++++DD
Sbjct  612  DVEQKTSGNFFFMDD  626


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI-LHAKKTAFVVEHDFI  599
            GE+QR A+A+   + ADIY+ DEPS+YLD  QR+ A+ VI+  +  +A+     VEHD  
Sbjct  221  GELQRFAIAVVAVQKADIYMFDEPSSYLDVRQRLKAALVIRSMVDDNARSYVICVEHDLS  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR +   ++
Sbjct  281  VLDYLSDFICVLYGTPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRTEELTFK  335



>dbj|GAM26905.1| hypothetical protein SAMD00019534_100800, partial [Acytostelium 
subglobosum LB1]
Length=610

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLG+PADIYLIDEPSAYLDSEQRI+A+KVIKRFILHA K+ F+VEHDFIM
Sbjct  473  GELQRVAIVLCLGQPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAGKSGFIVEHDFIM  532

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVY+G PSV C AN+PQSLL+GMN FL  LDITFRRDPTN+RPRINKLDS K
Sbjct  533  ATYLADRVIVYDGMPSVHCTANAPQSLLSGMNTFLKSLDITFRRDPTNFRPRINKLDSVK  592

Query  415  DREQKNAGSYYYLDD  371
            D+EQK  G++++LDD
Sbjct  593  DKEQKTNGNFFFLDD  607


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI R ++       VVEHD  +
Sbjct  227  GELQRFAIAVVCVQAAEIYMFDEPSSYLDVKQRLKAAQVI-RSLIQPTNYIIVVEHDLSV  285

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D V    G      +   P S+  G+N+FL+      ++ FR++   ++
Sbjct  286  LDYLSDFVCCLYGSAGAYGVVTLPFSVRDGINIFLNGFIKTENMRFRKEALTFK  339



>ref|XP_002997210.1| ATP-binding cassette sub-family E member 1 [Phytophthora infestans 
T30-4]
 gb|EEY69572.1| ATP-binding cassette sub-family E member 1 [Phytophthora infestans 
T30-4]
Length=626

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRI+A+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  492  GELQRVAIILCLGKPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAKKTAFVVEHDFIM  551

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VY+G+P ++C A++PQ LLTGMN FL  L+ITFRRDPTNYRPRINK DS K
Sbjct  552  ATYLADRVVVYDGKPGIECTAHAPQGLLTGMNTFLKQLEITFRRDPTNYRPRINKYDSVK  611

Query  415  DREQKNAGSYYYLDD  371
            D EQK++G+++++DD
Sbjct  612  DVEQKSSGNFFFMDD  626


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (55%), Gaps = 5/135 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI-LHAKKTAFVVEHDFI  599
            GE+QR A+A+   + ADIY+ DEPS+YLD  QR+ A+ VI+  +  +A+     VEHD  
Sbjct  221  GELQRFAIAVVAVQKADIYMFDEPSSYLDVRQRLKAALVIRSMVDDNARSYVICVEHDLS  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINK  431
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR +   ++   N 
Sbjct  281  VLDYLSDFICVLYGTPSAYGVVTMPFSVREGINIFLAGFVPTENLRFRTEELTFKVSQNA  340

Query  430  LDSTKDREQKNAGSY  386
             + +      N+ +Y
Sbjct  341  DEFSTGEGDANSFNY  355



>ref|XP_010159708.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Eurypyga helias]
Length=472

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  338  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  397

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  398  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  457

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  458  DVEQKKSGNYFFLDD  472



>emb|CCA19671.1| hypothetical protein ALNC14_058140 [Albugo laibachii Nc14]
Length=627

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPADIYLIDEPSAYLDSEQRIVA+KVIKRFILHAKKTAFVVEHDFIM
Sbjct  493  GELQRVAIVLCLGKPADIYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTAFVVEHDFIM  552

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+VY+G+P VDC A +PQSLL+GMN FL  L+ITFRRDPTN+RPRINK  S K
Sbjct  553  ATYLADRVVVYDGQPGVDCTARTPQSLLSGMNSFLKQLEITFRRDPTNFRPRINKAQSVK  612

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y+++DD
Sbjct  613  DVEQKTSGNYFFMDD  627


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 10/133 (8%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFI-LHAKKTAFVVEHDFI  599
            GE+QR A+ +   + ADIY+ DEPS+YLD  QR+ A+ VI+  + +  K     VEHD  
Sbjct  221  GELQRFAIGVVAVQKADIYMFDEPSSYLDVRQRLKAALVIRSMLEMDPKAYVVCVEHDLS  280

Query  598  MATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINK  431
            +  YL+D + V  G PS   +   P S+  G+N+FL+      ++ FR++   +     K
Sbjct  281  VLDYLSDYICVLYGTPSAYGVVTMPFSVREGINIFLAGFIPTENLRFRQEELTF-----K  335

Query  430  LDSTKDREQKNAG  392
            +  T D    N G
Sbjct  336  VAQTADEFSANDG  348



>emb|CAJ15800.1| RNase L inhibitor [Gallus gallus]
Length=472

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  338  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVMKRFILHAKKTAFVVEHDFIM  397

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  398  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  457

