BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046C11

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08361.1|  unnamed protein product                                189   2e-53   Coffea canephora [robusta coffee]
gb|AAF14242.1|AF110226_1  nuclear RNA binding protein                   179   1e-50   Nicotiana tabacum [American tobacco]
ref|XP_009613635.1|  PREDICTED: plasminogen activator inhibitor 1...    179   8e-50   Nicotiana tomentosiformis
ref|XP_011081281.1|  PREDICTED: RNA-binding protein FUS isoform X1      176   5e-49   Sesamum indicum [beniseed]
ref|XP_009789577.1|  PREDICTED: plasminogen activator inhibitor 1...    172   3e-47   Nicotiana sylvestris
ref|XP_009607512.1|  PREDICTED: intracellular hyaluronan-binding ...    169   2e-46   Nicotiana tomentosiformis
ref|XP_006362472.1|  PREDICTED: plasminogen activator inhibitor 1...    167   1e-45   Solanum tuberosum [potatoes]
ref|XP_004253373.2|  PREDICTED: plasminogen activator inhibitor 1...    164   9e-45   Solanum lycopersicum
ref|XP_011081284.1|  PREDICTED: plasminogen activator inhibitor 1...    164   2e-44   Sesamum indicum [beniseed]
ref|NP_001275449.1|  plasminogen activator inhibitor 1 RNA-bindin...    164   3e-44   Solanum tuberosum [potatoes]
ref|XP_006362474.1|  PREDICTED: plasminogen activator inhibitor 1...    164   3e-44   Solanum tuberosum [potatoes]
ref|XP_006362473.1|  PREDICTED: plasminogen activator inhibitor 1...    164   3e-44   
ref|XP_010677113.1|  PREDICTED: plasminogen activator inhibitor 1...    161   3e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002303373.2|  nuclear RNA-binding family protein                 159   3e-42   
ref|XP_009594553.1|  PREDICTED: plasminogen activator inhibitor 1...    158   3e-42   Nicotiana tomentosiformis
ref|XP_009772173.1|  PREDICTED: plasminogen activator inhibitor 1...    157   6e-42   Nicotiana sylvestris
ref|XP_011031954.1|  PREDICTED: plasminogen activator inhibitor 1...    157   6e-42   Populus euphratica
ref|XP_009766508.1|  PREDICTED: plasminogen activator inhibitor 1...    156   3e-41   Nicotiana sylvestris
gb|KDP39931.1|  hypothetical protein JCGZ_03462                         155   5e-41   Jatropha curcas
ref|XP_010275458.1|  PREDICTED: plasminogen activator inhibitor 1...    154   9e-41   Nelumbo nucifera [Indian lotus]
ref|XP_002266051.1|  PREDICTED: uncharacterized protein DDB_G0288133    154   2e-40   Vitis vinifera
emb|CAN75176.1|  hypothetical protein VITISV_016687                     154   2e-40   Vitis vinifera
ref|XP_010661405.1|  PREDICTED: plasminogen activator inhibitor 1...    153   3e-40   Vitis vinifera
ref|XP_004244706.2|  PREDICTED: plasminogen activator inhibitor 1...    151   1e-39   Solanum lycopersicum
gb|KDO57096.1|  hypothetical protein CISIN_1g017915mg                   151   2e-39   Citrus sinensis [apfelsine]
ref|XP_006477112.1|  PREDICTED: plasminogen activator inhibitor 1...    151   2e-39   Citrus sinensis [apfelsine]
gb|KJB37651.1|  hypothetical protein B456_006G214200                    150   2e-39   Gossypium raimondii
ref|XP_006440205.1|  hypothetical protein CICLE_v10020747mg             151   2e-39   Citrus clementina [clementine]
gb|KJB37646.1|  hypothetical protein B456_006G214200                    150   4e-39   Gossypium raimondii
ref|XP_010258760.1|  PREDICTED: plasminogen activator inhibitor 1...    150   4e-39   Nelumbo nucifera [Indian lotus]
gb|AEI59279.1|  RNA binding protein                                     149   7e-39   Suaeda glauca
ref|XP_007052327.1|  Hyaluronan / mRNA binding family isoform 1         148   2e-38   
ref|XP_002531778.1|  Plasminogen activator inhibitor 1 RNA-bindin...    148   3e-38   Ricinus communis
gb|EYU19470.1|  hypothetical protein MIMGU_mgv1a008507mg                147   7e-38   Erythranthe guttata [common monkey flower]
gb|KJB37647.1|  hypothetical protein B456_006G214200                    146   1e-37   Gossypium raimondii
ref|XP_007052330.1|  Hyaluronan / mRNA binding family isoform 4         144   1e-37   
gb|KDO57095.1|  hypothetical protein CISIN_1g017915mg                   146   1e-37   Citrus sinensis [apfelsine]
gb|KJB37648.1|  hypothetical protein B456_006G214200                    144   5e-37   Gossypium raimondii
ref|XP_007039722.1|  Hyaluronan / mRNA binding family                   144   8e-37   
gb|KDO57093.1|  hypothetical protein CISIN_1g017915mg                   143   1e-36   Citrus sinensis [apfelsine]
ref|XP_009613636.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    143   1e-36   Nicotiana tomentosiformis
ref|XP_011093236.1|  PREDICTED: plasminogen activator inhibitor 1...    143   2e-36   Sesamum indicum [beniseed]
gb|KJB24881.1|  hypothetical protein B456_004G166200                    142   3e-36   Gossypium raimondii
gb|KJB24880.1|  hypothetical protein B456_004G166200                    142   3e-36   Gossypium raimondii
ref|XP_008373667.1|  PREDICTED: plasminogen activator inhibitor 1...    142   5e-36   Malus domestica [apple tree]
ref|XP_008369209.1|  PREDICTED: plasminogen activator inhibitor 1...    142   6e-36   Malus domestica [apple tree]
gb|KHG27284.1|  hypothetical protein F383_11722                         141   6e-36   Gossypium arboreum [tree cotton]
gb|KHG17525.1|  Plasminogen activator inhibitor 1 RNA-binding           141   7e-36   Gossypium arboreum [tree cotton]
ref|XP_007209289.1|  hypothetical protein PRUPE_ppa007665mg             141   9e-36   Prunus persica
gb|KJB25493.1|  hypothetical protein B456_004G194400                    141   1e-35   Gossypium raimondii
ref|XP_003521066.1|  PREDICTED: plasminogen activator inhibitor 1...    141   1e-35   Glycine max [soybeans]
gb|KJB24891.1|  hypothetical protein B456_004G166300                    140   2e-35   Gossypium raimondii
gb|ABK94426.1|  unknown                                                 140   3e-35   Populus trichocarpa [western balsam poplar]
gb|KHG05539.1|  Plasminogen activator inhibitor 1 RNA-binding           140   3e-35   Gossypium arboreum [tree cotton]
ref|XP_006368965.1|  nuclear RNA-binding family protein                 140   3e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009343931.1|  PREDICTED: plasminogen activator inhibitor 1...    139   6e-35   Pyrus x bretschneideri [bai li]
ref|XP_006398418.1|  hypothetical protein EUTSA_v10000938mg             139   7e-35   Eutrema salsugineum [saltwater cress]
ref|XP_008238397.1|  PREDICTED: plasminogen activator inhibitor 1...    138   1e-34   Prunus mume [ume]
gb|KJB25494.1|  hypothetical protein B456_004G194400                    137   3e-34   Gossypium raimondii
ref|XP_009789579.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    136   4e-34   Nicotiana sylvestris
gb|AAF14244.1|AF110228_1  nuclear RNA binding protein A                 136   6e-34   Spinacia oleracea
ref|XP_011032359.1|  PREDICTED: plasminogen activator inhibitor 1...    136   6e-34   Populus euphratica
ref|XP_009368154.1|  PREDICTED: plasminogen activator inhibitor 1...    136   8e-34   
gb|KHG30709.1|  hypothetical protein F383_14338                         135   8e-34   Gossypium arboreum [tree cotton]
ref|XP_004300342.1|  PREDICTED: intracellular hyaluronan-binding ...    136   1e-33   Fragaria vesca subsp. vesca
ref|XP_007134461.1|  hypothetical protein PHAVU_010G049300g             135   2e-33   Phaseolus vulgaris [French bean]
ref|XP_003529036.1|  PREDICTED: plasminogen activator inhibitor 1...    135   2e-33   Glycine max [soybeans]
ref|XP_007218155.1|  hypothetical protein PRUPE_ppa007410mg             134   3e-33   Prunus persica
ref|XP_008232490.1|  PREDICTED: plasminogen activator inhibitor 1...    134   3e-33   Prunus mume [ume]
ref|XP_011081282.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    134   4e-33   Sesamum indicum [beniseed]
ref|XP_006375155.1|  hypothetical protein POPTR_0014s04820g             134   4e-33   Populus trichocarpa [western balsam poplar]
gb|ABK94354.1|  unknown                                                 134   4e-33   Populus trichocarpa [western balsam poplar]
ref|NP_001241515.1|  uncharacterized protein LOC100807657               134   5e-33   Glycine max [soybeans]
ref|XP_011032341.1|  PREDICTED: plasminogen activator inhibitor 1...    133   9e-33   Populus euphratica
ref|XP_006837401.1|  hypothetical protein AMTR_s00111p00140620          133   1e-32   Amborella trichopoda
ref|XP_009368155.1|  PREDICTED: plasminogen activator inhibitor 1...    132   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_008347095.1|  PREDICTED: plasminogen activator inhibitor 1...    130   1e-32   
ref|XP_008238398.1|  PREDICTED: plasminogen activator inhibitor 1...    132   2e-32   Prunus mume [ume]
emb|CDP21265.1|  unnamed protein product                                132   2e-32   Coffea canephora [robusta coffee]
ref|XP_006853790.1|  hypothetical protein AMTR_s00056p00215280          132   3e-32   
ref|XP_011047584.1|  PREDICTED: plasminogen activator inhibitor 1...    132   3e-32   Populus euphratica
gb|KCW77830.1|  hypothetical protein EUGRSUZ_D02118                     132   3e-32   Eucalyptus grandis [rose gum]
ref|XP_008344404.1|  PREDICTED: plasminogen activator inhibitor 1...    131   4e-32   
ref|XP_009373211.1|  PREDICTED: plasminogen activator inhibitor 1...    130   8e-32   Pyrus x bretschneideri [bai li]
ref|XP_004306983.1|  PREDICTED: circumsporozoite protein-like           130   8e-32   Fragaria vesca subsp. vesca
ref|XP_009776248.1|  PREDICTED: plasminogen activator inhibitor 1...    130   1e-31   Nicotiana sylvestris
ref|XP_003552493.1|  PREDICTED: plasminogen activator inhibitor 1...    130   2e-31   Glycine max [soybeans]
ref|XP_008375773.1|  PREDICTED: LOW QUALITY PROTEIN: plasminogen ...    130   2e-31   
ref|XP_009607515.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    129   2e-31   Nicotiana tomentosiformis
ref|XP_011465242.1|  PREDICTED: plasminogen activator inhibitor 1...    129   2e-31   Fragaria vesca subsp. vesca
ref|XP_010053521.1|  PREDICTED: vasodilator-stimulated phosphopro...    129   3e-31   Eucalyptus grandis [rose gum]
gb|KCW77831.1|  hypothetical protein EUGRSUZ_D02118                     129   3e-31   Eucalyptus grandis [rose gum]
ref|XP_010924482.1|  PREDICTED: probable H/ACA ribonucleoprotein ...    129   3e-31   Elaeis guineensis
gb|KHN40549.1|  hypothetical protein glysoja_001047                     129   3e-31   Glycine soja [wild soybean]
ref|XP_004515346.1|  PREDICTED: plasminogen activator inhibitor 1...    128   8e-31   Cicer arietinum [garbanzo]
ref|XP_010053519.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    127   1e-30   Eucalyptus grandis [rose gum]
dbj|BAE71280.1|  putative nuclear antigen homolog                       127   2e-30   Trifolium pratense [peavine clover]
ref|XP_010531668.1|  PREDICTED: plasminogen activator inhibitor 1...    126   2e-30   Tarenaya hassleriana [spider flower]
dbj|BAE71204.1|  putative nuclear antigen homolog                       126   3e-30   Trifolium pratense [peavine clover]
gb|KFK31390.1|  hypothetical protein AALP_AA6G105700                    126   3e-30   Arabis alpina [alpine rockcress]
ref|XP_010104826.1|  hypothetical protein L484_024026                   127   4e-30   
ref|XP_011017364.1|  PREDICTED: plasminogen activator inhibitor 1...    125   5e-30   Populus euphratica
ref|XP_007139646.1|  hypothetical protein PHAVU_008G047300g             125   7e-30   Phaseolus vulgaris [French bean]
ref|XP_010918620.1|  PREDICTED: plasminogen activator inhibitor 1...    125   7e-30   Elaeis guineensis
ref|XP_008459799.1|  PREDICTED: plasminogen activator inhibitor 1...    125   8e-30   Cucumis melo [Oriental melon]
gb|AES80534.2|  nuclear RNA-binding-like protein                        127   9e-30   Medicago truncatula
ref|XP_003624316.1|  Transcription factor                               127   1e-29   
ref|XP_010531670.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    124   1e-29   Tarenaya hassleriana [spider flower]
gb|AFK43517.1|  unknown                                                 124   1e-29   Lotus japonicus
emb|CDY40563.1|  BnaC02g33290D                                          124   1e-29   Brassica napus [oilseed rape]
gb|KJB37649.1|  hypothetical protein B456_006G214200                    123   2e-29   Gossypium raimondii
ref|XP_008798813.1|  PREDICTED: plasminogen activator inhibitor 1...    124   2e-29   Phoenix dactylifera
gb|ABD65038.1|  nuclear RNA binding protein, putative                   123   3e-29   Brassica oleracea
ref|XP_008810382.1|  PREDICTED: plasminogen activator inhibitor 1...    123   4e-29   Phoenix dactylifera
ref|XP_002301233.2|  transcription factor family protein                122   6e-29   
ref|XP_006644341.1|  PREDICTED: plasminogen activator inhibitor 1...    122   7e-29   Oryza brachyantha
ref|XP_007142624.1|  hypothetical protein PHAVU_007G003500g             122   8e-29   Phaseolus vulgaris [French bean]
gb|EAY75654.1|  hypothetical protein OsI_03559                          122   8e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_009128949.1|  PREDICTED: suppressor protein STM1-like            122   8e-29   Brassica rapa
ref|XP_004961407.1|  PREDICTED: RNA-binding protein FUS-like            122   8e-29   Setaria italica
gb|ABD64914.1|  nuclear RNA binding protein, putative                   122   9e-29   Brassica oleracea
ref|XP_010531669.1|  PREDICTED: plasminogen activator inhibitor 1...    122   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_009395730.1|  PREDICTED: keratin, type II cytoskeletal 2 e...    122   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006280739.1|  hypothetical protein CARUB_v10026708mg             121   2e-28   Capsella rubella
dbj|BAE71297.1|  hypothetical protein                                   121   2e-28   Trifolium pratense [peavine clover]
emb|CDY43435.1|  BnaAnng07070D                                          121   2e-28   Brassica napus [oilseed rape]
ref|XP_009101440.1|  PREDICTED: suppressor protein STM1                 120   2e-28   Brassica rapa
ref|XP_003556572.1|  PREDICTED: plasminogen activator inhibitor 1...    120   2e-28   Glycine max [soybeans]
emb|CDY67886.1|  BnaCnng56800D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_009114287.1|  PREDICTED: uncharacterized protein LOC103839539    120   3e-28   Brassica rapa
gb|KJB37650.1|  hypothetical protein B456_006G214200                    119   3e-28   Gossypium raimondii
gb|EAZ13376.1|  hypothetical protein OsJ_03294                          120   3e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010919739.1|  PREDICTED: plasminogen activator inhibitor 1...    120   3e-28   Elaeis guineensis
ref|XP_004140509.1|  PREDICTED: uncharacterized protein LOC101209927    120   4e-28   Cucumis sativus [cucumbers]
ref|XP_002870130.1|  hypothetical protein ARALYDRAFT_493188             120   4e-28   
ref|XP_002870099.1|  hypothetical protein ARALYDRAFT_493124             120   4e-28   Arabidopsis lyrata subsp. lyrata
gb|KJB22277.1|  hypothetical protein B456_004G038700                    120   5e-28   Gossypium raimondii
ref|NP_001044098.1|  Os01g0721900                                       120   6e-28   
ref|XP_010449600.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    120   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010434652.1|  PREDICTED: plasminogen activator inhibitor 1...    119   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010449710.1|  PREDICTED: plasminogen activator inhibitor 1...    117   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002458112.1|  hypothetical protein SORBIDRAFT_03g027110          119   2e-27   Sorghum bicolor [broomcorn]
ref|XP_008798814.1|  PREDICTED: plasminogen activator inhibitor 1...    119   2e-27   Phoenix dactylifera
gb|EPS72575.1|  hypothetical protein M569_02184                         118   2e-27   Genlisea aurea
ref|XP_006414296.1|  hypothetical protein EUTSA_v10025552mg             118   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_004150996.1|  PREDICTED: uncharacterized protein LOC101210473    117   3e-27   Cucumis sativus [cucumbers]
ref|XP_010481348.1|  PREDICTED: plasminogen activator inhibitor 1...    117   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010481347.1|  PREDICTED: plasminogen activator inhibitor 1...    117   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010441486.1|  PREDICTED: plasminogen activator inhibitor 1...    117   4e-27   Camelina sativa [gold-of-pleasure]
gb|KJB24892.1|  hypothetical protein B456_004G166300                    117   4e-27   Gossypium raimondii