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  458  DVEQKKSGNYFFLDD  472



>gb|EWM23869.1| rnase l inhibitor-like protein [Nannochloropsis gaditana]
Length=657

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLGKPAD+YLIDEPSAYLDSEQRI  SKVIKRFI+H+KKTAFVVEHDFIM
Sbjct  520  GELQRVAIVLCLGKPADVYLIDEPSAYLDSEQRIACSKVIKRFIMHSKKTAFVVEHDFIM  579

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG P V+  ANSPQSLLTGMN FL  L+ITFRRDP+NYRPRINKL+S K
Sbjct  580  ATYLADRVIVYEGDPGVEATANSPQSLLTGMNKFLKQLEITFRRDPSNYRPRINKLESVK  639

Query  415  DREQKNAGSYYYLD  374
            DREQK AG+Y++ D
Sbjct  640  DREQKQAGTYFFAD  653


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 57/101 (56%), Gaps = 5/101 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTA-----FVVE  611
            GE+QR  + +   + AD+Y+ DEPS+YLD +QR+ A+  I+  +   +  +      VVE
Sbjct  230  GELQRFTIGIVCVQEADVYMFDEPSSYLDVKQRLRAALTIRSLVSSGQGGSEQTYVLVVE  289

Query  610  HDFIMATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLS  488
            HD  +  YL+D +    G PS   +   P S+  G+N+FL+
Sbjct  290  HDLAVLDYLSDYICCLYGTPSAYGVVTMPFSVREGINIFLA  330



>ref|XP_001696778.1| hypothetical protein CHLREDRAFT_119356 [Chlamydomonas reinhardtii]
 gb|EDP00886.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=393

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ L LG+PADIYLIDEPSAYLDSEQRI+A+KVIKRFI+H+KKTAF+VEHDFIM
Sbjct  258  GELQRVAITLALGQPADIYLIDEPSAYLDSEQRIMAAKVIKRFIMHSKKTAFIVEHDFIM  317

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATY+ADRVIVYEG PS    A +PQSL TGMN FL++LDITFRRDPTNYRPRINK  STK
Sbjct  318  ATYMADRVIVYEGEPSKRAFARTPQSLQTGMNKFLANLDITFRRDPTNYRPRINKWGSTK  377

Query  415  DREQKNAGSYYYLDD  371
            DREQK AG++YY+ D
Sbjct  378  DREQKEAGTFYYIGD  392


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 67/114 (59%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + AD+Y++DEPS+YLD  QR+ A++VI R +L   K   VVEHD  +
Sbjct  14   GELQRFAIAVVACQQADVYMLDEPSSYLDVRQRLKAAQVI-RSLLAVDKFVIVVEHDLSV  72

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    GRP    +   P  +  G+N+FL+      ++ FR +   ++
Sbjct  73   LDYLSDFICCLYGRPGAYGVVTLPFGVREGINIFLAGFVPTENLRFREESLTFK  126



>ref|NP_001046567.1| Os02g0282900 [Oryza sativa Japonica Group]
 dbj|BAD22422.1| putative 68 kDa protein HP68 [Oryza sativa Japonica Group]
 dbj|BAF08481.1| Os02g0282900 [Oryza sativa Japonica Group]
 gb|EAZ22601.1| hypothetical protein OsJ_06269 [Oryza sativa Japonica Group]
 dbj|BAH00549.1| unnamed protein product [Oryza sativa Japonica Group]
Length=608

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSA+LDSEQR++A+KVIKRFILH KKTAFVVEHDFIM
Sbjct  474  GELQRVALCLCLGKPADIYLIDEPSAHLDSEQRLLAAKVIKRFILHEKKTAFVVEHDFIM  533

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+V+EG+PSVDCIAN+P+ L +GMN FLSHLD+TFR+DPT YRPRINKL S K
Sbjct  534  ATYLADKVVVFEGKPSVDCIANAPEPLASGMNRFLSHLDVTFRKDPTTYRPRINKLGSIK  593

Query  415  DREQKNAGSYYYLD  374
            D EQK AG YYYL+
Sbjct  594  DAEQKAAGCYYYLE  607


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 64/114 (56%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + AD+Y+ DEPS YLD +QR+ A++VI R +L  K    VVEHD  +
Sbjct  224  GELQRFAIAARAMEEADVYMFDEPSCYLDVKQRLKAAQVI-RSLLQPKNYVIVVEHDLSI  282

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G P    +   P S+  G+N+FL       ++ FR +   +R
Sbjct  283  LDYLSDYICCLYGTPGAYGVVTLPSSVREGINIFLDGFIPTENLRFREEKLTFR  336



>ref|XP_011395697.1| ABC transporter E family member 2 [Auxenochlorella protothecoides]
 gb|KFM22831.1| ABC transporter E family member 2 [Auxenochlorella protothecoides]
Length=631

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ +CLG+PA++YLIDEPSAYLDSEQRI+A+KVIKRFI+H+KKTAF+VEHDFIM
Sbjct  497  GELQRVAITMCLGQPANVYLIDEPSAYLDSEQRIIAAKVIKRFIMHSKKTAFIVEHDFIM  556

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A YLADRV+VYEG+PSVD  A +PQSLLTGMNLFL +L+ITFRRDPTNYRPRINK +S K
Sbjct  557  AAYLADRVVVYEGQPSVDATARTPQSLLTGMNLFLKNLEITFRRDPTNYRPRINKKESLK  616

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AG++YYL D
Sbjct  617  DREQKSAGTFYYLGD  631


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 75/136 (55%), Gaps = 7/136 (5%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A +Y+IDEPS+YLD  QR+ A++VI R +L + K   VVEHD  +
Sbjct  248  GELQRFAIAVVALQEAGVYMIDEPSSYLDVRQRLKAAEVI-RGLLASDKYVIVVEHDLSV  306

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D +    G+P    +   P S+  G+N+FL       ++ FR +  +++     +
Sbjct  307  LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLGGFVPTENLRFREESLSFKVSDTTV  366

Query  427  DSTKDREQKNAGSYYY  380
            D   D   K   SY Y
Sbjct  367  DG--DEGAKRFLSYKY  380



>ref|XP_003773214.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
2 [Sarcophilus harrisii]
Length=476

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  342  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  401

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  402  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  461

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  462  DVEQKKSGNYFFLDD  476



>gb|KFQ20366.1| ATP-binding cassette sub-family E member 1, partial [Merops nubicus]
Length=506

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  372  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  431

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  432  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  491

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  492  DVEQKKSGNYFFLDD  506


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  127  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  185

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  186  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  220



>ref|XP_008944156.1| PREDICTED: ATP-binding cassette sub-family E member 1, partial 
[Merops nubicus]
Length=510

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  376  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  435

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  436  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  495

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  496  DVEQKKSGNYFFLDD  510


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  131  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  189

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  190  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  224



>ref|XP_005648868.1| Abce1 protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24324.1| Abce1 protein [Coccomyxa subellipsoidea C-169]
Length=559

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ L LG PADIYLIDEPSAYLDSEQRI+A+KVIKRFI+H+KKTAF+VEHDFIM
Sbjct  425  GELQRVAITLALGTPADIYLIDEPSAYLDSEQRIIAAKVIKRFIMHSKKTAFIVEHDFIM  484

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            A YLADRVIVYEG PS +  A  PQSLL+GMNLFL +LDITFRRDPTNYRPRINK++S K
Sbjct  485  AAYLADRVIVYEGEPSKNATARKPQSLLSGMNLFLKNLDITFRRDPTNYRPRINKMNSVK  544

Query  415  DREQKNAGSYYYLDD  371
            D+EQK+AGS+YYLDD
Sbjct  545  DQEQKSAGSFYYLDD  559


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 71/118 (60%), Gaps = 5/118 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + AD+Y+IDEPS+YLD  QR+ A++VI R +L  KK   VVEHD  +
Sbjct  171  GELQRFAIAVVAAQEADVYMIDEPSSYLDVRQRLKAAQVI-RSLLGPKKYVIVVEHDLAV  229

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRIN  434
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +   ++ RI 
Sbjct  230  LDYLSDFICCLYGKPGAYGVVTMPFSVREGINIFLAGFVPTENLRFRDEALTFKARIT  287



>ref|XP_001913718.1| ATP-binding cassette sub-family E member 1 [Entamoeba histolytica 
HM-1:IMSS]
 gb|EDS89508.1| ATP-binding cassette sub-family E member 1, putative [Entamoeba 
histolytica HM-1:IMSS]
Length=203

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPAD+YLIDEPSAYLDSEQRIVASKVIKRFILH+KKTAF+VEHDFIM
Sbjct  68   GELQRVALVLCLGKPADVYLIDEPSAYLDSEQRIVASKVIKRFILHSKKTAFIVEHDFIM  127

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+VYEG+P+ +CIAN P +++ GMN FL  L+ITFRRDP NYRPRINK +S K
Sbjct  128  ATYLADKVVVYEGKPAEECIANPPVNMVDGMNTFLKSLNITFRRDPDNYRPRINKENSQK  187

Query  415  DREQKNAGSYYYLD  374
            D+EQK  G Y++ +
Sbjct  188  DQEQKREGKYFHTE  201



>ref|XP_004359361.1| RNaseL inhibitor-like protein [Dictyostelium fasciculatum]
 gb|EGG21511.1| RNaseL inhibitor-like protein [Dictyostelium fasciculatum]
Length=602

 Score =   235 bits (599),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ LCLG+PADIYLIDEPSAYLDSEQRI+A+KVIKRFILHA K+ F+VEHDFIM
Sbjct  464  GELQRVAIILCLGQPADIYLIDEPSAYLDSEQRIIAAKVIKRFILHAGKSGFIVEHDFIM  523

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIVYEG PSV C+AN+PQSLL+GMN FL  L+ITFRRDP+N+RPRINKL+S K
Sbjct  524  ATYLADRVIVYEGTPSVSCVANTPQSLLSGMNQFLKSLEITFRRDPSNFRPRINKLNSIK  583