ref|XP_009772180.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    117   6e-27   Nicotiana sylvestris
ref|XP_010449709.1|  PREDICTED: plasminogen activator inhibitor 1...    117   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009396539.1|  PREDICTED: plasminogen activator inhibitor 1...    117   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010439990.1|  PREDICTED: H/ACA ribonucleoprotein complex s...    117   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009145376.1|  PREDICTED: plasminogen activator inhibitor 1...    116   8e-27   Brassica rapa
ref|XP_002440366.1|  hypothetical protein SORBIDRAFT_09g030400          117   8e-27   Sorghum bicolor [broomcorn]
ref|XP_009145362.1|  PREDICTED: plasminogen activator inhibitor 1...    115   1e-26   Brassica rapa
ref|XP_010494951.1|  PREDICTED: plasminogen activator inhibitor 1...    115   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010919740.1|  PREDICTED: plasminogen activator inhibitor 1...    115   2e-26   Elaeis guineensis
gb|ABR25759.1|  nuclear antigen                                         113   2e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001078399.1|  hyaluronan / mRNA binding domain-containing ...    114   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001043502.1|  Os01g0603000                                       115   3e-26   
ref|XP_004969088.1|  PREDICTED: plasminogen activator inhibitor 1...    114   5e-26   Setaria italica
gb|KFK22256.1|  hypothetical protein AALP_AAs66747U001100               114   6e-26   Arabis alpina [alpine rockcress]
ref|XP_011101848.1|  PREDICTED: plasminogen activator inhibitor 1...    114   6e-26   Sesamum indicum [beniseed]
gb|KJB37652.1|  hypothetical protein B456_006G214200                    114   7e-26   Gossypium raimondii
dbj|BAG90611.1|  unnamed protein product                                111   8e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009410905.1|  PREDICTED: plasminogen activator inhibitor 1...    114   8e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY35615.1|  BnaC01g21370D                                          113   9e-26   Brassica napus [oilseed rape]
ref|NP_193416.1|  hyaluronan / mRNA binding domain-containing pro...    113   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64962.1|  nuclear RNA binding protein A-like protein              113   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004148350.1|  PREDICTED: uncharacterized protein LOC101207608    112   2e-25   Cucumis sativus [cucumbers]
emb|CDY28966.1|  BnaA02g25100D                                          112   2e-25   Brassica napus [oilseed rape]
ref|NP_001078400.1|  hyaluronan / mRNA binding domain-containing ...    112   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434762.1|  PREDICTED: plasminogen activator inhibitor 1...    112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010925494.1|  PREDICTED: protein argonaute 2-like                112   2e-25   Elaeis guineensis
ref|XP_008465866.1|  PREDICTED: plasminogen activator inhibitor 1...    112   3e-25   Cucumis melo [Oriental melon]
gb|EYU40365.1|  hypothetical protein MIMGU_mgv1a008102mg                112   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_004961035.1|  PREDICTED: insulin receptor substrate 4-like       112   3e-25   Setaria italica
gb|ABD65067.1|  nuclear RNA binding protein, putative                   112   3e-25   Brassica oleracea
gb|AAM61393.1|  nuclear antigen homolog                                 112   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148572.1|  plasminogen activator inhibitor 1 RNA-bindin...    112   3e-25   Zea mays [maize]
ref|NP_001056139.1|  Os05g0533100                                       111   3e-25   
emb|CDX76586.1|  BnaA08g08140D                                          112   3e-25   
ref|XP_006285507.1|  hypothetical protein CARUB_v10006948mg             112   4e-25   Capsella rubella
ref|XP_002863351.1|  hypothetical protein ARALYDRAFT_494257             112   4e-25   
ref|XP_006414219.1|  hypothetical protein EUTSA_v10025512mg             112   4e-25   Eutrema salsugineum [saltwater cress]
gb|AFW81314.1|  plasminogen activator inhibitor 1 RNA-binding pro...    112   4e-25   
ref|XP_009416461.1|  PREDICTED: plasminogen activator inhibitor 1...    112   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006284012.1|  hypothetical protein CARUB_v10005134mg             111   5e-25   Capsella rubella
gb|EAY74854.1|  hypothetical protein OsI_02745                          111   5e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001056483.1|  Os05g0589600                                       111   5e-25   
ref|XP_004969787.1|  PREDICTED: eukaryotic translation initiation...    111   7e-25   Setaria italica
gb|KEH17858.1|  nuclear RNA-binding-like protein                        111   7e-25   Medicago truncatula
ref|XP_009108277.1|  PREDICTED: plasminogen activator inhibitor 1...    110   8e-25   Brassica rapa
gb|EEE64473.1|  hypothetical protein OsJ_19323                          111   8e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79581.1|  hypothetical protein OsI_20751                          111   9e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006477113.1|  PREDICTED: plasminogen activator inhibitor 1...    110   9e-25   Citrus sinensis [apfelsine]
gb|AAT47083.1|  unknown protein                                         110   1e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KDO57094.1|  hypothetical protein CISIN_1g017915mg                   110   1e-24   Citrus sinensis [apfelsine]
emb|CDY65881.1|  BnaAnng21260D                                          110   1e-24   Brassica napus [oilseed rape]
ref|XP_006654864.1|  PREDICTED: plasminogen activator inhibitor 1...    110   1e-24   Oryza brachyantha
ref|XP_009108330.1|  PREDICTED: plasminogen activator inhibitor 1...    110   1e-24   Brassica rapa
ref|XP_006440206.1|  hypothetical protein CICLE_v10020747mg             110   1e-24   Citrus clementina [clementine]
emb|CDX76567.1|  BnaA08g08330D                                          110   1e-24   
gb|ACG24258.1|  plasminogen activator inhibitor 1 RNA-binding pro...    110   2e-24   Zea mays [maize]
gb|EAY99238.1|  hypothetical protein OsI_21200                          110   2e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_193485.1|  hyaluronan / mRNA binding family                      110   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19467.1|  hypothetical protein MIMGU_mgv1a008831mg                109   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_002440127.1|  hypothetical protein SORBIDRAFT_09g026550          109   3e-24   Sorghum bicolor [broomcorn]
ref|XP_009108276.1|  PREDICTED: plasminogen activator inhibitor 1...    109   3e-24   Brassica rapa
ref|NP_001281195.1|  plasminogen activator inhibitor 1 RNA-bindin...    109   4e-24   Zea mays [maize]
ref|XP_003567795.1|  PREDICTED: plasminogen activator inhibitor 1...    109   4e-24   Brachypodium distachyon [annual false brome]
emb|CAA66481.1|  transcription factor                                   108   6e-24   Vicia faba var. minor [tick bean]
gb|KDP28866.1|  hypothetical protein JCGZ_14637                         108   6e-24   Jatropha curcas
gb|EMS68133.1|  hypothetical protein TRIUR3_26332                       111   7e-24   Triticum urartu
ref|XP_002511578.1|  RNA binding protein, putative                      107   1e-23   Ricinus communis
ref|XP_008675099.1|  PREDICTED: plasminogen activator inhibitor 1...    107   1e-23   Zea mays [maize]
gb|ACL54182.1|  unknown                                                 105   1e-23   Zea mays [maize]
emb|CDY33522.1|  BnaA06g35510D                                          107   2e-23   Brassica napus [oilseed rape]
gb|KHN27127.1|  hypothetical protein glysoja_032895                     106   2e-23   Glycine soja [wild soybean]
gb|KFK24045.1|  hypothetical protein AALP_AAs42697U000600               106   4e-23   Arabis alpina [alpine rockcress]
ref|XP_011093237.1|  PREDICTED: plasminogen activator inhibitor 1...    106   4e-23   Sesamum indicum [beniseed]
gb|EMT09866.1|  hypothetical protein F775_32096                         105   4e-23   
dbj|BAJ89734.1|  predicted protein                                      106   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004492923.1|  PREDICTED: intracellular hyaluronan-binding ...    106   5e-23   Cicer arietinum [garbanzo]
gb|KHG04303.1|  hypothetical protein F383_01005                         105   7e-23   Gossypium arboreum [tree cotton]
ref|XP_009605755.1|  PREDICTED: plasminogen activator inhibitor 1...    105   1e-22   Nicotiana tomentosiformis
gb|EMT08444.1|  hypothetical protein F775_29168                         107   1e-22   
gb|ABD65145.1|  nuclear RNA binding protein, putative                   104   2e-22   Brassica oleracea
emb|CAC85227.1|  salt tolerance protein 1                               103   2e-22   Beta vulgaris [beet]
emb|CDY38403.1|  BnaC01g10120D                                          103   2e-22   Brassica napus [oilseed rape]
ref|XP_010692032.1|  PREDICTED: uncharacterized protein DDB_G0288...    103   2e-22   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS59053.1|  hypothetical protein TRIUR3_33029                       103   2e-22   Triticum urartu
ref|XP_003569708.1|  PREDICTED: RNA-binding protein FUS-like            103   2e-22   Brachypodium distachyon [annual false brome]
emb|CDM84169.1|  unnamed protein product                                103   4e-22   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001275394.1|  nuclear RNA binding protein                        102   5e-22   Solanum tuberosum [potatoes]
ref|XP_002991714.1|  hypothetical protein SELMODRAFT_448524             103   6e-22   Selaginella moellendorffii
ref|XP_003568032.1|  PREDICTED: probable H/ACA ribonucleoprotein ...    102   7e-22   Brachypodium distachyon [annual false brome]
dbj|BAJ96699.1|  predicted protein                                      102   1e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABI18976.1|  nuclear-localized RNA binding protein                   101   1e-21   Capsicum annuum
ref|XP_004229741.1|  PREDICTED: plasminogen activator inhibitor 1...    101   1e-21   
gb|AAF14245.1|AF110229_1  nuclear RNA binding protein B                 100   1e-21   Spinacia oleracea
ref|XP_009130695.1|  PREDICTED: intracellular hyaluronan-binding ...    101   2e-21   Brassica rapa
emb|CDY43474.1|  BnaC08g10790D                                        97.8    5e-20   Brassica napus [oilseed rape]
ref|XP_008459800.1|  PREDICTED: plasminogen activator inhibitor 1...  97.1    5e-20   Cucumis melo [Oriental melon]
ref|XP_006655517.1|  PREDICTED: plasminogen activator inhibitor 1...  97.1    7e-20   
ref|XP_009136852.1|  PREDICTED: plasminogen activator inhibitor 1...  96.3    9e-20   Brassica rapa
emb|CDX90469.1|  BnaA03g43120D                                        96.3    1e-19   
ref|XP_010053520.1|  PREDICTED: H/ACA ribonucleoprotein complex s...  95.9    2e-19   Eucalyptus grandis [rose gum]
gb|ABY60453.1|  putative nuclear RNA binding protein                  92.4    2e-19   Adonis aestivalis var. palaestina
ref|XP_006414295.1|  hypothetical protein EUTSA_v10025552mg           94.7    2e-19   
ref|XP_009406178.1|  PREDICTED: plasminogen activator inhibitor 1...  95.1    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001760974.1|  predicted protein                                94.4    4e-19   
ref|XP_008650627.1|  PREDICTED: DNA ligase 1-like                     92.8    5e-19   
gb|KHN00198.1|  hypothetical protein glysoja_034729                   90.5    6e-19   Glycine soja [wild soybean]
gb|ABR26138.1|  salt tolerance protein 2                              91.3    8e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_002458418.1|  hypothetical protein SORBIDRAFT_03g033140        93.2    1e-18   Sorghum bicolor [broomcorn]
ref|XP_006284013.1|  hypothetical protein CARUB_v10005134mg           92.0    2e-18   
gb|KHN11561.1|  hypothetical protein glysoja_006014                   88.2    1e-17   Glycine soja [wild soybean]
tpg|DAA57853.1|  TPA: hypothetical protein ZEAMMB73_322547            89.4    2e-17   
gb|EPS59059.1|  hypothetical protein M569_15751                       90.1    2e-17   Genlisea aurea
ref|XP_008793172.1|  PREDICTED: uncharacterized protein DDB_G0288...  89.4    4e-17   Phoenix dactylifera
tpg|DAA57846.1|  TPA: hypothetical protein ZEAMMB73_955694            88.2    4e-17   
ref|XP_001785274.1|  predicted protein                                88.6    7e-17   
ref|XP_001767830.1|  predicted protein                                88.6    7e-17   
ref|NP_199532.1|  Hyaluronan / mRNA binding family protein            87.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAF14246.1|AF110230_1  nuclear RNA binding protein C               85.5    2e-16   Spinacia oleracea
gb|AAM63072.1|  nuclear RNA binding protein A-like protein            86.3    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440090.1|  PREDICTED: uncharacterized protein LOC104723416  82.8    4e-16   
gb|ADE76006.1|  unknown                                               82.4    6e-16   Picea sitchensis
ref|XP_009388577.1|  PREDICTED: plasminogen activator inhibitor 1...  85.1    1e-15   
dbj|BAJ98247.1|  predicted protein                                    81.3    3e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU21341.1|  unknown                                               81.6    4e-15   Glycine max [soybeans]
gb|AAS75737.1|  thermoinhibition-associated THB-4 protein             79.0    5e-15   Tagetes minuta
gb|AGV54489.1|  plasminogen activator inhibitor 1 RNA-binding pro...  83.6    5e-15   Phaseolus vulgaris [French bean]
gb|EMT12851.1|  hypothetical protein F775_28068                       82.0    5e-15   
ref|XP_008811725.1|  PREDICTED: uncharacterized protein LOC103722810  77.8    3e-14   Phoenix dactylifera
ref|WP_035019856.1|  hypothetical protein                             73.2    3e-13   
ref|XP_010231993.1|  PREDICTED: uncharacterized protein LOC100831026  72.0    2e-12   
gb|EMS56112.1|  hypothetical protein TRIUR3_18406                     72.0    7e-12   
ref|NP_001078724.1|  Hyaluronan / mRNA binding family protein         73.2    8e-12   
ref|XP_001756282.1|  predicted protein                                73.6    1e-11   
ref|XP_010246647.1|  PREDICTED: aspartate, glycine, lysine and se...  69.3    4e-10   
ref|XP_010926667.1|  PREDICTED: protein argonaute 3-like              67.8    1e-09   
ref|XP_009383830.1|  PREDICTED: keratin, type I cytoskeletal 9-like   67.8    1e-09   
ref|XP_008792951.1|  PREDICTED: circumsporozoite protein-like         66.6    3e-09   
ref|XP_002988573.1|  hypothetical protein SELMODRAFT_447366           65.9    4e-09   
ref|XP_006848446.1|  hypothetical protein AMTR_s00013p00244720        65.1    8e-09   
gb|KHN46561.1|  hypothetical protein glysoja_032653                   65.1    9e-09   
ref|XP_002979268.1|  hypothetical protein SELMODRAFT_444118           63.2    4e-08   
gb|KHN13635.1|  UDP-glucose 4-epimerase GEPI48                        60.1    3e-07   
ref|XP_002534519.1|  RNA binding protein, putative                    58.2    1e-06   
gb|KHN41588.1|  hypothetical protein glysoja_038326                   55.8    2e-06   
ref|NP_001173713.1|  Os03g0845300                                     57.8    2e-06   
gb|AAS07374.1|  hypothetical protein                                  58.2    2e-06   
gb|EAY92561.1|  hypothetical protein OsI_14301                        58.2    3e-06   
emb|CAN80478.1|  hypothetical protein VITISV_018750                   57.8    3e-06   
ref|XP_003635425.2|  PREDICTED: interleukin enhancer-binding fact...  57.8    3e-06   
ref|XP_001760895.1|  predicted protein                                57.0    5e-06   
ref|XP_010646835.1|  PREDICTED: uncharacterized protein LOC100262339  56.6    6e-06   
ref|XP_010685112.1|  PREDICTED: epsin-like                            53.1    9e-05   
ref|XP_002539777.1|  conserved hypothetical protein                   48.9    3e-04   
ref|XP_011008634.1|  PREDICTED: spore wall protein 2-like             51.6    3e-04   
dbj|BAH56853.1|  AT5G47210                                            48.1    5e-04   
dbj|BAD87405.1|  nuclear RNA binding protein A-like                   47.8    7e-04   
ref|XP_002307871.1|  hypothetical protein POPTR_0006s01090g           50.4    8e-04   
emb|CBI18782.3|  unnamed protein product                              50.1    0.001   