Query  415  DREQKNAGSYYYLDD  371
            D EQK AG+Y++LDD
Sbjct  584  DTEQKYAGNYFFLDD  598


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 74/136 (54%), Gaps = 9/136 (7%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + A+IY+ DEPS+YLD +QR+ A++VI+  I        VVEHD  +
Sbjct  219  GELQRFAIAVVAVQNAEIYMFDEPSSYLDVKQRLKAAQVIRSLIKEGNYI-IVVEHDLSV  277

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKL  428
              YL+D V    G P    +   P S+  G+N+FLS      ++ FRRD   +    N  
Sbjct  278  LDYLSDFVCCLYGSPGAYGVVTLPFSVREGINIFLSGYIKTENMRFRRDALTF----NFA  333

Query  427  DSTKDREQKNAGSYYY  380
            ++ ++ E K    Y Y
Sbjct  334  ETAEEEEVKKHCLYKY  349



>gb|EEC72923.1| hypothetical protein OsI_06764 [Oryza sativa Indica Group]
Length=669

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPADIYLIDEPSA+LDSEQR++A+KVIKRFILH KKTAFVVEHDFIM
Sbjct  473  GELQRVALCLCLGKPADIYLIDEPSAHLDSEQRLLAAKVIKRFILHEKKTAFVVEHDFIM  532

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLAD+V+V+EG+PSVDCIAN+P+ L +GMN FLSHLD+TFR+DPT YRPRINKL S K
Sbjct  533  ATYLADKVVVFEGKPSVDCIANAPEPLASGMNRFLSHLDVTFRKDPTTYRPRINKLGSIK  592

Query  415  DREQKNAGSYYYLD  374
            D EQK AG YYYL+
Sbjct  593  DAEQKAAGCYYYLE  606


 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A    + AD+Y+ DEPS YLD +QR+ A++VI R +L  K    VVEHD  +
Sbjct  223  GELQRFAIAARAMEEADVYMFDEPSCYLDVKQRLKAAQVI-RSLLQPKNYVIVVEHDLSI  281

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G P    +   P S+  G+N+FL+      ++ FR +   +R
Sbjct  282  LDYLSDYICCLYGTPGAYGVVTFPSSVREGINIFLNGFIPTENLRFREEKLTFR  335



>ref|XP_002958474.1| hypothetical protein VOLCADRAFT_121720 [Volvox carteri f. nagariensis]
 gb|EFJ40474.1| hypothetical protein VOLCADRAFT_121720 [Volvox carteri f. nagariensis]
Length=410

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVA+ L LG+PADIYLIDEPSAYLDSEQRI+A+KVIKRFI+H+KKTAF+VEHDFIM
Sbjct  275  GELQRVAITLALGQPADIYLIDEPSAYLDSEQRIMAAKVIKRFIMHSKKTAFIVEHDFIM  334

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATY+ADRVIVYEG PS    A +PQSL TGMN FL +LDITFRRDPTNYRPRINK  STK
Sbjct  335  ATYMADRVIVYEGEPSKHAFARTPQSLQTGMNQFLRNLDITFRRDPTNYRPRINKWGSTK  394

Query  415  DREQKNAGSYYYLDD  371
            DREQK+AG++YY+ D
Sbjct  395  DREQKDAGTFYYIGD  409


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A+A+   + AD+Y++DEPS+YLD  QR+ A++VI R +L   K   VVEHD  +
Sbjct  22   GELQRFAIAVVACQQADVYMLDEPSSYLDVRQRLKAAQVI-RSLLDVDKFVIVVEHDLSV  80

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYR  446
              YL+D +    G+P    +   P S+  G+N+FL+      ++ FR +  +++
Sbjct  81   LDYLSDFICCLYGKPGAYGVVTLPFSVREGINIFLAGFVPTENLRFREESLSFK  134



>ref|XP_009205906.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X3 [Papio anubis]
Length=546

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  412  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  471

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  472  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  531

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  532  DVEQKKSGNYFFLDD  546


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  167  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  225

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  226  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  260



>gb|ABN11928.1| putative ATP-binding cassette sub-family E member 1 [Maconellicoccus 
hirsutus]
Length=372

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPAD+YLIDEPSAYLDSEQRIVA+KVIKRFILHAKKT FVVEHDFIM
Sbjct  238  GELQRVALTLCLGKPADVYLIDEPSAYLDSEQRIVAAKVIKRFILHAKKTGFVVEHDFIM  297

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV+EG PSV+  AN+PQ+LL GMN FL  L ITFRRDP N+RPRINK +S K
Sbjct  298  ATYLADRVIVFEGEPSVESTANTPQTLLAGMNRFLELLGITFRRDPNNFRPRINKANSVK  357

Query  415  DREQKNAGSYYYLDD  371
            D +QK AG Y++L+D
Sbjct  358  DVDQKRAGQYFFLED  372


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 9/121 (7%)
 Frame = -3

Query  730  ADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIMATYLADRVIVYEGRP  551
             DI++ DEPS+YLD +QR+ A+  I R ++ A K   VVEHD  +  YL+D +    G P
Sbjct  7    GDIFMFDEPSSYLDVKQRLKAAVTI-RSLIQADKFVIVVEHDLSVLDYLSDFICCLYGVP  65

Query  550  SVDCIANSPQSLLTGMNLFLSHL----DITFRRDPTNYRPRINKLDSTKDREQKNAGSYY  383
                +   P S+  G+N+FL       ++ FR +   ++      +S  + E K    Y 
Sbjct  66   GAYGVVTMPFSVREGINIFLDGFVPTENLRFREESLVFKVA----ESATEEEVKRMTHYE  121

Query  382  Y  380
            Y
Sbjct  122  Y  122



>gb|KFM79460.1| ATP-binding cassette sub-family E member 1, partial [Stegodyphus 
mimosarum]
Length=601

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVAL LCLGKPAD+YLIDEPSAYLDSEQR+VA+KVIKRFILHAKKT FVVEHDFIM
Sbjct  467  GELQRVALVLCLGKPADVYLIDEPSAYLDSEQRLVAAKVIKRFILHAKKTGFVVEHDFIM  526

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV+EG+PSV+ +ANSPQ+LL GMN FL  L+ITFRRDP NYRPRINKL+S K
Sbjct  527  ATYLADRVIVFEGKPSVETMANSPQTLLAGMNKFLELLNITFRRDPNNYRPRINKLNSVK  586

Query  415  DREQKNAGSYYYLDD  371
            D EQK  G+Y++L+D
Sbjct  587  DTEQKRGGNYFFLED  601


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A++ I R+++H  K   VVEHD  +
Sbjct  222  GELQRFACAIVCIQRADIFMFDEPSSYLDVKQRLKAAEAI-RYLIHPDKYIIVVEHDLSV  280

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G P    +   P S+  G+N+FL
Sbjct  281  LDYLSDFICCLYGVPGAYGVVTMPFSVREGINIFL  315



>ref|XP_004758181.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Mustela 
putorius furo]
Length=544

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  410  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  469

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  470  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  529

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  530  DVEQKKSGNYFFLDD  544


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  210  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  268

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTG  506
              YL+D +    G PS   +   P S+  G
Sbjct  269  LDYLSDFICCLYGVPSAYGVVTMPFSVREG  298



>gb|AAH66836.1| Abce1 protein, partial [Mus musculus]
 gb|AAH66794.1| Abce1 protein, partial [Mus musculus]
Length=575

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  441  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  500

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  501  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  560

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  561  DVEQKKSGNYFFLDD  575


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  196  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  254

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  255  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  289



>emb|CAA52920.1| 2'-5' oligoadenylate binding protein [Homo sapiens]
Length=402

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRV L LCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  268  GELQRVRLRLCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  327

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  328  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  387

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  388  DVEQKKSGNYFFLDD  402


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  23   GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  81

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  82   LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  116



>ref|XP_009501163.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Phalacrocorax 
carbo]
Length=599

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|KFO70694.1| ATP-binding cassette sub-family E member 1, partial [Cuculus 
canorus]
Length=600

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  466  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  525

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  526  ATYLADRVIVFDGVPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  585

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  586  DVEQKKSGNYFFLDD  600


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  221  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  279

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  280  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  314



>ref|XP_010136758.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Buceros 
rhinoceros silvestris]
Length=599

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_008917678.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Manacus 
vitellinus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_009687570.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family 
E member 1 [Struthio camelus australis]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_007235762.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Astyanax 
mexicanus]
Length=372

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  238  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  297

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS    AN+PQ+LL GMN FL+ L+ITFRRDP N+RPRINKL+S K
Sbjct  298  ATYLADRVIVFDGIPSKTTSANTPQTLLAGMNKFLAQLEITFRRDPNNFRPRINKLNSIK  357

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  358  DVEQKKSGNYFFLDD  372



>ref|XP_009568558.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Cuculus 
canorus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|EHH53998.1| hypothetical protein EGM_14727 [Macaca fascicularis]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>dbj|BAE89880.1| unnamed protein product [Macaca fascicularis]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNAVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_009278535.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Aptenodytes 
forsteri]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|EHH26220.1| hypothetical protein EGK_16133 [Macaca mulatta]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVICIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_008499007.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Calypte 
anna]
 ref|XP_008639504.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Corvus 
brachyrhynchos]
 ref|XP_010410284.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Corvus 
cornix cornix]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|NP_001077154.1| ATP-binding cassette sub-family E member 1 [Bos taurus]
 ref|XP_004017271.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ovis aries]
 ref|XP_005217556.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Bos taurus]
 ref|XP_005691269.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Capra 
hircus]
 ref|XP_005908341.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Bos mutus]
 ref|XP_005975468.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pantholops 
hodgsonii]
 ref|XP_006062190.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Bubalus 
bubalis]
 ref|XP_010837423.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Bison 
bison bison]
 ref|XP_010837424.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Bison 
bison bison]
 gb|AAI34546.1| ABCE1 protein [Bos taurus]
 tpg|DAA20891.1| TPA: ATP-binding cassette, sub-family E, member 1 [Bos taurus]
 gb|ELR47216.1| ATP-binding cassette sub-family E member 1 [Bos mutus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_010291764.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Phaethon 
lepturus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_009889030.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Charadrius 
vociferus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|KFW96353.1| ATP-binding cassette sub-family E member 1, partial [Phalacrocorax 
carbo]
Length=610