>emb|CDP08361.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 150/203 (74%), Gaps = 10/203 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKREG+GRGNWG+PTDEIAPE EEP    VN+G      EKQ GQE  GD  KDS
Sbjct  185  GRGNEIKREGAGRGNWGTPTDEIAPETEEP----VNEGEKNADAEKQSGQETVGDGNKDS  240

Query  587  PL--depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN  414
             +   E + KEPE+KEMTL+EY+KLLEEKRK++LAS+PEERKV LDKEFESM LL+NKKN
Sbjct  241  HVDEPEEKEKEPEEKEMTLEEYQKLLEEKRKSLLASKPEERKVNLDKEFESMQLLSNKKN  300

Query  413  DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            DD+VF+KLGS  +DK+++AGEK KK  SINEFLKPAEGE        G          G 
Sbjct  301  DDDVFIKLGS-DKDKRRDAGEKAKKAVSINEFLKPAEGEN---YYRPGGRGRGRGRGRGG  356

Query  233  gGNNTSSFETPSIEDVGQFPTLG  165
             GNN+ + E PSI DVGQFP+LG
Sbjct  357  YGNNSYNVEAPSIADVGQFPSLG  379



>gb|AAF14242.1|AF110226_1 nuclear RNA binding protein [Nicotiana tabacum]
Length=299

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 157/204 (77%), Gaps = 6/204 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+P D+IA E E P    VNDG      EK+ GQE+A D  KD
Sbjct  101  GRGNEYIKREGSGRGNWGTPADDIAQETEVP----VNDGEKIVEAEKEAGQEEAEDTNKD  156

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKND
Sbjct  157  STAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKND  216

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS +++K+KEA EK +KT+SINEFLKPAEGE Y R GGRGRG G G G  G G
Sbjct  217  DEIFIKLGS-EKEKRKEAVEKARKTQSINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGG  275

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                 SF  PSIEDVGQFP+L +K
Sbjct  276  VGGNKSFSAPSIEDVGQFPSLVAK  299



>ref|XP_009613635.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana tomentosiformis]
Length=373

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 157/204 (77%), Gaps = 6/204 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+P D+IA E E P    VNDG      EK+ GQE+A D  KD
Sbjct  175  GRGNEYIKREGSGRGNWGTPADDIAQETEVP----VNDGEKIVEAEKEAGQEEAEDTNKD  230

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKND
Sbjct  231  STAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKND  290

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS +++K+KEA EK +KT+SINEFLKPAEGE Y R GGRGRG G G G  G G
Sbjct  291  DEIFIKLGS-EKEKRKEAVEKARKTQSINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGG  349

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                 SF  PSIEDVGQFP+L +K
Sbjct  350  VGGNKSFSAPSIEDVGQFPSLVAK  373



>ref|XP_011081281.1| PREDICTED: RNA-binding protein FUS isoform X1 [Sesamum indicum]
Length=365

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 147/203 (72%), Gaps = 8/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+PTDEI PE EEP     N+GV     EKQ G++D  DA KDS
Sbjct  171  GRGTEFKREGAGRGNWGTPTDEIVPETEEP----TNEGVKNVDSEKQSGEDDVIDANKDS  226

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK+LEEKRKA+LA + EERKV LDKE ESM LL+NKKNDD
Sbjct  227  SANEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKSEERKVGLDKELESMQLLSNKKNDD  286

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            EVF+KLGS  +DK+KEA EK KK+ SINEFLKPAEG+   +    G          G  G
Sbjct  287  EVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPAEGD---KYYRAGGRGRGRGRGRGGFG  342

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
             N  + E P+IEDVGQFP+L +K
Sbjct  343  GNNYNVEAPAIEDVGQFPSLVAK  365



>ref|XP_009789577.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=374

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 151/205 (74%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+P D+IA E E P    VNDG      EK+ GQEDA D  KD
Sbjct  175  GRGNEYIKREGSGRGNWGTPADDIAQETEVP----VNDGEKIVEAEKEAGQEDAEDTNKD  230

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LDKE E+M LL+NKKND
Sbjct  231  STAAEPEEKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLDKELETMQLLSNKKND  290

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS +++K+KEA EK +KTKSINEFLKPA+GE+ Y   G           G  G
Sbjct  291  DEIFIKLGS-EKEKRKEAVEKARKTKSINEFLKPADGESSYYRRGGRGRGQGRGRGGFGG  349

Query  230  GNNTS-SFETPSIEDVGQFPTLGSK  159
            G   + +F  PSIEDVGQFP+L +K
Sbjct  350  GVGGNKNFSAPSIEDVGQFPSLVAK  374



>ref|XP_009607512.1| PREDICTED: intracellular hyaluronan-binding protein 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=359

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 156/203 (77%), Gaps = 8/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+P DE APE EEP+N    +G      EK   Q DA DA KDS
Sbjct  165  GRGNEFKREGAGRGNWGTPADEFAPEKEEPLN----EGEKIVDTEKPAVQADAEDASKDS  220

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  EP+ KEPE+KEMTL+EYEKLLE+KRKA+LA +PEERKV LDKE ESM LL+NKK+DD
Sbjct  221  PAAEPQEKEPEEKEMTLEEYEKLLEDKRKALLALKPEERKVNLDKELESMQLLSNKKSDD  280

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            EVF+KLGS ++DK+KEA EK KKTKSINEFLKPA+G +YYR GGRGRG       G  G 
Sbjct  281  EVFIKLGS-EKDKRKEAVEKAKKTKSINEFLKPADGGSYYRRGGRGRGGRDHGRDGVVGN  339

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
            N+ S+   PSIEDV QFP+LG+K
Sbjct  340  NSVSA---PSIEDVRQFPSLGAK  359



>ref|XP_006362472.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum tuberosum]
Length=366

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 148/204 (73%), Gaps = 7/204 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+  D+IAP  EE     VNDG      EKQ GQEDAGD  KD
Sbjct  169  GRGNEFIKREGSGRGNWGTTADDIAPVTEE----SVNDGEKIVDAEKQSGQEDAGDTNKD  224

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LD E +SM LL+NKKND
Sbjct  225  SSAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDNELQSMQLLSNKKND  284

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLG+ ++DKKKEA EK KKTKSINEFLKPAEGE+ Y   G            G G
Sbjct  285  DEIFIKLGA-EKDKKKEAVEKNKKTKSINEFLKPAEGES-YYRPGGRGRGRGRGRGNGGG  342

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                +S  +PSIEDVGQFP+L +K
Sbjct  343  YGGINSVSSPSIEDVGQFPSLAAK  366



>ref|XP_004253373.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like, 
partial [Solanum lycopersicum]
Length=327

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 145/206 (70%), Gaps = 7/206 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+  D+IA E E P    V DG      EKQ GQEDAGD  KD
Sbjct  122  GRGNEYIKREGSGRGNWGTTADDIALETEVP----VVDGEKIVEAEKQTGQEDAGDDNKD  177

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   E E KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LDKE +SM LL+NKKND
Sbjct  178  STAAELEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKND  237

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLG+ ++DKKKEA EK KK +SINEFLKPAEGE+ Y   G            G G
Sbjct  238  DEIFIKLGA-EKDKKKEAVEKAKKAQSINEFLKPAEGES-YYRPGGRGRGRGRGRGNGGG  295

Query  230  GNNTSSFETPSIEDVGQFPTLGSK*G  153
                SS   PSIEDVGQFP+L  K G
Sbjct  296  YGGISSVSAPSIEDVGQFPSLAVKKG  321



>ref|XP_011081284.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=358

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 144/203 (71%), Gaps = 8/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+ TDEI  + EEP +    +GV     EK+ GQ+D GDA KD+
Sbjct  164  GRGTEYKREGAGRGNWGTHTDEIVQDTEEPDS----EGVKNVESEKRSGQDDVGDANKDT  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
               E E KEPE+KEMTL+EYEK+LEEKRKA+LA +  ERKV LDKE ESM LL+NKKNDD
Sbjct  220  SAKEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKSRERKVDLDKELESMQLLSNKKNDD  279

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            +VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE   +  G  R         G  G
Sbjct  280  DVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPAEGE---KYYGAVRRGRGHGRGRGGYG  335

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
             N    + P+IEDVGQFP+L +K
Sbjct  336  GNNYDLQAPAIEDVGQFPSLVAK  358



>ref|NP_001275449.1| plasminogen activator inhibitor 1 RNA-binding protein-like [Solanum 
tuberosum]
 gb|ABA81884.1| nuclear RNA binding protein-like [Solanum tuberosum]
Length=363

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 147/204 (72%), Gaps = 7/204 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      EKQ GQEDAGD  K+
Sbjct  166  GRGNEFIKREGSGRGNWGTTADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDTNKE  221

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KE+TL+EYEK++EEKRKA++A + EERKV LDKE +SM LL+NKKND
Sbjct  222  STAAEPEEKEPEEKEITLEEYEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKND  281

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLG+ ++DKKKEA EK KKTKSINEFLKPAEGE+ Y   G            G G
Sbjct  282  DEIFIKLGA-EKDKKKEAVEKTKKTKSINEFLKPAEGES-YYRPGGRGRGRGRGRGNGGG  339

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                +S   PSIEDVGQFP+L  K
Sbjct  340  YGGINSVSAPSIEDVGQFPSLAVK  363



>ref|XP_006362474.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Solanum tuberosum]
Length=364

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 147/204 (72%), Gaps = 7/204 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      EKQ GQEDAGD  KD
Sbjct  167  GRGNEYIKREGSGRGNWGTTADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDNNKD  222

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LDKE +SM LL+NKKND
Sbjct  223  STAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKND  282

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLG+ ++DKKKEA EK KKT++INEFLKPAEGE  Y   G            G G
Sbjct  283  DEIFIKLGA-EKDKKKEAVEKAKKTQNINEFLKPAEGEN-YYRSGGRGRGRGRGRGNGGG  340

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                +S   PSIEDVGQFP+L +K
Sbjct  341  YVGNNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_006362473.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Solanum tuberosum]
Length=364

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 147/204 (72%), Gaps = 7/204 (3%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      EKQ GQEDAGD  KD
Sbjct  167  GRGNEYIKREGSGRGNWGTTADDIAPETEVP----VIDGEKIVEAEKQAGQEDAGDNNKD  222

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LDKE +SM LL+NKKND
Sbjct  223  STAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKND  282

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLG+ ++DKKKEA EK KKT++INEFLKPAEGE  Y   G            G G
Sbjct  283  DEIFIKLGA-EKDKKKEAVEKAKKTQNINEFLKPAEGEN-YYRSGGRGRGRGRGRGNGGG  340

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                +S   PSIEDVGQFP+L +K
Sbjct  341  YVGNNSVSAPSIEDVGQFPSLAAK  364



>ref|XP_010677113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Beta vulgaris subsp. vulgaris]
 emb|CAC85228.1| salt tolerance protein 2 [Beta vulgaris]
Length=356

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 148/204 (73%), Gaps = 9/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG EIKREGSGRGNWGSPTDEIAPE EEP+  V N+     A +K  G+ +  DA+K+S
Sbjct  159  GRGGEIKREGSGRGNWGSPTDEIAPETEEPV--VENEAAV--AADKPAGEGENVDAEKES  214

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
               E    EPE+KEMTL+EYEK+LEEKRKA+L+ + EERKV LDKEFESM L++ KKNDD
Sbjct  215  QEKEVVEAEPEEKEMTLEEYEKVLEEKRKALLSLKGEERKVDLDKEFESMQLVSKKKNDD  274

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+ A  + +  K  SINEFLKPAEG+ Y+R G      G G   GGY
Sbjct  275  EVFIKLGSDKDKRKEAAEREERSKKSVSINEFLKPAEGDGYHRRGRGRGRGGRGGYGGGY  334

Query  233  gGNNTSSFETPSIEDVGQFPTLGS  162
            G NN S+   PSIED  QFP+LG+
Sbjct  335  GMNNASA---PSIEDPNQFPSLGA  355



>ref|XP_002303373.2| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|EEE78352.2| nuclear RNA-binding family protein [Populus trichocarpa]
Length=361

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 147/208 (71%), Gaps = 10/208 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKREGSGRGNWG+PTDEIAPE E+P   VV++  N    EKQ G+EDA DA KD+
Sbjct  159  GRGNEIKREGSGRGNWGTPTDEIAPETEDP---VVDNEKNV-ITEKQQGEEDAADANKDT  214

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              ++PE KEPE+KEMTL+EYEK+LEEKRKA+L  + EERKV LDK+ + M  L++KK++D
Sbjct  215  -AEKPEEKEPEEKEMTLEEYEKVLEEKRKALLDLKTEERKVGLDKDLQCMQQLSSKKSND  273

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGE---Tyyrpggrgrgrghgsgr  243
            E+F+KLGSEK+ +K  A +  + KK  SINEFLKPAEGE      R G        G G 
Sbjct  274  EIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAEGERSYNSGRGGRGRGRGRGGYGS  333

Query  242  ggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G+N      PSIED GQFP+LG K
Sbjct  334  GSGYGSNARDVAAPSIEDPGQFPSLGGK  361



>ref|XP_009594553.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=365

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 157/203 (77%), Gaps = 5/203 (2%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG++ KREG+GRGNWG+PTDEIAPE EEP      +G      EK  G+EDAGDAKKDS
Sbjct  168  GRGNDFKREGAGRGNWGTPTDEIAPETEEP----AAEGEKIVDSEKPAGEEDAGDAKKDS  223

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             + EPE KEPE+KEMTL+EYEKLLEEKRKA+LA +PEERKV LDKEFESM LL+NKKN+D
Sbjct  224  SVAEPEEKEPEEKEMTLEEYEKLLEEKRKALLAQKPEERKVNLDKEFESMQLLSNKKNED  283

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            +VF+KLG+ ++DK+KEA EK KKTKSINEFLKPAEG  YYR  GRG     G G     G
Sbjct  284  DVFIKLGA-EKDKRKEAVEKAKKTKSINEFLKPAEGGNYYRGRGRGGRGRGGRGGYEGNG  342

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
             N  S E P IEDVGQFP+LG+K
Sbjct  343  GNNYSVEAPKIEDVGQFPSLGAK  365



>ref|XP_009772173.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 158/203 (78%), Gaps = 8/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+P DE+APE EEP    VN+G      EKQ  Q DA DA KDS
Sbjct  162  GRGNEFKREGAGRGNWGTPADELAPEKEEP----VNEGEKIVVTEKQAVQADAEDASKDS  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  EP+ KEPE+KEMTL+EYEKLLEEKRKA+LA +PEERKV LDKE ESM LL+NKK+DD
Sbjct  218  PAAEPQEKEPEEKEMTLEEYEKLLEEKRKALLALKPEERKVNLDKELESMQLLSNKKSDD  277