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  476  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  535

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  536  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  595

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  596  DVEQKKSGNYFFLDD  610


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  231  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  289

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  290  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  324



>ref|XP_009956414.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Leptosomus 
discolor]
 ref|XP_010173643.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Caprimulgus 
carolinensis]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_010011879.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Nestor 
notabilis]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_002188739.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
1 [Taeniopygia guttata]
 ref|XP_005044822.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ficedula 
albicollis]
 ref|XP_005243378.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Falco 
peregrinus]
 ref|XP_005440966.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Falco 
cherrug]
 ref|XP_005525662.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pseudopodoces 
humilis]
 ref|XP_005499929.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Columba 
livia]
 ref|XP_009070821.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Acanthisitta 
chloris]
 ref|XP_009099594.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Serinus 
canaria]
 ref|XP_009099596.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Serinus 
canaria]
 ref|XP_009483432.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pelecanus 
crispus]
 ref|XP_009467035.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Nipponia 
nippon]
 ref|XP_009641929.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Egretta 
garzetta]
 ref|XP_009705784.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Cariama 
cristata]
 ref|XP_009875197.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Apaloderma 
vittatum]
 ref|XP_009895042.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Picoides 
pubescens]
 ref|XP_009925075.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Haliaeetus 
albicilla]
 ref|XP_009925076.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Haliaeetus 
albicilla]
 ref|XP_009925077.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Haliaeetus 
albicilla]
 ref|XP_009941177.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Opisthocomus 
hoazin]
 ref|XP_009965545.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tyto alba]
 ref|XP_010159707.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Eurypyga helias]
 ref|XP_010073761.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pterocles 
gutturalis]
 ref|XP_010192502.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Mesitornis 
unicolor]
 ref|XP_010226547.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tinamus 
guttatus]
 ref|XP_010306504.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Balearica 
regulorum gibbericeps]
 ref|XP_010574249.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Haliaeetus 
leucocephalus]
 ref|XP_010574258.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Haliaeetus 
leucocephalus]
 ref|XP_010574267.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Haliaeetus 
leucocephalus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|AAS07031.1| RNase L inhibitor [Chlorocebus aethiops]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_007127461.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Physeter catodon]
 ref|XP_007127462.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Physeter catodon]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_005146619.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Melopsittacus 
undulatus]
Length=599

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_009574946.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Fulmarus 
glacialis]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004606253.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Sorex 
araneus]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|KFQ42390.1| ATP-binding cassette sub-family E member 1, partial [Nestor notabilis]
Length=604

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  470  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  529

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  530  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  589

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  590  DVEQKKSGNYFFLDD  604


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  225  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  283

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  284  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  318



>ref|XP_005485380.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Zonotrichia 
albicollis]
 ref|XP_005418162.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Geospiza fortis]
 ref|XP_005418163.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Geospiza fortis]
 ref|XP_010120788.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chlamydotis 
macqueenii]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_007189424.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Balaenoptera acutorostrata scammoni]
 ref|XP_007189425.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Balaenoptera acutorostrata scammoni]
 ref|XP_007189426.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X3 [Balaenoptera acutorostrata scammoni]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI + DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADILMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_003500814.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Cricetulus griseus]
 ref|XP_005077785.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Mesocricetus 
auratus]
 ref|XP_007621924.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Cricetulus griseus]
 gb|EGW00215.1| ATP-binding cassette sub-family E member 1 [Cricetulus griseus]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004485045.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette, sub-family 
E (OABP), member 1 [Dasypus novemcinctus]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_009817785.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Gavia 
stellata]
 ref|XP_010206868.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Colius 
striatus]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004655905.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Jaculus 
jaculus]
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSQNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|NP_002931.2| ATP-binding cassette sub-family E member 1 [Homo sapiens]
 ref|NP_001035809.1| ATP-binding cassette sub-family E member 1 [Homo sapiens]
 ref|NP_056566.2| ATP-binding cassette sub-family E member 1 [Mus musculus]
 ref|NP_001233538.1| ATP-binding cassette sub-family E member 1 [Pan troglodytes]
 ref|NP_001253883.1| ATP-binding cassette sub-family E member 1 [Macaca mulatta]
 ref|XP_002716973.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Oryctolagus 
cuniculus]
 ref|XP_002745362.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Callithrix 
jacchus]
 ref|XP_003476892.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Cavia porcellus]
 ref|XP_005006844.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Cavia porcellus]
 ref|XP_005345450.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Microtus 
ochrogaster]
 ref|XP_005386690.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Chinchilla lanigera]
 ref|XP_005386691.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Chinchilla lanigera]
 ref|XP_005386692.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X3 [Chinchilla lanigera]
 ref|XP_006169561.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X3 [Tupaia chinensis]
 ref|XP_006971794.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Peromyscus 
maniculatus bairdii]
 ref|XP_008265616.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Oryctolagus 
cuniculus]
 ref|XP_008825705.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Nannospalax 
galili]
 ref|XP_008967104.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pan paniscus]
 ref|XP_008967105.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pan paniscus]
 ref|XP_009446589.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Pan troglodytes]
 ref|XP_010336937.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010609247.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Fukomys 
damarensis]
 sp|P61221.1|ABCE1_HUMAN RecName: Full=ATP-binding cassette sub-family E member 1; AltName: 
Full=2'-5'-oligoadenylate-binding protein; AltName: Full=HuHP68; 
AltName: Full=RNase L inhibitor; AltName: Full=Ribonuclease 
4 inhibitor; Short=RNS4I [Homo sapiens]
 sp|P61222.1|ABCE1_MOUSE RecName: Full=ATP-binding cassette sub-family E member 1; AltName: 
Full=RNase L inhibitor; AltName: Full=Ribonuclease 4 inhibitor; 
Short=RNS4I [Mus musculus]
 gb|AAH05422.1| ATP-binding cassette, sub-family E (OABP), member 1 [Mus musculus]
 gb|AAH16283.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 dbj|BAB93476.1| ATP-binding cassette sub-family E member 1 [Homo sapiens]
 gb|AAP88781.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 gb|AAX41970.1| ATP-binding cassette sub-family E member 1 [synthetic construct]
 gb|AAZ38723.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 dbj|BAE27718.1| unnamed protein product [Mus musculus]
 dbj|BAE39277.1| unnamed protein product [Mus musculus]
 gb|EAX05049.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 gb|EDL10876.1| ATP-binding cassette, sub-family E (OABP), member 1 [Mus musculus]
 dbj|BAI46190.1| ATP-binding cassette, sub-family E (OABP), member 1 [synthetic 
construct]
 dbj|BAK62336.1| ATP-binding cassette sub-family E member 1 [Pan troglodytes]
 gb|AIC49602.1| ABCE1, partial [synthetic construct]
 prf||2207222A RNase L inhibitor
Length=599

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004378910.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Trichechus 
manatus latirostris]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004645502.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Octodon 
degus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_006906351.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pteropus 
alecto]
 ref|XP_011357725.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pteropus 
vampyrus]
 ref|XP_011357726.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pteropus 
vampyrus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>dbj|BAE39748.1| unnamed protein product [Mus musculus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>dbj|BAE01051.1| unnamed protein product [Macaca fascicularis]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_010007234.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chaetura 
pelagica]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|KFW74048.1| ATP-binding cassette sub-family E member 1, partial [Manacus 
vitellinus]
Length=615

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  481  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  540

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  541  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  600

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  601  DVEQKKSGNYFFLDD  615


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  236  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  294

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  295  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  329



>ref|XP_004316570.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tursiops 
truncatus]
Length=585

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  451  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  510

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  511  ATYLADRVIVFDGVPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  570

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  571  DVEQKKSGNYFFLDD  585


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  206  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  264

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  265  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  299



>ref|XP_008142077.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Eptesicus 
fuscus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|AAC24730.1| RNAse L inhibitor [Mus musculus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_006756018.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Myotis 
davidii]
 gb|ELK36116.1| ATP-binding cassette sub-family E member 1 [Myotis davidii]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|NP_001101916.1| ATP-binding cassette sub-family E member 1 [Rattus norvegicus]
 ref|NP_001126534.1| ATP-binding cassette sub-family E member 1 [Pongo abelii]
 ref|XP_003257812.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Nomascus 
leucogenys]
 ref|XP_005556066.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Macaca fascicularis]
 ref|XP_005556067.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Macaca fascicularis]
 ref|XP_006255469.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Rattus norvegicus]
 ref|XP_007998089.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chlorocebus 
sabaeus]
 ref|XP_007998090.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chlorocebus 
sabaeus]
 ref|XP_009205904.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Papio anubis]
 ref|XP_009238619.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Pongo abelii]
 ref|XP_010359515.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Rhinopithecus 
roxellana]
 ref|XP_010359524.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Rhinopithecus 
roxellana]
 emb|CAH92618.1| hypothetical protein [Pongo abelii]
 gb|EDL92306.1| ATP-binding cassette, sub-family E (OABP), member 1 [Rattus norvegicus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|AAP06039.1| SJCHGC02444 protein [Schistosoma japonicum]
Length=149

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR+A+ LCLG+PAD+YLIDEPSAYLDSEQR+ A+KVIKRFILHAKKTAF+VEHDFIM
Sbjct  15   GELQRLAITLCLGQPADVYLIDEPSAYLDSEQRLHAAKVIKRFILHAKKTAFIVEHDFIM  74

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRV+V++G+P V   A +PQ+L+TGMN FL  LDITFRRDPTN RPRINKL+S K
Sbjct  75   ATYLADRVVVFDGQPGVKATATTPQNLVTGMNKFLQSLDITFRRDPTNARPRINKLNSVK  134

Query  415  DREQKNAGSYYYLDD  371
            D +QK +G+Y++L D
Sbjct  135  DVDQKKSGNYFFLGD  149



>gb|KFV08643.1| ATP-binding cassette sub-family E member 1, partial [Pterocles 
gutturalis]
Length=606

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  472  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  531

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  532  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  591

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  592  DVEQKKSGNYFFLDD  606


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  227  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  285

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  286  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  320