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            EVF+KLGS ++DK+KEA EK KKTKSINEFLKPA+GE+YY  GGRGRG       G  G 
Sbjct  278  EVFIKLGS-EKDKRKEAVEKAKKTKSINEFLKPADGESYYGRGGRGRGGRDRGRDGFVGN  336

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
            N+ S+   PSIEDV QFP+LG+K
Sbjct  337  NSVSA---PSIEDVRQFPSLGAK  356



>ref|XP_011031954.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=362

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 144/208 (69%), Gaps = 9/208 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKREGSGRGNWG+PTDEI PE E+P   VV++  N    EKQ G+E+A DA KD+
Sbjct  159  GRGNEIKREGSGRGNWGTPTDEIVPETEDP---VVDNEKNV-ITEKQQGEENAADANKDT  214

Query  587  PLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN  414
               EPE KE E +E  MTL+EYEK+LEEKRKA+LA + EERKV LDK+ + M  L++KK+
Sbjct  215  AEKEPEEKEKEPEEKEMTLEEYEKVLEEKRKALLALKTEERKVGLDKDLQCMQQLSSKKS  274

Query  413  DDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGE-Tyyrpggrgrgrghgsgr  243
            +DE+F+KLGSEK+ +K  A +  + KK  SINEFLKPAEGE +Y    G         G 
Sbjct  275  NDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAEGERSYNPGRGGRGRGRGRGGY  334

Query  242  ggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G+N      PSIED GQFP+LG K
Sbjct  335  GSGYGSNARDVAAPSIEDPGQFPSLGGK  362



>ref|XP_009766508.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=369

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 155/206 (75%), Gaps = 8/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG++ KREG+GR NWG+PTDEIAPE EEP    V +G      EK  G+EDAGDAKKDS
Sbjct  169  GRGNDFKREGAGRANWGTPTDEIAPETEEP----VTEGEKIVDPEKPAGEEDAGDAKKDS  224

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
                PE KEPE+KEMTL+EYEKLLEEKRKA+LA +PEERKV LDKEFESM LL+NKKN+D
Sbjct  225  SAAAPEEKEPEEKEMTLEEYEKLLEEKRKALLAQKPEERKVNLDKEFESMQLLSNKKNED  284

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE---Tyyrpggrgrgrghgsgrgg  237
            +VF+KLG+ ++DK+KEA EK KKTKSINEFLKPAEGE        GGRG     G G  G
Sbjct  285  DVFIKLGA-EKDKRKEAVEKAKKTKSINEFLKPAEGENYYRGRGRGGRGGRGRGGYGGNG  343

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
              G N  S E P IEDVGQFP+LG+K
Sbjct  344  GNGGNNYSVEAPKIEDVGQFPSLGAK  369



>gb|KDP39931.1| hypothetical protein JCGZ_03462 [Jatropha curcas]
Length=366

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 142/205 (69%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+PTDEIA E EEP+  +  + V     EK  G+EDA DA K+S
Sbjct  169  GRGNEIKRDGAGRGNWGTPTDEIAQETEEPVTEIEKNVV----AEKPSGEEDAADANKES  224

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P DEPE K  + + MTL+EYEK+LEEKRKA+L+S+ EERKV ++KEF SM  L+NKK +D
Sbjct  225  PADEPEEKVEDKE-MTLEEYEKILEEKRKALLSSKTEERKVDVEKEFGSMLQLSNKKGND  283

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSEK+ +K  A +  + KK+ SI EFLKPA+GE      G          RGGY
Sbjct  284  DIFIKLGSEKDKRKDAADKEDRAKKSVSITEFLKPADGE--KYYSGGRGRGRGRGSRGGY  341

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G N      PSIED GQFP+LG K
Sbjct  342  VGGNARDVAAPSIEDRGQFPSLGGK  366



>ref|XP_010275458.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=359

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 143/206 (69%), Gaps = 11/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+PTDEI  E EE     +         EK  G+++ GD  K++
Sbjct  162  GRGNEMKREGSGRGNWGTPTDEIVQETEEVEKTTIT--------EKTGGEDETGDTNKEN  213

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P++EPE KEPEDKEMTLDEYEK+LEEKRKA+ A + EERKV LDK+FESM  LA+KK +D
Sbjct  214  PVNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTEERKVNLDKDFESMQQLASKKGND  273

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAE-GETyyrpggrgrgrghgsgrgg  237
            +VF+KLGSEK+ +K+     E+ KK+ SINEFLKPAE G  Y   G      G GS  G 
Sbjct  274  DVFIKLGSEKDKRKEAIDKEERTKKSVSINEFLKPAEGGRYYSPGGRGRGRGGRGSRGGF  333

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             G N  S+   PSIED GQFPTLG K
Sbjct  334  SGVNQASNVVAPSIEDPGQFPTLGGK  359



>ref|XP_002266051.1| PREDICTED: uncharacterized protein DDB_G0288133 [Vitis vinifera]
 emb|CBI29539.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+P DEIAPE EEPIN       NT A EKQ G+E A DA K++
Sbjct  167  GRGNEIKRDGAGRGNWGTPADEIAPENEEPINETEK---NTSA-EKQLGEEIAADANKEN  222

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P++E E KEPEDKEMTL+EY+K+LEEKRKA+LA + EERKV + K+FE+M  L++KK++D
Sbjct  223  PVNESEEKEPEDKEMTLEEYQKVLEEKRKALLALKTEERKVDV-KDFEAMQQLSSKKDND  281

Query  407  EVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            +VF+KLGSEK+ +K   +  E+ KK+ SINEFLKPA      R  G          RGG+
Sbjct  282  DVFIKLGSEKDKRKELADKEERAKKSVSINEFLKPA---EGERYYGGRGRGRGRGTRGGF  338

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             GN  S+   PSIED GQFPTLG K
Sbjct  339  AGNTYSNVAAPSIEDPGQFPTLGGK  363



>emb|CAN75176.1| hypothetical protein VITISV_016687 [Vitis vinifera]
Length=363

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 148/205 (72%), Gaps = 10/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+P DEIAPE EEPIN       NT A EKQ G+E A DA K++
Sbjct  167  GRGNEIKRDGAGRGNWGTPADEIAPENEEPINETEK---NTSA-EKQLGEEIAADANKEN  222

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P++E E KEPEDKEMTL+EY+K+LEEKRKA+LA + EERKV + K+FE+M  L++KK++D
Sbjct  223  PVNESEEKEPEDKEMTLEEYQKVLEEKRKALLALKTEERKVDV-KDFEAMQQLSSKKDND  281

Query  407  EVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            +VF+KLGSEK+ +K   +  E+ KK+ SINEFLKPA      R  G          RGG+
Sbjct  282  DVFIKLGSEKDKRKELADKEERAKKSVSINEFLKPA---EGERYYGGRGRGCGRGTRGGF  338

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             GN  S+   PSIED GQFPTLG K
Sbjct  339  AGNTYSNVAAPSIEDPGQFPTLGGK  363



>ref|XP_010661405.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Vitis vinifera]
 emb|CBI16673.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 155/205 (76%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE++   EE    VVN+G      EK  G+ED  D  K++
Sbjct  161  GRGNELKREGSGRGNWGTETDELSGVTEE----VVNEGEKNLGAEKPVGEEDVADGNKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P++EPE KEPE+KEMTL+EYEK+LEE+RKA+   + EERKV +DKEF+SM  L++KK +D
Sbjct  217  PVNEPEEKEPEEKEMTLEEYEKVLEERRKALQTLKTEERKVDVDKEFKSMQQLSSKKGND  276

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGS+K+ +K+ A +  + KK  SINEFLKPAEGE +Y PGGRGRGRG GS  G  
Sbjct  277  DIFIKLGSDKDKRKEAAEKEERAKKAVSINEFLKPAEGERFYSPGGRGRGRGRGSRGGYG  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN  S+   PSIED GQFPTLG+K
Sbjct  337  GGNAMSNVAAPSIEDPGQFPTLGAK  361



>ref|XP_004244706.2| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=340

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 128/159 (81%), Gaps = 6/159 (4%)
 Frame = -1

Query  767  GRGSE-IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E IKREGSGRGNWG+  D+IAPE E P    V DG      EKQ GQEDAGD  KD
Sbjct  167  GRGNEYIKREGSGRGNWGTTADDIAPETEVP----VVDGEKIVEAEKQTGQEDAGDNNKD  222

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            S   EPE KEPE+KEMTL+EYEK++EEKRKA++A + EERKV LDKE +SM LL+NKKND
Sbjct  223  STAAEPEEKEPEEKEMTLEEYEKVMEEKRKALVALKQEERKVNLDKELQSMQLLSNKKND  282

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  294
            DE+F+KLG+ ++DKKKEA EK KKT++INEFLKPAEGE+
Sbjct  283  DEIFIKLGA-EKDKKKEAVEKAKKTQTINEFLKPAEGES  320



>gb|KDO57096.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=364

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 159/206 (77%), Gaps = 9/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++
Sbjct  165  GRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKND  411
            P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++
Sbjct  220  PVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSN  279

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G 
Sbjct  280  DDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGY  339

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             G  + ++   P IED GQFP+LG K
Sbjct  340  GGSTSGNAA-APKIEDPGQFPSLGGK  364



>ref|XP_006477112.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Citrus sinensis]
Length=364

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 159/206 (77%), Gaps = 9/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++
Sbjct  165  GRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKND  411
            P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++
Sbjct  220  PVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSN  279

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G 
Sbjct  280  DDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGY  339

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             G  + ++   P IED GQFP+LG K
Sbjct  340  GGSTSGNAA-APKIEDPGQFPSLGGK  364



>gb|KJB37651.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=306

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 143/204 (70%), Gaps = 8/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGSPTD IAPE EE     V +     + EKQ G+EDA DA K++
Sbjct  110  GRGNEFKRDGSGRGNWGSPTDGIAPETEEN----VPENEKNVSIEKQSGEEDAMDAGKEN  165

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D
Sbjct  166  AANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSND  224

Query  407  EVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE     G           RGGYG
Sbjct  225  DIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYG  282

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  SS   PSIED G FP+LG K
Sbjct  283  GNTASSVLAPSIEDPGHFPSLGGK  306



>ref|XP_006440205.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53445.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=364

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 160/206 (78%), Gaps = 9/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++
Sbjct  165  GRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKND  411
            P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++
Sbjct  220  PVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSN  279

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G 
Sbjct  280  DDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGY  339

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             G  ++S+   P IED GQFP+LG K
Sbjct  340  GGSTSSSAA-APKIEDPGQFPSLGGK  364



>gb|KJB37646.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=357

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 143/204 (70%), Gaps = 8/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGSPTD IAPE EE     V +     + EKQ G+EDA DA K++
Sbjct  161  GRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D
Sbjct  217  AANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSND  275

Query  407  EVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE     G           RGGYG
Sbjct  276  DIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYG  333

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  SS   PSIED G FP+LG K
Sbjct  334  GNTASSVLAPSIEDPGHFPSLGGK  357



>ref|XP_010258760.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Nelumbo nucifera]
Length=358

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 153/207 (74%), Gaps = 11/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEE-PINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+EIKREG+GRGNWG   DE+  E EE  I         T   EK  G+E+AGDA K+
Sbjct  159  GRGNEIKREGAGRGNWGRQADELVQETEELSIE-------KTAITEKPVGEEEAGDANKE  211

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P +EPE KEPEDKEMTLDEYEK+LEEKRKA+ A + EERKV LDK+FESM  LANKK +
Sbjct  212  NPTNEPEEKEPEDKEMTLDEYEKVLEEKRKALQALKTEERKVNLDKDFESMQQLANKKGN  271

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+KLGS+K+ +K   +  E+ KK+ SINEFLKP+EGE YY PGGRGRGRG    +GG
Sbjct  272  DDVFIKLGSDKDKRKDNTDKEERAKKSVSINEFLKPSEGEKYYNPGGRGRGRGGRGSKGG  331

Query  236  ygGNNTSSFET-PSIEDVGQFPTLGSK  159
            +GG N +S E  PSI D GQFPTLG K
Sbjct  332  FGGGNMTSNEVAPSIGDPGQFPTLGGK  358



>gb|AEI59279.1| RNA binding protein [Suaeda glauca]
Length=359

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 154/204 (75%), Gaps = 9/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG EIKR+G+GRGNWG+PTDEIAPE+ EP+  V N+ V  D  EK  G E+    +K++
Sbjct  162  GRGGEIKRDGAGRGNWGTPTDEIAPESGEPV--VENEAVAAD--EKPSGDENVV-VEKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E E  EPE+K+MTL+EY+K+LEEKRKA+LA + EERKV LDK+FESM L++ KKNDD
Sbjct  217  PEKEAEETEPEEKQMTLEEYQKVLEEKRKALLALKAEERKVDLDKDFESMQLVSKKKNDD  276

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+ A +  + KK+ SINEFL+PAEG+ +YR GGRGR RG   G GG 
Sbjct  277  EVFIKLGSDKDKRKEAAEKDERAKKSVSINEFLRPAEGDGHYRRGGRGRSRGGRGGYGGG  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGS  162
             G N +S   PSIED  QFP+LG+
Sbjct  337  YGMNNAS--APSIEDPSQFPSLGA  358



>ref|XP_007052327.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052328.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 ref|XP_007052329.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96484.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96485.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
 gb|EOX96486.1| Hyaluronan / mRNA binding family isoform 1 [Theobroma cacao]
Length=375

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 142/205 (69%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE+A   EE    VVN+       EK  G+EDAGDA K+S
Sbjct  177  GRGNELKREGSGRGNWGTQTDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKES  232

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++D
Sbjct  233  PTNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSND  291

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGSEK+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  292  EVFIKLGSEKDKRKEAFDKEERAKKSVSINEFLKPAEGE-RYYNPSGRGRGRGRGSRGFG  350

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GG+   +   PSIED GQFPTLG K
Sbjct  351  GGSAAGNVSAPSIEDPGQFPTLGGK  375



>ref|XP_002531778.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
 gb|EEF30592.1| Plasminogen activator inhibitor 1 RNA-binding protein, putative 
[Ricinus communis]
Length=364

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 147/206 (71%), Gaps = 11/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEP-INGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E KREG+GRGNWG+P DEIAPE EEP I    N G+     EK  G+E A DA KD
Sbjct  167  GRGNEFKREGAGRGNWGTPADEIAPEIEEPLIENEKNIGI-----EKPSGEEGAADANKD  221

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P++E E KEPEDKEMTL+EYEKL EE++K++  S+ EERKV ++KEF +M  L+NKK  
Sbjct  222  NPMNELEEKEPEDKEMTLEEYEKLREERKKSLSLSKAEERKVDVEKEFGTMLQLSNKKGS  281

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            DE+F+KLGSEK+ +K  A +  + KK  SINEFLKPAEGE Y+   GRGRGRG   G G 
Sbjct  282  DEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAEGERYFGGRGRGRGRGSRGGYGL  341

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
                + ++   PSIED GQFPTLG K
Sbjct  342  GSARDVAA---PSIEDRGQFPTLGGK  364



>gb|EYU19470.1| hypothetical protein MIMGU_mgv1a008507mg [Erythranthe guttata]
Length=371

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 150/204 (74%), Gaps = 8/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGV-VNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E KREG+GRGNWG+ T++IAPE EEP + V + D       EK  G+EDA DA KD
Sbjct  175  GRGNEFKREGAGRGNWGTHTEDIAPETEEPASEVKIVDP------EKPSGEEDAVDANKD  228

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            SP ++ E +  E+KEMTL+EYEK+ EEKRKA+L+ + EERKV LDKE E+M LL+ KKND
Sbjct  229  SPKEQEEKEPEEEKEMTLEEYEKVREEKRKALLSLKSEERKVNLDKELEAMQLLSTKKND  288

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DEVF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE YYR GGRG     G GR G  
Sbjct  289  DEVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPAEGENYYRGGGRGGRGRGGRGREGGF  347

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            G + +    P+I DVGQFP+LG K
Sbjct  348  GRSNAGERAPAIGDVGQFPSLGGK  371



>gb|KJB37647.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 137/204 (67%), Gaps = 9/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGSPTD IAPE EE     V +     + EKQ G+EDA DA K++
Sbjct  161  GRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
                   ++  + +MTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D
Sbjct  217  -AANEAEEKEPENKMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSND  274

Query  407  EVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE     G           RGGYG
Sbjct  275  DIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYG  332

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  SS   PSIED G FP+LG K
Sbjct  333  GNTASSVLAPSIEDPGHFPSLGGK  356



>ref|XP_007052330.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
 gb|EOX96487.1| Hyaluronan / mRNA binding family isoform 4 [Theobroma cacao]
Length=267

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 141/205 (69%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G+ +E+KREGSGRGNWG+ TDE+A   EE    VVN+       EK  G+EDAGDA K+S
Sbjct  69   GKKNELKREGSGRGNWGTQTDELAQVTEE----VVNESEKNLGDEKPAGEEDAGDASKES  124

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEF +M  L+NKK++D
Sbjct  125  PTNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFATMQQLSNKKSND  183

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGSEK+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  184  EVFIKLGSEKDKRKEAFDKEERAKKSVSINEFLKPAEGE-RYYNPSGRGRGRGRGSRGFG  242

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GG+   +   PSIED GQFPTLG K
Sbjct  243  GGSAAGNVSAPSIEDPGQFPTLGGK  267



>gb|KDO57095.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=363

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 158/206 (77%), Gaps = 10/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++
Sbjct  165  GRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKND  411
            P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++
Sbjct  220  PVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSN  279

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+K GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G 
Sbjct  280  DDVFIK-GSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGY  338

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             G  + ++   P IED GQFP+LG K
Sbjct  339  GGSTSGNAA-APKIEDPGQFPSLGGK  363



>gb|KJB37648.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=356

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 142/204 (70%), Gaps = 9/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KR+GSGRGNWGSPTD IAPE EE     V +     + EKQ G+EDA DA K++
Sbjct  161  GRG-QFKRDGSGRGNWGSPTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN  215

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D
Sbjct  216  AANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSND  274

Query  407  EVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE     G           RGGYG
Sbjct  275  DIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYG  332

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  SS   PSIED G FP+LG K
Sbjct  333  GNTASSVLAPSIEDPGHFPSLGGK  356



>ref|XP_007039722.1| Hyaluronan / mRNA binding family [Theobroma cacao]
 gb|EOY24223.1| Hyaluronan / mRNA binding family [Theobroma cacao]
Length=358

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 145/204 (71%), Gaps = 8/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+G+GRGNWG+ TDEIAPE E  +N V  +  N  A EKQ G+ED  DA K++
Sbjct  162  GRGNEFKRDGAGRGNWGTSTDEIAPETE--VN-VPENEKNVGA-EKQSGEEDVVDASKEN  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPE+KEMTL+EYEK+L+EKRKA+LA + EERKV + KEFESM  L+NKK++D
Sbjct  218  AANEPEEKEPENKEMTLEEYEKILDEKRKALLALKTEERKVDV-KEFESMQQLSNKKSND  276

Query  407  EVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE YY PG          G  G  
Sbjct  277  DIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGERYYGPGRGRGRGRGPRGGYGGI  336

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
                S+   P+IED GQFPTLG K
Sbjct  337  AG--SNVPAPAIEDRGQFPTLGGK  358



>gb|KDO57093.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=335

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 130/160 (81%), Gaps = 8/160 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKR+G+GRGNWG+PTDEIA E EEP    V +  NT+A EK  G+E+A DA K++
Sbjct  165  GRGNEIKRDGAGRGNWGTPTDEIAQETEEP----VAETENTNA-EKPSGEENAADANKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKND  411
            P+DE E KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++
Sbjct  220  PVDEQEEKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSN  279

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGE  297
            D+VF+K+GSEK+ +K  A +  K KK+ SINEFLKPAEGE
Sbjct  280  DDVFIKVGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGE  319



>ref|XP_009613636.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=350

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 139/197 (71%), Gaps = 16/197 (8%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG    P               VNDG      EK+ GQE+A D  KDS   EPE
Sbjct  170  RRSGTGRGETEVP---------------VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPE  214

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  390
             KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LDKE ESM LL+NKKNDDE+F+KL
Sbjct  215  EKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLDKELESMQLLSNKKNDDEIFIKL  274

Query  389  GSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF  210
            GS +++K+KEA EK +KT+SINEFLKPAEGE Y R GGRGRG G G G  G G     SF
Sbjct  275  GS-EKEKRKEAVEKARKTQSINEFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSF  333

Query  209  ETPSIEDVGQFPTLGSK  159
              PSIEDVGQFP+L +K
Sbjct  334  SAPSIEDVGQFPSLVAK  350



>ref|XP_011093236.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Sesamum indicum]
Length=376

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 151/206 (73%), Gaps = 8/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED-AGDAKKD  591
            G+G+EIKREG+GRGNWG+ TDE+A EAE  + G    G+N    EK  G+ED A D   +
Sbjct  176  GQGNEIKREGAGRGNWGTQTDELAQEAEG-VGGEAEKGLNA---EKPSGEEDAAADGDNE  231

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +  +E   KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV + KEFES+  L+NKK +
Sbjct  232  AAKNEVGEKEPENKEMTLEEYEKVLEEKRKALQALKTEERKVDV-KEFESLKPLSNKKTN  290

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+KLGSEK+ K+   E  E+ KK  SINEFLKPAEGE YY PGGRGRGRG GS  G 
Sbjct  291  DDVFIKLGSEKDKKRELAEKEERAKKAVSINEFLKPAEGERYYNPGGRGRGRGRGSRGGY  350

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             GGN  S+ + PSIED GQFPTLG K
Sbjct  351  SGGNEMSNVKAPSIEDPGQFPTLGGK  376



>gb|KJB24881.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 138/205 (67%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE+A   EE    V N+G      EK  G+EDA DA K+S
Sbjct  165  GRGNELKREGSGRGNWGTQTDELAQVTEE----VANEGERNLGDEKPAGEEDARDANKES  220

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++D
Sbjct  221  ASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSND  279

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  280  EVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFG  338

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN       PSIED G FP LG K
Sbjct  339  GGNAARDVAAPSIEDPGHFPILGGK  363



>gb|KJB24880.1| hypothetical protein B456_004G166200 [Gossypium raimondii]
Length=363

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 138/205 (67%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE+A   EE    V N+G      EK  G+EDA DA K+S
Sbjct  165  GRGNELKREGSGRGNWGTQTDELAQVTEE----VANEGERNLGDEKPAGEEDARDANKES  220

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++D
Sbjct  221  ASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSND  279

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  280  EVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFG  338

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN       PSIED G FP LG K
Sbjct  339  GGNAARDVAAPSIEDPGHFPILGGK  363



>ref|XP_008373667.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=365

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 150/209 (72%), Gaps = 13/209 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD---AFEKQHGQEDAGDAK  597
            GRGS+IKREGSGRGNWG+P+D+IAPE EEP       G  T+     EKQ G+ +A DA 
Sbjct  164  GRGSDIKREGSGRGNWGTPSDDIAPEIEEP-------GTETEKNFGAEKQSGENEAADAN  216

Query  596  KDSPLdepevkepedkEMTLDE-YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            KDS ++E E KE E+++    E YEK+LEEKRKA+LA + EERKV +DK+ ++M LL+NK
Sbjct  217  KDSTVNETEEKESEEEKEMTLEEYEKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNK  276

Query  419  KNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsg  246
            K +DE+F+KLGSEK+ +K+ A +  + KK+ SIN+FLKPAEGE YY   GRGRGRG   G
Sbjct  277  KENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINQFLKPAEGERYYGGRGRGRGRGPRGG  336

Query  245  rggygGNNTSSFETPSIEDVGQFPTLGSK  159
              G  G  +S+   PSIED GQFP+LG K
Sbjct  337  YSGGPGGYSSNVAAPSIEDPGQFPSLGGK  365



>ref|XP_008369209.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Malus domestica]
Length=359

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 151/205 (74%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KREGSGRGNWG+P+D+IAPE EEP         N  A EKQ G+ +A DA K+ 
Sbjct  159  GRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEK---NVGA-EKQSGENEAADANKED  214

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +D
Sbjct  215  TVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKEND  274

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE Y+   GRGRGRG   G  G 
Sbjct  275  EIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYHGGRGRGRGRGPRGGYSGG  334

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G  +S+   PSI D GQFP+LG K
Sbjct  335  PGGYSSNAAAPSIGDPGQFPSLGGK  359



>gb|KHG27284.1| hypothetical protein F383_11722 [Gossypium arboreum]
Length=354

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 139/204 (68%), Gaps = 9/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGS TDEIAPE E              + EKQ G+EDA DA K++
Sbjct  159  GRGNEFKRDGSGRGNWGSSTDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKEN  213

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D
Sbjct  214  AANETEEKEPENKEMTLEEYEKILEEKRKALAALKTEGRKVDV-KEFESMQQLSNKKSND  272

Query  407  EVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE     G           RGGYG
Sbjct  273  DIFIKLGSEKDKRKDADKEEKVKKSVSINEFLKPAEGER--YYGPGRGRGRSRGPRGGYG  330

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  S+ + PSI D G FP+LG K
Sbjct  331  GNTASNVQAPSIADPGHFPSLGGK  354



>gb|KHG17525.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=361

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 137/205 (67%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE+A   EE    V N G      EK  G+EDA DA K+S
Sbjct  163  GRGNELKREGSGRGNWGTQTDELAQVTEE----VANGGERNLGDEKPAGEEDARDANKES  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++D
Sbjct  219  ASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSND  277

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  278  EVFIKLGSDKDKRKEAYDREERAKKSVSINEFLKPAEGER-YYNPSGRGRGRGRGSRGFG  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN       PSIED G FP LG K
Sbjct  337  GGNAARDVAAPSIEDPGHFPILGGK  361



>ref|XP_007209289.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
 gb|EMJ10488.1| hypothetical protein PRUPE_ppa007665mg [Prunus persica]
Length=360

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G GSE KR+G+GRGNWG+PTD+IA E EEP   +     N  A EKQ G+ +A DA K++
Sbjct  161  GHGSEFKRDGAGRGNWGTPTDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             ++E E KEPE+KEMTL+EYEK+LEEKRKA+LA + EERKV LDKE +SM  L+NKK ++
Sbjct  217  TVNESEEKEPEEKEMTLEEYEKVLEEKRKALLALKTEERKVDLDKELKSMQQLSNKKENN  276

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G 
Sbjct  277  DIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGGRGRGRGRGPRGGYSGG  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G  + S   PSIED GQFPTLG K
Sbjct  337  PGGYSGSA-APSIEDPGQFPTLGGK  360



>gb|KJB25493.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=354

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 137/204 (67%), Gaps = 9/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGS TDEIAPE E              + EKQ G+EDA DA K++
Sbjct  159  GRGNEFKRDGSGRGNWGSSTDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKEN  213

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D
Sbjct  214  AANEAEEKEPENKEMTLEEYEKILEEKRKALDALKTEGRKVDV-KEFESMQQLSNKKSND  272

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  K   SINEFLKPAEGE     G           RGGYG
Sbjct  273  DIFIKLGSEKDKRKDADKEEKAKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYG  330

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  S+ + PSI D G FP+LG K
Sbjct  331  GNTASNVQAPSIADPGHFPSLGGK  354



>ref|XP_003521066.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 136/205 (66%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG+  D+IA   EE    VVN+     A EK  G+EDA +  KDS
Sbjct  171  GRGNEFKREGSGRGNWGTQNDDIAEVTEE----VVNETEKVLADEKPVGEEDAAEGNKDS  226

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV + KEF SM  L+NKK +D
Sbjct  227  PANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEARKVDI-KEFASMQPLSNKKEND  285

Query  407  EVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F+KLGS+K+ +K    ++ K  KS+N  EFLKPAEGE      G          RGGY
Sbjct  286  EIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLKPAEGER--YYPGGRGRGRGRGSRGGY  343

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             GN  S+   PSIED G FP+LG K
Sbjct  344  SGNAYSNAPAPSIEDPGHFPSLGGK  368



>gb|KJB24891.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=361

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 138/205 (67%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE+A      +  V N+G      EK  G+EDA +A K+S
Sbjct  164  GRGNELKREGSGRGNWGTQTDELAQ-----VTEVTNEGERNLGDEKPAGEEDAREANKES  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEFESM  L+NKKN+D
Sbjct  219  ASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKNND  277

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  278  EVFIKLGSDKDKRKEAYEKEERAKKSVSINEFLKPAEGE-RYYNPSGRGRGRGRGSRGFG  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GG+       PSIED G FPTLG K
Sbjct  337  GGSAARDVAAPSIEDPGHFPTLGGK  361



>gb|ABK94426.1| unknown [Populus trichocarpa]
Length=370

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 141/212 (67%), Gaps = 17/212 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+P DEIAPE EEP    V D   +   EKQ  +EDA  A KD+
Sbjct  167  GRGNELKREGSGRGNWGTPADEIAPETEEP----VVDNEKSVITEKQPEEEDAAAASKDA  222

Query  587  P-------LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALL  429
                    ++EPE KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L
Sbjct  223  ADASKDAAVNEPEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQL  282

Query  428  ANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrgh  255
            ++KK++DE+F+KLGSEK+ +K  A +  + KK  SINEFLKPA G+              
Sbjct  283  SSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAGGDR----YYNPGRGRG  338

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                 G  G NT   E PSIED GQFPTLG K
Sbjct  339  RGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  370



>gb|KHG05539.1| Plasminogen activator inhibitor 1 RNA-binding [Gossypium arboreum]
Length=362

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 138/205 (67%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TD +A   EE    V N+G      EK  G+EDA DA K+S
Sbjct  164  GRGNELKREGSGRGNWGTQTDNLAQVTEE----VTNEGERNLGDEKPAGEEDARDANKES  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEFESM  L+NKK++D
Sbjct  220  ASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKSND  278

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ +K+     E+ KK+ SINEFLKPAEGE  Y              RG  
Sbjct  279  EVFIKLGSDKDKRKEAYEKEERAKKSVSINEFLKPAEGE-RYYNPSGRGRGRGRGSRGFG  337

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GG+       PSIED G FPTLG K
Sbjct  338  GGSAARDVAAPSIEDPGHFPTLGGK  362



>ref|XP_006368965.1| nuclear RNA-binding family protein [Populus trichocarpa]
 gb|ERP65534.1| nuclear RNA-binding family protein [Populus trichocarpa]
Length=374

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 141/212 (67%), Gaps = 17/212 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+P DEIAPE EEP    V D   +   EKQ  +EDA  A KD+
Sbjct  171  GRGNELKREGSGRGNWGTPADEIAPETEEP----VVDNEKSVITEKQPEEEDAAAASKDA  226

Query  587  P-------LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALL  429
                    ++EPE KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L
Sbjct  227  ADASKDAAVNEPEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQL  286

Query  428  ANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrgh  255
            ++KK++DE+F+KLGSEK+ +K  A +  + KK  SINEFLKPA G+              
Sbjct  287  SSKKSNDEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAGGDR----YYNPGRGRG  342

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                 G  G NT   E PSIED GQFPTLG K
Sbjct  343  RGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  374



>ref|XP_009343931.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=367

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 149/209 (71%), Gaps = 13/209 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD---AFEKQHGQEDAGDAK  597
            GRGS+IKREGSGRGNWG+P+D+IAPE EEP       G  T+     EKQ G+ +  DA 
Sbjct  166  GRGSDIKREGSGRGNWGTPSDDIAPEIEEP-------GTETEKNVGAEKQSGENETADAN  218

Query  596  KDSPLdepevkepedkEMTLDE-YEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            KDS ++E E KEPE+++    E YEK+LEEKRKA+LA + EERKV +DK+ ++M LL+NK
Sbjct  219  KDSTVNETEEKEPEEEKEMTLEEYEKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNK  278

Query  419  KNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsg  246
            K +DE+F+KLGSEK+ +K+ A +  + KK+ SIN+FLKP EGE YY   GRGRGRG   G
Sbjct  279  KENDEIFIKLGSEKDKRKEAAEKEERAKKSVSINQFLKPTEGERYYGGRGRGRGRGPRGG  338