>gb|KGL97849.1| ATP-binding cassette sub-family E member 1, partial [Charadrius 
vociferus]
Length=607

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  473  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  532

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  533  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  592

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  593  DVEQKKSGNYFFLDD  607


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  228  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  286

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  287  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  321



>gb|KFP79450.1| ATP-binding cassette sub-family E member 1, partial [Apaloderma 
vittatum]
 gb|KFV51262.1| ATP-binding cassette sub-family E member 1, partial [Tyto alba]
Length=607

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  473  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  532

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  533  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  592

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  593  DVEQKKSGNYFFLDD  607


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  228  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  286

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  287  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  321



>ref|XP_005864932.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Myotis brandtii]
 ref|XP_006081801.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Myotis lucifugus]
 ref|XP_006081802.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Myotis lucifugus]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_001501999.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Equus 
caballus]
 ref|XP_008513587.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Equus 
przewalskii]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004708755.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Echinops 
telfairi]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|KFO91191.1| ATP-binding cassette sub-family E member 1, partial [Buceros 
rhinoceros silvestris]
Length=610

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  476  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  535

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  536  ATYLADRVIVFDGVPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  595

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  596  DVEQKKSGNYFFLDD  610


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  231  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  289

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  290  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  324



>gb|KFP06257.1| ATP-binding cassette sub-family E member 1, partial [Calypte 
anna]
Length=610

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  476  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  535

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  536  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  595

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  596  DVEQKKSGNYFFLDD  610


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  231  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  289

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  290  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  324



>ref|XP_003790241.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family 
E member 1 [Otolemur garnettii]
Length=602

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  468  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  527

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  528  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  587

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  588  DVEQKKSGNYFFLDD  602


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  223  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  281

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  282  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  316



>gb|KFO03636.1| ATP-binding cassette sub-family E member 1, partial [Balearica 
regulorum gibbericeps]
Length=610

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  476  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  535

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  536  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  595

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  596  DVEQKKSGNYFFLDD  610


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  231  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  289

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  290  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  324



>gb|KFP68620.1| ATP-binding cassette sub-family E member 1, partial [Cariama 
cristata]
Length=609

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  475  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  534

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  535  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  594

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  595  DVEQKKSGNYFFLDD  609


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  230  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  288

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  289  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  323



>ref|XP_002916281.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ailuropoda 
melanoleuca]
 ref|XP_867212.2| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
4 [Canis lupus familiaris]
 ref|XP_003985024.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Felis 
catus]
 ref|XP_004411823.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Odobenus 
rosmarus divergens]
 ref|XP_004588193.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ochotona 
princeps]
 ref|XP_004685359.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Condylura 
cristata]
 ref|XP_004802299.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Mustela 
putorius furo]
 ref|XP_004907711.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004907712.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004907713.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X3 [Heterocephalus glaber]
 ref|XP_004868966.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Heterocephalus 
glaber]
 ref|XP_006744161.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006744162.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Leptonychotes weddellii]
 ref|XP_007091833.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Panthera 
tigris altaica]
 ref|XP_007528329.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Erinaceus 
europaeus]
 ref|XP_007942294.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Orycteropus 
afer afer]
 ref|XP_008069707.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tarsius 
syrichta]
 ref|XP_008584155.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Galeopterus 
variegatus]
 ref|XP_008584156.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Galeopterus 
variegatus]
 ref|XP_008683663.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ursus 
maritimus]
 gb|EHB17456.1| ATP-binding cassette sub-family E member 1 [Heterocephalus glaber]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>ref|XP_004420936.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ceratotherium 
simum simum]
Length=599

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++V+KRFILHAKKTAFVVEHDFIM
Sbjct  465  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIM  524

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  525  ATYLADRVIVFDGIPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  584

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  585  DVEQKKSGNYFFLDD  599


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  220  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  278

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  279  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  313



>gb|KFP27294.1| ATP-binding cassette sub-family E member 1, partial [Colius striatus]
Length=610

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QRVALALCLGKPAD+YLIDEPSAYLDSEQR++A++VIKRFILHAKKTAFVVEHDFIM
Sbjct  476  GELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVIKRFILHAKKTAFVVEHDFIM  535

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFLSHLDITFRRDPTNYRPRINKLDSTK  416
            ATYLADRVIV++G PS + +ANSPQ+LL GMN FLS L+ITFRRDP NYRPRINKL+S K
Sbjct  536  ATYLADRVIVFDGIPSKNTLANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIK  595

Query  415  DREQKNAGSYYYLDD  371
            D EQK +G+Y++LDD
Sbjct  596  DVEQKKSGNYFFLDD  610


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -3

Query  775  GEVQRVALALCLGKPADIYLIDEPSAYLDSEQRIVASKVIKRFILHAKKTAFVVEHDFIM  596
            GE+QR A A+   + ADI++ DEPS+YLD +QR+ A+  I R +++  +   VVEHD  +
Sbjct  231  GELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITI-RSLINPDRYIIVVEHDLSV  289

Query  595  ATYLADRVIVYEGRPSVDCIANSPQSLLTGMNLFL  491
              YL+D +    G PS   +   P S+  G+N+FL
Sbjct  290  LDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFL  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730