Query  245  rggygGNNTSSFETPSIEDVGQFPTLGSK  159
              G  G  +S+   PSIED GQFP+LG K
Sbjct  339  YSGGPGGYSSNVAAPSIEDPGQFPSLGGK  367



>ref|XP_006398418.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
 gb|ESQ39871.1| hypothetical protein EUTSA_v10000938mg [Eutrema salsugineum]
Length=359

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 118/158 (75%), Gaps = 5/158 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+  D+I P  EEP   V    V     EKQ G++D  DAKKD+
Sbjct  153  GRGNDLKREGGGRGNWGTTEDDIPPATEEPTTEVEKSPV----AEKQSGEDDTTDAKKDA  208

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P DE E KE EDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK+++
Sbjct  209  PADEQEEKEAEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSNE  267

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  294
            E+F+KLGSEK+ +  E  EK KK+ SINEFLKPA+GET
Sbjct  268  EIFIKLGSEKDKRTTEKEEKAKKSLSINEFLKPADGET  305



>ref|XP_008238397.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Prunus mume]
Length=360

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 150/205 (73%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G GSE KR+G+GRGNWG+PTD+IA E EEP   +     N  A EKQ G+ +A DA K++
Sbjct  161  GHGSEFKRDGAGRGNWGTPTDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             ++E E KE E+KEMTL+EYEK+LEEKRKA+LA + EERKV LDK+ +SM  L+NKK ++
Sbjct  217  TVNESEEKELEEKEMTLEEYEKVLEEKRKALLALKTEERKVDLDKDLKSMQQLSNKKENN  276

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY   GRGRGRG   G GG 
Sbjct  277  DIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGGRGRGRGRGPRGGYGGG  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G  + S   PSIED GQFPTLG K
Sbjct  337  PGGYSGSA-APSIEDPGQFPTLGGK  360



>gb|KJB25494.1| hypothetical protein B456_004G194400 [Gossypium raimondii]
Length=353

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 131/204 (64%), Gaps = 10/204 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGS TDEIAPE E              + EKQ G+EDA DA K++
Sbjct  159  GRGNEFKRDGSGRGNWGSSTDEIAPETE-----ENVTENEKKSTEKQFGEEDAADANKEN  213

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
                   ++  + +MTL+EYEK+LEEKRKA+ A + E RKV + KEFESM  L+NKK++D
Sbjct  214  -AANEAEEKEPENKMTLEEYEKILEEKRKALDALKTEGRKVDV-KEFESMQQLSNKKSND  271

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KLGSEK+ +K    E+  K   SINEFLKPAEGE     G           RGGYG
Sbjct  272  DIFIKLGSEKDKRKDADKEEKAKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYG  329

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
            GN  S+ + PSI D G FP+LG K
Sbjct  330  GNTASNVQAPSIADPGHFPSLGGK  353



>ref|XP_009789579.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=351

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 133/198 (67%), Gaps = 17/198 (9%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG    P               VNDG      EK+ GQEDA D  KDS   EPE
Sbjct  170  RRSGTGRGETEVP---------------VNDGEKIVEAEKEAGQEDAEDTNKDSTAAEPE  214

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  390
             KEPE+KEMTL+EYEKL+EEKRKA+LA +PEERKV LDKE E+M LL+NKKNDDE+F+KL
Sbjct  215  EKEPEEKEMTLEEYEKLMEEKRKALLALKPEERKVNLDKELETMQLLSNKKNDDEIFIKL  274

Query  389  GSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTS-S  213
            GS +++K+KEA EK +KTKSINEFLKPA+GE+ Y   G           G  GG   + +
Sbjct  275  GS-EKEKRKEAVEKARKTKSINEFLKPADGESSYYRRGGRGRGQGRGRGGFGGGVGGNKN  333

Query  212  FETPSIEDVGQFPTLGSK  159
            F  PSIEDVGQFP+L +K
Sbjct  334  FSAPSIEDVGQFPSLVAK  351



>gb|AAF14244.1|AF110228_1 nuclear RNA binding protein A [Spinacia oleracea]
Length=356

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 138/206 (67%), Gaps = 7/206 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG ++KREGSGRGNWG+P DEIA E EEP   V N+ V   A EK  G+E A DA K++
Sbjct  154  GRGGDVKREGSGRGNWGTPADEIAQETEEPA-VVENEAVV--AAEKPAGEEVA-DAGKEN  209

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E E  EPE+K+MTL+EYEK+LEEKRKA+LA + EERKV +DK+FESM L   KK DD
Sbjct  210  PEKEAEEVEPEEKQMTLEEYEKVLEEKRKALLALKAEERKVDVDKDFESMQLKTKKKVDD  269

Query  407  EVFVKLGS--ekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF++L S  +K+ +  E  EK KK+ SINEFL+PAEG   Y+  G     G G   G  
Sbjct  270  EVFIQLNSDKDKKKEAAEKEEKAKKSVSINEFLRPAEGGDQYQRRGGRGRGGRGGRGGNG  329

Query  233  gGNNTSSFET-PSIEDVGQFPTLGSK  159
            GG    +  T P IED  QFPTLG K
Sbjct  330  GGGYGMNHATAPKIEDPNQFPTLGGK  355



>ref|XP_011032359.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Populus euphratica]
Length=360

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 140/208 (67%), Gaps = 18/208 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG-----QEDAGD  603
            GRG+E+KREGSGRGNWG+PTDE+A   EE      N+G      EK  G     ++ A D
Sbjct  166  GRGNEMKREGSGRGNWGTPTDELALVTEE----AANEG------EKNWGDDKPVEDAAAD  215

Query  602  AKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
             KK++P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+N
Sbjct  216  GKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFQSMQQLSN  274

Query  422  KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgr  243
            KK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  Y   G          R
Sbjct  275  KKENNDVFIKLGS-DKDKRKEAYEKAKKSVSINEFLKPAEGE-RYYGAGSRSRGRGRGAR  332

Query  242  ggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G    +  SS   PSIED GQFPTLG K
Sbjct  333  GFGNRDGMSSVPAPSIEDPGQFPTLGGK  360



>ref|XP_009368154.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Pyrus x bretschneideri]
Length=362

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 151/205 (74%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KREGSGRGNWG+P+D+IAPE EEP         N  A EKQ G+ +A DA K+ 
Sbjct  162  GRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEK---NVSA-EKQSGENEAADANKED  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +D
Sbjct  218  AVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKEND  277

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G 
Sbjct  278  EIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGGRGRGRGRGPRGGYSGG  337

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G  +S+   PSI D GQFP+LG K
Sbjct  338  PGGYSSNAAAPSIGDPGQFPSLGGK  362



>gb|KHG30709.1| hypothetical protein F383_14338 [Gossypium arboreum]
Length=353

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 141/216 (65%), Gaps = 21/216 (10%)
 Frame = -1

Query  764  RGSEIKREGSGRGNWGSPTDEIAP-------------EAEEPINGVVNDGVNTDAFEKQH  624
            R +E KR+GSGRGNWGSPTD IAP             EAEE     V +       EKQ 
Sbjct  145  RMNEFKRDGSGRGNWGSPTDGIAPSYAYISVILPKIREAEE----NVPENEKNVGIEKQS  200

Query  623  GQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFE  444
            G+EDA DA K++  +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFE
Sbjct  201  GEEDAMDAGKENAANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFE  259

Query  443  SMALLANKKNDDEVFVKLGSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgr  267
            SM  L++KK++D++F+KLGSEK+ +K    E+  KK+ SINEFLKPAEGE     G    
Sbjct  260  SMQQLSSKKSNDDIFIKLGSEKDKRKDADKEERVKKSVSINEFLKPAEGER--YYGPGRG  317

Query  266  grghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                   RGGYGGN  SS   PSIED G FP+LG K
Sbjct  318  RGRGRGPRGGYGGNTASSVLAPSIEDPGHFPSLGGK  353



>ref|XP_004300342.1| PREDICTED: intracellular hyaluronan-binding protein 4-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=385

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 143/212 (67%), Gaps = 14/212 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KR+G+GRGNWG+PTDEIA E E P   V  D    DA EK  G+ +A DA K++
Sbjct  179  GRGSDFKRDGAGRGNWGTPTDEIASEVE-PGTEVEKD---VDA-EKPLGENEAADANKEN  233

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              DEP+ KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV LDKE +SM  L++KK +D
Sbjct  234  AEDEPKEKEPEEKEMTLEEYEKVLEEKRKALAALKTEERKVDLDKELKSMQQLSSKKTND  293

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyr-------pggrgrgrgh  255
            E+F+KLGSEK+ +K+ A ++ +  K  SINEFLKPAEGE+           GGRG   G+
Sbjct  294  EIFIKLGSEKDKRKEAAEKEERAKKVVSINEFLKPAEGESQRHYSGRNRGRGGRGSRGGY  353

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                 G   +N ++   PSI D   FP+LG K
Sbjct  354  SGEGHGGHSSNANAKPAPSIADTALFPSLGGK  385



>ref|XP_007134461.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
 gb|ESW06455.1| hypothetical protein PHAVU_010G049300g [Phaseolus vulgaris]
Length=359

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 145/209 (69%), Gaps = 11/209 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KR+G+GRGNWG+ +D+IA   EE    V ++       EK  G+E A D  KDS
Sbjct  156  GRGNDLKRDGAGRGNWGTQSDDIAQVTEE----VGDETEKNFGDEKPVGEESAADGNKDS  211

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPE+KEMTL+EYEK+LEE+RKA+ A + E RKV + KEF SM  L+NKK++D
Sbjct  212  PANENEEKEPEEKEMTLEEYEKVLEERRKALQALKTETRKVDI-KEFASMQPLSNKKDND  270

Query  407  EVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEGE----Tyyrpggrgrgrghgsg  246
            E+F+KLGS+K+ +K    ++ +  KS+N  EFLKPAEGE    T  R  GRGRG G G G
Sbjct  271  EIFIKLGSDKDKRKDALEKEERSKKSVNITEFLKPAEGERYYNTSGRGRGRGRGGGRGGG  330

Query  245  rggygGNNTSSFETPSIEDVGQFPTLGSK  159
             GGY GN  S+   PSIED GQFPTLG K
Sbjct  331  GGGYSGNAGSNVSAPSIEDPGQFPTLGGK  359



>ref|XP_003529036.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=368

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 134/205 (65%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWG+  D+IA   EE    VV +     A EK  G+EDA +  KD 
Sbjct  171  GRGNEFKRDGSGRGNWGTQNDDIAVVTEE----VVYETEKNFADEKPAGEEDAPEGNKDC  226

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV + KEF SM  L+NKK +D
Sbjct  227  PANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEVRKVDI-KEFASMQPLSNKKEND  285

Query  407  EVFVKLGSekedkkkeagekvkktKSIN--EFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F+KLGS+K+ +K    ++ K  KS+N  EFLKPAEGE      G          RGGY
Sbjct  286  EIFIKLGSDKDKRKDALEKEEKSKKSVNITEFLKPAEGER--YYSGGRGRGRGRGSRGGY  343

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             GN  S+   PSIED GQFPTL  K
Sbjct  344  SGNAYSNVPAPSIEDPGQFPTLSGK  368



>ref|XP_007218155.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
 gb|EMJ19354.1| hypothetical protein PRUPE_ppa007410mg [Prunus persica]
Length=369

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 142/205 (69%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSEIKREGSGRGNWGS TDE++   EE    V N        EK  G+ DA D  K++
Sbjct  169  GRGSEIKREGSGRGNWGSETDELSQVIEE----VANVTERNLGDEKPVGEVDAADGNKET  224

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEF S+  L+NKK +D
Sbjct  225  PANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSEERKVDTKEFASLQQLSNKKGND  284

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEGE +Y PGGRGRGRG G   G  
Sbjct  285  DIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKPAEGERFYNPGGRGRGRGRGPRGGFS  344

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
               +  S   PSIED GQFPTLG+K
Sbjct  345  NNYSHGSAAAPSIEDPGQFPTLGAK  369



>ref|XP_008232490.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Prunus mume]
Length=369

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 141/205 (69%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSEIKREGSGRGNWGS TDE++   EE    V N        EK  G+ DA D  K++
Sbjct  169  GRGSEIKREGSGRGNWGSETDELSQVTEE----VANVTERNLGDEKPVGEVDAADGNKET  224

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEF S+  L+NKK +D
Sbjct  225  PANEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKTSEERKVDTKEFASLQQLSNKKGND  284

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEGE +Y PGGRGRGRG G   G  
Sbjct  285  DIFIKLGSDKDKKKEAAEKEEKSKKSVSINEFLKPAEGERFYNPGGRGRGRGRGPRGGFS  344

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
               +  S   PSIED GQFPTLG K
Sbjct  345  NNYSHGSAAAPSIEDPGQFPTLGGK  369



>ref|XP_011081282.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Sesamum indicum]
Length=343

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 141/197 (72%), Gaps = 19/197 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG           E EEP     N+GV     EKQ G++D  DA KDS  +E E
Sbjct  166  RRSGTGRG-----------ETEEP----TNEGVKNVDSEKQSGEDDVIDANKDSSANEQE  210

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  390
             KEPE+KEMTL+EYEK+LEEKRKA+LA + EERKV LDKE ESM LL+NKKNDDEVF+KL
Sbjct  211  EKEPEEKEMTLEEYEKVLEEKRKALLALKSEERKVGLDKELESMQLLSNKKNDDEVFIKL  270

Query  389  GSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF  210
            GS  +DK+KEA EK KK+ SINEFLKPAEG+ YYR GGRGRGRG G G  G    N  + 
Sbjct  271  GS-DKDKRKEAAEKAKKSVSINEFLKPAEGDKYYRAGGRGRGRGRGRGGFGG---NNYNV  326

Query  209  ETPSIEDVGQFPTLGSK  159
            E P+IEDVGQFP+L +K
Sbjct  327  EAPAIEDVGQFPSLVAK  343



>ref|XP_006375155.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 ref|XP_006375156.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52952.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
 gb|ERP52953.1| hypothetical protein POPTR_0014s04820g [Populus trichocarpa]
Length=373

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 147/215 (68%), Gaps = 19/215 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN-GVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E+KREGSGRGNWG+PTDE+A   EE  N G  N G      + +  +E A D KK+
Sbjct  166  GRGNEMKREGSGRGNWGTPTDELALVTEEAANEGEKNLG------DDKPVEEAAADRKKE  219

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+NKK +
Sbjct  220  NPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFQSMQQLSNKKEN  278

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            ++VF+KLGS+K+ +K+   +  K KK+ SINEFLKPAEGE YY  G RGRGRG G+   G
Sbjct  279  NDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKPAEGERYYGSGSRGRGRGRGARGFG  338

Query  236  ygGNNTSSF---------ETPSIEDVGQFPTLGSK  159
                 +S F           PSIED GQFPTLG K
Sbjct  339  NRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>gb|ABK94354.1| unknown [Populus trichocarpa]
Length=373

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 147/215 (68%), Gaps = 19/215 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN-GVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E+KREGSGRGNWG+PTDE+A   EE  N G  N G      + +  +E A D KK+
Sbjct  166  GRGNEMKREGSGRGNWGTPTDELALVTEEAANEGEKNLG------DDKPVEEAAADRKKE  219

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+NKK +
Sbjct  220  NPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFQSMQQLSNKKEN  278

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            ++VF+KLGS+K+ +K+   +  K KK+ SINEFLKPAEGE YY  G RGRGRG G+   G
Sbjct  279  NDVFIKLGSDKDKRKEAYEKDEKAKKSVSINEFLKPAEGERYYGSGSRGRGRGRGARGFG  338

Query  236  ygGNNTSSF---------ETPSIEDVGQFPTLGSK  159
                 +S F           PSIED GQFPTLG K
Sbjct  339  NRDGMSSGFGNRDGMSSVPAPSIEDPGQFPTLGGK  373



>ref|NP_001241515.1| uncharacterized protein LOC100807657 [Glycine max]
 gb|ACU21122.1| unknown [Glycine max]
Length=367

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 138/205 (67%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG+ TDE+A   +E    V N+       EK   +ED  D  KDS
Sbjct  168  GRGNEFKREGSGRGNWGAQTDELAQVTDE----VANETEKNLGDEKPAVEEDVADGNKDS  223

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ 
Sbjct  224  PTNETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNH  282

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGS+K+ +K+     EK KK+ SI EFLKPAEGE YY PG          G GGY
Sbjct  283  DIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGY  342

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G+ T++   PSIED G FPTL +K
Sbjct  343  HGSATNNAPAPSIEDPGHFPTLSAK  367



>ref|XP_011032341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
 ref|XP_011032350.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Populus euphratica]
Length=370

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 147/217 (68%), Gaps = 26/217 (12%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHG-----QEDAGD  603
            GRG+E+KREGSGRGNWG+PTDE+A   EE      N+G      EK  G     ++ A D
Sbjct  166  GRGNEMKREGSGRGNWGTPTDELALVTEE----AANEG------EKNWGDDKPVEDAAAD  215

Query  602  AKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
             KK++P +EPE KEPEDK MTL+EYEK+LEEKRKA+ A + EERKV   KEF+SM  L+N
Sbjct  216  GKKENPANEPEEKEPEDKVMTLEEYEKVLEEKRKALQALKTEERKVDA-KEFQSMQQLSN  274

Query  422  KKNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgr  243
            KK +++VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE YY  G R RGRG G+  
Sbjct  275  KKENNDVFIKLGS-DKDKRKEAYEKAKKSVSINEFLKPAEGERYYGAGSRSRGRGRGARG  333

Query  242  ggygGNNTSSF---------ETPSIEDVGQFPTLGSK  159
             G     +S F           PSIED GQFPTLG K
Sbjct  334  FGNRDGMSSGFGSRDGMSSVPAPSIEDPGQFPTLGGK  370



>ref|XP_006837401.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
 gb|ERN00255.1| hypothetical protein AMTR_s00111p00140620 [Amborella trichopoda]
Length=362

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 145/208 (70%), Gaps = 9/208 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIA-PEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG+E KR+G+GRGNWG+P DE A  E+EE    VV +     + EK   +E+     KD
Sbjct  159  GRGNEFKRDGAGRGNWGAPIDEGAVQESEE----VVGENGKVTSPEKPSEEENNAAVNKD  214

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            + ++EPE KEPE+KEMTL EYEK+LEEKRKA+ A + EERKV LDK+FESM  L++KK +
Sbjct  215  NAVNEPEQKEPENKEMTLSEYEKVLEEKRKALQALKNEERKVNLDKDFESMLQLSDKKAN  274

Query  410  DEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGETyyrpggrgrgrghgsgr  243
            D+VF+KLGSEK+  +++   +     KK+ SINEFLKP +G  YY P GRGRG+G G   
Sbjct  275  DDVFIKLGSEKDAARRKEIAEKEERIKKSVSINEFLKPVDGGRYYSPRGRGRGQGRGGFG  334

Query  242  ggygGNNTSSFETPSIEDVGQFPTLGSK  159
            GG   N+T+S   PSIED  QFPTL +K
Sbjct  335  GGISSNSTNSIAAPSIEDQNQFPTLAAK  362



>ref|XP_009368155.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Pyrus x bretschneideri]
Length=359

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 150/205 (73%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KREGSGRGNWG+P+D+IAPE EEP         N  A EKQ G+ +A DA K+ 
Sbjct  162  GRGSDFKREGSGRGNWGTPSDDIAPETEEPGTETEK---NVSA-EKQSGENEAADANKED  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             ++E E KEPE+KEMTL+EY+K+LEEKRKA+LA + EERKV +DK+ ++M LL+NKK +D
Sbjct  218  AVNETEEKEPEEKEMTLEEYQKVLEEKRKALLALKTEERKVDVDKDLKAMQLLSNKKEND  277

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G 
Sbjct  278  EIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGGRGRGRGRGPRGGYSGG  337

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G N +    PSI D GQFP+LG K
Sbjct  338  PGGNAA---PPSIGDPGQFPSLGGK  359



>ref|XP_008347095.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=236

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 138/205 (67%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE+KREGSGRGNWG+  DE++   EE    V N        EK   + DA D  KD+
Sbjct  36   GRGSEVKREGSGRGNWGAQADELSEVTEE----VANVTEKNLGDEKLVEEGDAADGNKDT  91

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEFES   L+NKK +D
Sbjct  92   PAKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQQLSNKKAND  151

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            E+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGGRGRGRG GS  GG+ 
Sbjct  152  EIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGGRGRGRGRGSRGGGFS  211

Query  230  GNNT-SSFETPSIEDVGQFPTLGSK  159
             N + SS   PSIED GQFPTLG K
Sbjct  212  SNYSHSSAAAPSIEDPGQFPTLGGK  236



>ref|XP_008238398.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Prunus mume]
Length=359

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 147/201 (73%), Gaps = 7/201 (3%)
 Frame = -1

Query  755  EIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLde  576
            E KR+G+GRGNWG+PTD+IA E EEP   +     N  A EKQ G+ +A DA K++ ++E
Sbjct  164  EFKRDGAGRGNWGTPTDDIAQETEEPGTEIEK---NVGA-EKQLGENEAADANKENTVNE  219

Query  575  pevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFV  396
             E KE E+KEMTL+EYEK+LEEKRKA+LA + EERKV LDK+ +SM  L+NKK ++++F+
Sbjct  220  SEEKELEEKEMTLEEYEKVLEEKRKALLALKTEERKVDLDKDLKSMQQLSNKKENNDIFI  279

Query  395  KLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNN  222
            KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY   GRGRGRG   G GG  G  
Sbjct  280  KLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYGGRGRGRGRGPRGGYGGGPGGY  339

Query  221  TSSFETPSIEDVGQFPTLGSK  159
            + S   PSIED GQFPTLG K
Sbjct  340  SGSA-APSIEDPGQFPTLGGK  359



>emb|CDP21265.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 139/206 (67%), Gaps = 10/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQH-GQEDAGDAKKD  591
            GRG+EIKREG+GRGNWG+ +DE+A  AEE     VN+G      EKQ  G+ED  D  K+
Sbjct  166  GRGNEIKREGAGRGNWGTESDEVAQAAEE-----VNEGEKNPNAEKQPPGEEDTADGSKE  220

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P +E E KEPE+KEMTL+EYEK+LEEKRK +   + EERKV   K F SM  LANKK +
Sbjct  221  TPANESEEKEPENKEMTLEEYEKVLEEKRKTLQTLKTEERKVDA-KAFASMQQLANKKAN  279

Query  410  DEVFVKLGS--ekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            ++VF+KLGS  +K+ +  E  EK KK+ SINEFLKPAEGE  +   G          RG 
Sbjct  280  EDVFIKLGSDKDKKKEANEKEEKAKKSLSINEFLKPAEGE-KFYNPGGRGRGRGRGSRGY  338

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             GGN+  + ETPSIED+  FP+LGSK
Sbjct  339  GGGNSYGNVETPSIEDLVLFPSLGSK  364



>ref|XP_006853790.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
 gb|ERN15257.1| hypothetical protein AMTR_s00056p00215280 [Amborella trichopoda]
Length=403

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 148/211 (70%), Gaps = 13/211 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA--K  597
            GRG+E KREG+GRGNWG+PTD+  A +  E    V N        EKQ  QED  DA  +
Sbjct  180  GRGNETKREGAGRGNWGTPTDDGFAVQESE---AVANVEEKNPTPEKQPEQEDGVDAGKE  236

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
            K++ ++EPE KEPEDKEMTL+EYEK+ EEKRKA+LA +PEERKV +DKEF+SM  L+ KK
Sbjct  237  KENAVNEPEEKEPEDKEMTLEEYEKVREEKRKALLAMKPEERKVDVDKEFKSMQQLSLKK  296

Query  416  NDDEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGETyyrpggrgrgrghgs  249
             +D++F+KLGS+K+  +++   +     KK+ SINEFLKPAEGE YY PGGRGRGRG G 
Sbjct  297  GNDDIFIKLGSDKDSNRRKDSAEKDERVKKSLSINEFLKPAEGEKYYSPGGRGRGRGRGD  356

Query  248  grggygGNNTSSFET---PSIEDVGQFPTLG  165
              G  GG   SS      PSIED GQFPTLG
Sbjct  357  RGGYRGGYTGSSANVALAPSIEDPGQFPTLG  387



>ref|XP_011047584.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=364

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 138/212 (65%), Gaps = 17/212 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQ-------HGQEDA  609
            GRG+EIKREGSGRGNWG+  DEIAPE EEP    V D   +   EKQ          +DA
Sbjct  161  GRGNEIKREGSGRGNWGTHADEIAPETEEP----VVDNEKSFIAEKQPEEEEAAAASKDA  216

Query  608  GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALL  429
             DA KD+   EPEVKEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV LDK+ +SM  L
Sbjct  217  ADASKDAAAKEPEVKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVGLDKDLQSMQQL  276

Query  428  ANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrgh  255
            ++KK++ E+F+KLGSEK+ +K  A +  + KK  SINEFLKPA G+              
Sbjct  277  SSKKSNAEIFIKLGSEKDKRKDAADKEDRAKKAVSINEFLKPAGGDR----HYNPGRGRG  332

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                 G  G NT   E PSIED GQFPTLG K
Sbjct  333  RGRGRGGYGGNTRDVEAPSIEDPGQFPTLGGK  364



>gb|KCW77830.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=370

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 150/209 (72%), Gaps = 10/209 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+G+GRGNWG+PTDEIAPE EE     V +   T   EKQ   ED  DA K+ 
Sbjct  166  GRGNETKRDGAGRGNWGAPTDEIAPETEE----PVTEVEKTGGSEKQLAGEDGADASKEK  221

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND-  411
            PL+EPE KEPEDKEMTL+EYEK+ EE RK++LA + EERKV LDK+ +SM  L+NKK D 
Sbjct  222  PLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERKVELDKDLKSMQQLSNKKKDN  281

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +++F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY PGGRGRGRG G+  G 
Sbjct  282  NDIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYNPGGRGRGRGRGARGGY  341

Query  236  ygGNNTSSFE---TPSIEDVGQFPTLGSK  159
             GG           PSIED GQFP+LG K
Sbjct  342  GGGGGGGYARDAAAPSIEDPGQFPSLGGK  370



>ref|XP_008344404.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Malus domestica]
Length=367

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 142/211 (67%), Gaps = 18/211 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQE------DAG  606
            GRGSE+KREGSGRGNWGS  DE++   EE  N            EK  G E      DA 
Sbjct  167  GRGSEVKREGSGRGNWGSQADELSELTEEVAN----------VTEKHLGDEKPVEEGDAA  216

Query  605  DAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
            D KKD+P +EPE KEPEDKEMTL+EY+K+LEEKRKA+ A +  E +    KEFES   L+
Sbjct  217  DGKKDTPANEPEEKEPEDKEMTLEEYQKVLEEKRKALQALKTTEERKVDAKEFESFQQLS  276

Query  425  NKKNDDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgs  249
            NKK +DE+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE +Y PGGRGRGRG GS
Sbjct  277  NKKANDEIFIKLGSDKDKKKDSEKEEKSKKSVSINEFLKPAEGERFYNPGGRGRGRGRGS  336

Query  248  grggygGNNT-SSFETPSIEDVGQFPTLGSK  159
              GG+  N + SS   PSIED GQFPTLG K
Sbjct  337  KGGGFSSNYSHSSAAAPSIEDPGQFPTLGGK  367



>ref|XP_009373211.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Pyrus x bretschneideri]
Length=372

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE+KREGSGRGNWG+  DE++   EE    V N        EK   + DA D  KD+
Sbjct  172  GRGSEVKREGSGRGNWGAQADELSEVTEE----VANVTEKNLGDEKPGEEGDAADGNKDT  227

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEFES   L+NKK +D
Sbjct  228  PANEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQQLSNKKAND  287

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            E+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGGRGRGRG GS  GG+ 
Sbjct  288  EIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGGRGRGRGRGSRGGGFS  347

Query  230  GNNT-SSFETPSIEDVGQFPTLGSK  159
             N + SS   PSIED GQFPTLG K
Sbjct  348  SNYSHSSAAAPSIEDPGQFPTLGGK  372



>ref|XP_004306983.1| PREDICTED: circumsporozoite protein-like [Fragaria vesca subsp. 
vesca]
Length=387

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 141/211 (67%), Gaps = 20/211 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQE------DAG  606
            GRG+E+KREGSGRGNWGS TDE  PE        V +GV  DA EK  G+E      +A 
Sbjct  189  GRGNELKREGSGRGNWGSQTDEF-PE--------VTEGV--DATEKNLGEEKLVGEVEAA  237

Query  605  DAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
            D  K++P +EPE KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV   KEFES+  ++
Sbjct  238  DGSKETPANEPEEKEPEEKEMTLEEYEKVLEEKRKALQALKTEERKVDT-KEFESLQQIS  296

Query  425  NKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghg  252
            NKK +D+VF+KLGS+K+ KK+ A ++ K  K  SINEFLKPAEGE +  P   GRGRG G
Sbjct  297  NKKGNDDVFIKLGSDKDKKKESAEKEEKAKKSVSINEFLKPAEGERFSYPSRGGRGRGRG  356

Query  251  sgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
               G       SS   P IED   FPTLG K
Sbjct  357  PRGGSSSNYPQSSVRAPPIEDPSHFPTLGGK  387



>ref|XP_009776248.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana sylvestris]
Length=363

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 132/208 (63%), Gaps = 11/208 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG EIKREG+GRGNWG+  DE+    +E    V N+G      EK     +AGD KK++
Sbjct  162  GRGGEIKREGAGRGNWGTQADEVTQITDE----VANEGEKNLNVEKPSADGEAGDDKKEN  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E E KEPE+KEMTL+EYEK+LEEKR+A+ A + EERKV + KEFESM  L+ K +DD
Sbjct  218  PAAEAEDKEPENKEMTLEEYEKVLEEKRQALQALKTEERKVDI-KEFESMQQLSKKSSDD  276

Query  407  EVFVKLGSe-kedkkkeagekvkktKSINEFLKPAEGETyyr----pggrgrgrghgsgr  243
             +F+KLG + K  +  E  EK KK  SINEFLKPAEGE YY       G       G G 
Sbjct  277  -IFIKLGPKDKRRESAEKEEKAKKAVSINEFLKPAEGERYYAPGGRGRGGRGRGSRGYGG  335

Query  242  ggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G  G N TS+ E P IED G FPTLG K
Sbjct  336  GYGGANTTSNVEAPLIEDPGHFPTLGGK  363



>ref|XP_003552493.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Glycine max]
Length=370

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 141/209 (67%), Gaps = 11/209 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG+ TDE+A   +E    VVN+       EK   +ED  D  KDS
Sbjct  167  GRGNEFKREGSGRGNWGTQTDELAQVTDE----VVNETEKNLGDEKPAVEEDVADGNKDS  222

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ 
Sbjct  223  PTNETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNH  281

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyr----pggrgrgrghgsg  246
            ++F+KLGS+K+ +K+     EK KK+ SI EFLKPAEGE YY      G     RG G G
Sbjct  282  DIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGG  341

Query  245  rggygGNNTSSFETPSIEDVGQFPTLGSK  159
             G Y G++T++   PSIED G FP LG+K
Sbjct  342  GGVYRGSSTNNAPAPSIEDPGHFPNLGAK  370



>ref|XP_008375773.1| PREDICTED: LOW QUALITY PROTEIN: plasminogen activator inhibitor 
1 RNA-binding protein-like [Malus domestica]
Length=373

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 138/205 (67%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE+KREGSGRGNWG+  DE++   EE    V N        EK   + DA D  KD+
Sbjct  173  GRGSEVKREGSGRGNWGAQADELSEVTEE----VANVTEKNLGDEKLVEEGDAADGNKDT  228

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  EP  KEPEDKEMTL+EYEK+LEEKRKA+ A +  E +    KEFES   L+NKK +D
Sbjct  229  PXKEPGEKEPEDKEMTLEEYEKVLEEKRKALQALKTTEERKVDAKEFESFQQLSNKKAND  288

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            E+F+KLGS+K+ KK    E+  K   SINEFLKPAEGE  Y PGGRGRGRG GS  GG+ 
Sbjct  289  EIFIKLGSDKDKKKDAEKEEKSKKSVSINEFLKPAEGERSYNPGGRGRGRGRGSRGGGFS  348

Query  230  GNNT-SSFETPSIEDVGQFPTLGSK  159
             N + SS   PSIED GQFPTLG K
Sbjct  349  SNYSHSSAAAPSIEDPGQFPTLGGK  373



>ref|XP_009607515.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=337

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 141/197 (72%), Gaps = 19/197 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG           E EEP+N    +G      EK   Q DA DA KDSP  EP+
Sbjct  160  RRSGTGRG-----------EKEEPLN----EGEKIVDTEKPAVQADAEDASKDSPAAEPQ  204

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  390
             KEPE+KEMTL+EYEKLLE+KRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KL
Sbjct  205  EKEPEEKEMTLEEYEKLLEDKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKL  264

Query  389  GSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF  210
            GS ++DK+KEA EK KKTKSINEFLKPA+G +YYR GGRGRG       G  G N+ S+ 
Sbjct  265  GS-EKDKRKEAVEKAKKTKSINEFLKPADGGSYYRRGGRGRGGRDHGRDGVVGNNSVSA-  322

Query  209  ETPSIEDVGQFPTLGSK  159
              PSIEDV QFP+LG+K
Sbjct  323  --PSIEDVRQFPSLGAK  337



>ref|XP_011465242.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=384

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 142/212 (67%), Gaps = 15/212 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KR+G+GRGNWG+PTDEIA E E P   V  D    DA EK  G+ +A DA K++
Sbjct  179  GRG-DFKRDGAGRGNWGTPTDEIASEVE-PGTEVEKD---VDA-EKPLGENEAADANKEN  232

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              DEP+ KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV LDKE +SM  L++KK +D
Sbjct  233  AEDEPKEKEPEEKEMTLEEYEKVLEEKRKALAALKTEERKVDLDKELKSMQQLSSKKTND  292

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyr-------pggrgrgrgh  255
            E+F+KLGSEK+ +K+ A ++ +  K  SINEFLKPAEGE+           GGRG   G+
Sbjct  293  EIFIKLGSEKDKRKEAAEKEERAKKVVSINEFLKPAEGESQRHYSGRNRGRGGRGSRGGY  352

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                 G   +N ++   PSI D   FP+LG K
Sbjct  353  SGEGHGGHSSNANAKPAPSIADTALFPSLGGK  384



>ref|XP_010053521.1| PREDICTED: vasodilator-stimulated phosphoprotein-like [Eucalyptus 
grandis]
Length=368

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 151/208 (73%), Gaps = 9/208 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+G+GRGNWG+PTDEIAPE EEP+  V  + V +   EKQ   E+A DA K++
Sbjct  165  GRGNEFKRDGAGRGNWGTPTDEIAPEPEEPVVEVEKN-VGS---EKQLVDEEAADASKEN  220

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            PL+EPE KEPEDKEMTL+EYEK+ EEKRKA+L  + EERKV +DKE +SM  L++KK + 
Sbjct  221  PLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVEVDKELKSMQQLSSKKENH  280

Query  407  EVFVKLGSe--kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSE  K  +  E  E+ KK+ SINEFLKPAEGE YY PGGRGRGRG G+  G  
Sbjct  281  DIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYNPGGRGRGRGRGARGGYG  340

Query  233  gGNNTSSFE---TPSIEDVGQFPTLGSK  159
            GG           PSIED GQFP+LG K
Sbjct  341  GGGGGGYARDAAAPSIEDPGQFPSLGGK  368



>gb|KCW77831.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=369

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 154/208 (74%), Gaps = 9/208 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+G+GRGNWG+PTDEIAPE EEP+  V  + V +   EKQ   E+A DA K++
Sbjct  166  GRGNEFKRDGAGRGNWGTPTDEIAPEPEEPVVEVEKN-VGS---EKQLVDEEAADASKEN  221

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            PL+EPE KEPEDKEMTL+EYEK+ EEKRKA+L  + EERKV +DKE +SM  L++KK + 
Sbjct  222  PLNEPEEKEPEDKEMTLEEYEKVREEKRKALLVLKAEERKVEVDKELKSMQQLSSKKENH  281

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSEK+ +K+ A +  + KK+ SINEFLKPAEGE YY PGGRGRGRG G+  G  
Sbjct  282  DIFIKLGSEKDKRKEAAEKEERAKKSVSINEFLKPAEGERYYNPGGRGRGRGRGARGGYG  341

Query  233  gGNNTSSFE---TPSIEDVGQFPTLGSK  159
            GG           PSIED GQFP+LG K
Sbjct  342  GGGGGGYARDAAAPSIEDPGQFPSLGGK  369



>ref|XP_010924482.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1-like 
protein [Elaeis guineensis]
Length=376

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 137/216 (63%), Gaps = 22/216 (10%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD----AFEKQHGQEDA--G  606
            GRG EIKREG+GRGNWG+ TD+I  +A        ++ VN D    A EKQ  QEDA   
Sbjct  167  GRGYEIKREGAGRGNWGTATDDIIAQAS-------DENVNADDKLVATEKQQEQEDAPSS  219

Query  605  DAKKDSPLdepevkepedkE-MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALL  429
            +A KD  +   E ++  + + MTL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L
Sbjct  220  EANKDKDVQTNEEEKEPEDKEMTLEEYEKIREEKRKALLALKIEERKVEIDRELQSMQQL  279

Query  428  ANKKNDDEVFVKLGSekedkkkeagekv----kktKSINEFLKPAEGE----Tyyrpggr  273
            ++KK +++VF+KLGS+K+  KK+         KK+ SIN+FLKPAEGE       R  GR
Sbjct  280  SSKKGNEDVFIKLGSDKDMGKKKDVADRDERGKKSVSINQFLKPAEGERYYSATGRGRGR  339

Query  272  grgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  165
            GRG       G  GG+ ++    PSIED GQFPTLG
Sbjct  340  GRGGRGPFRGGFGGGDTSAPAAAPSIEDPGQFPTLG  375



>gb|KHN40549.1| hypothetical protein glysoja_001047 [Glycine soja]
Length=363

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 140/211 (66%), Gaps = 13/211 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG+ TDE+A   +E    VVN+       EK   +ED  D  KDS
Sbjct  158  GRGNEFKREGSGRGNWGTQTDELAQVTDE----VVNETEKNLGDEKPAVEEDVADGNKDS  213

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEE+RKA  A + EERKV   KEFESM  L++KK++ 
Sbjct  214  PTNETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEERKVDT-KEFESMQALSSKKDNH  272

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGET------yyrpggrgrgrghg  252
            ++F+KLGS+K+ +K+     EK KK+ SI EFLKPAEGE           G   RG G G
Sbjct  273  DIFIKLGSDKDKRKEAFEKEEKSKKSVSITEFLKPAEGEAYYNPGRGRGRGRGSRGGGGG  332

Query  251  sgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
             G G Y G++T++   PSIED G FP LG+K
Sbjct  333  GGGGVYRGSSTNNAPAPSIEDPGHFPNLGAK  363



>ref|XP_004515346.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cicer arietinum]
Length=371

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 139/205 (68%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS  KREG+GRGNWG+ +DEIA   EE    V N+       EK  G+E+A D  K++
Sbjct  169  GRGSGFKREGAGRGNWGTQSDEIAQVTEE----VANETEKNLGEEKPAGEEEAADVSKET  224

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV   KEFESM  L+ KK++ 
Sbjct  225  PANEAEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEGRKVDA-KEFESMKPLSCKKDNV  283

Query  407  EVFVKLGSekedkkke-agekvkktKSINEFLKPAEGE---Tyyrpggrgrgrghgsgrg  240
            E+F KLGS+K+ +K+    EK KK  SINEFLKPA+GE        GGRG   G GS  G
Sbjct  284  EIFAKLGSDKDKRKEAFDKEKSKKALSINEFLKPADGEKFYNPGGRGGRGGRGGRGSRGG  343

Query  239  gygGNNTSSFETPSIEDVGQFPTLG  165
            G+GGN  S+   PSIED GQFPTLG
Sbjct  344  GFGGNAYSNVPAPSIEDPGQFPTLG  368



>ref|XP_010053519.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X1 [Eucalyptus grandis]
Length=374

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 140/213 (66%), Gaps = 14/213 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+G+GRGNWG+PTDEIAPE EE     V +   T   EKQ   ED  DA K+ 
Sbjct  166  GRGNETKRDGAGRGNWGAPTDEIAPETEE----PVTEVEKTGGSEKQLAGEDGADASKEK  221

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND-  411
            PL+EPE KEPEDKEMTL+EYEK+ EE RK++LA + EERKV LDK+ +SM  L+NKK D 
Sbjct  222  PLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERKVELDKDLKSMQQLSNKKKDN  281

Query  410  DEVFVKLGSekedk--kkeagekvkktKSINEFLKPAEGE-------Tyyrpggrgrgrg  258
            +++F+KLG EK+ +    E  EK KK+ SINEFLKPAEGE            G   RG  
Sbjct  282  NDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAEGERYYNPGGRGRGRGRGARGGY  341

Query  257  hgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
             G G GG GG        PSIED GQFP+LG K
Sbjct  342  GGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  374



>dbj|BAE71280.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 134/205 (65%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+ TDEIA   EE     V +G      EK   + DA +  KDS
Sbjct  172  GRGNEFKREGAGRGNWGTETDEIAQVTEE----AVIEGEKNIGDEKPAVENDAAEGNKDS  227

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KE EDKEMTL+EY+K+LEEKRKA+   + EERKV   KEFE+M  L+ KK++ 
Sbjct  228  AANEAEEKEAEDKEMTLEEYQKVLEEKRKALQVVKTEERKVDT-KEFETMQALSCKKDNF  286

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F KLGS+K+ +K+     EK KK+ SINEFLKPAEG+ Y+R  G       G G G  
Sbjct  287  EIFAKLGSDKDKRKEAFDKEEKAKKSVSINEFLKPAEGDAYHRGRGGRGREARGGGGGYR  346

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN   +   PSIED G FPTLG+K
Sbjct  347  GGNLNRNVRAPSIEDPGHFPTLGAK  371



>ref|XP_010531668.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 139/205 (68%), Gaps = 10/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE KREGSGRGNWG+P +E+  E EE         V     EK  G ++A DA K++
Sbjct  158  GRGSEFKREGSGRGNWGTPGEELVAETEETGVETEKKVV-----EKPAGDDEAADANKET  212

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVCLDKEFESMALLANKKN  414
            P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LA+   ERKV L KEFESM  L+NKK 
Sbjct  213  PAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLATSDSERKVDL-KEFESMQQLSNKKA  271

Query  413  DDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrg  240
            +DE+F+KLGS+K+ +K      EK KK  SINEFLKPAEGE YY  GGRGRGRG G G  
Sbjct  272  NDEIFIKLGSDKDKRKDALDKEEKAKKAVSINEFLKPAEGEGYYPRGGRGRGRGRGGGSR  331

Query  239  gygGNNTSSFETPSIEDVGQFPTLG  165
            G G     S   P+IED  QFP+LG
Sbjct  332  GGGYGGYQSKAAPAIEDTAQFPSLG  356



>dbj|BAE71204.1| putative nuclear antigen homolog [Trifolium pratense]
Length=371

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 134/205 (65%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+ TDEIA   EE     V +G      EK   + DA +  KDS
Sbjct  172  GRGNEFKREGAGRGNWGTETDEIAQVTEE----AVIEGEKNIGDEKPAVENDAAEGNKDS  227

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KE EDKEMTL+EY+K+LEEKRKA+   + EERKV   KEFE+M  L+ KK++ 
Sbjct  228  AANEAEEKEAEDKEMTLEEYQKVLEEKRKALQVVKTEERKVDT-KEFETMQALSCKKDNF  286

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F KLGS+K+ +K+     EK KK+ SINEFLKPAEG+ YYR  G       G G G  
Sbjct  287  EIFAKLGSDKDKRKEAFDKEEKAKKSVSINEFLKPAEGDAYYRGRGGRGREARGGGGGYR  346

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN   +   PSIED G FPTLG+K
Sbjct  347  GGNLNRNVRAPSIEDPGHFPTLGAK  371



>gb|KFK31390.1| hypothetical protein AALP_AA6G105700 [Arabis alpina]
Length=353

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 131/208 (63%), Gaps = 16/208 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+  D+I P  EEP+  V    V     EKQ G+++  DAKK++
Sbjct  154  GRGNDLKREGGGRGNWGTTEDDIPPATEEPMTEVEKSPVTA---EKQEGEDETTDAKKET  210

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P      +E E+K+MTL+EYEK+ EEK+KA+  ++ EERKV   K FESM  L+NKK+++
Sbjct  211  PA-----EEEEEKQMTLEEYEKIQEEKKKAMQGAKVEERKVDT-KVFESMQQLSNKKSNE  264

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            E+F+KLGSEK     E  EK +K+ SINEFLKPA+GE+Y   GG     G   GRGG   
Sbjct  265  EIFIKLGSEKRKDATEKEEKARKSLSINEFLKPADGESYNPRGGYRGRGGGRGGRGGQRD  324

Query  227  NNTSSFE-------TPSIEDVGQFPTLG  165
               +           P+I D  QFPTLG
Sbjct  325  GRGNGGGNQRFGGAAPAIGDNAQFPTLG  352



>ref|XP_010104826.1| hypothetical protein L484_024026 [Morus notabilis]
 gb|EXC02062.1| hypothetical protein L484_024026 [Morus notabilis]
Length=463

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 149/200 (75%), Gaps = 8/200 (4%)
 Frame = -1

Query  758  SEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLd  579
            +E+KREGSGRGNWG+PTDEIAPE EEP+        N DA  ++ G E+A DA K+ P  
Sbjct  196  NELKREGSGRGNWGTPTDEIAPEVEEPVVENEK---NVDA--EKLGDEEASDANKEKPEK  250

Query  578  epevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVF  399
            E E KEPEDKEMTL+EYEK+LEEKRKA+LA + EERKV   KEFESM  L++KK +DE+F
Sbjct  251  EAEEKEPEDKEMTLEEYEKVLEEKRKALLALKTEERKVD-SKEFESMQQLSSKKGNDEIF  309

Query  398  VKLGSe--kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN  225
            +KLGSE  K  +  E  EK KK+ SINEFLKPAEGE YY PGGRGRGRG GS  G  GG 
Sbjct  310  IKLGSEKDKRKEAAEKEEKAKKSLSINEFLKPAEGERYYTPGGRGRGRGRGSRGGYGGGY  369

Query  224  NTSSFETPSIEDVGQFPTLG  165
            ++S+   PSIED GQFPTLG
Sbjct  370  SSSNVAAPSIEDPGQFPTLG  389



>ref|XP_011017364.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
 ref|XP_011017365.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Populus euphratica]
Length=359

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 138/203 (68%), Gaps = 8/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREG+GRGNWG+ TDE+A   EE    V N+G      EK    E A D  K++
Sbjct  165  GRGNEMKREGAGRGNWGTQTDELAEITEE----VGNEGDKNLGDEKPV-TEAAADGNKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EP  KEPE+KEMTL+EYEK+LEEKRKA+LA + EERKV   KEF+SM  +++KK ++
Sbjct  220  LDNEPGEKEPEEKEMTLEEYEKVLEEKRKALLALKTEERKVDA-KEFQSMQQISSKKENN  278

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            +VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  Y+  G          RG    
Sbjct  279  DVFIKLGS-DKDKRKEASEKAKKSVSINEFLKPAEGE-RYQGSGGRGRGRGRGARGFGNR  336

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
            +  S+   PSIED GQFPTLG K
Sbjct  337  DGISNVPAPSIEDPGQFPTLGGK  359



>ref|XP_007139646.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
 gb|ESW11640.1| hypothetical protein PHAVU_008G047300g [Phaseolus vulgaris]
Length=365

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 144/205 (70%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREG+GRGNWG+  D+I    EE    VVN+    +  +++   E+  D  KDS
Sbjct  167  GRGNEFKREGAGRGNWGTQNDDITETTEE----VVNE-TEKNLGDEKPAVEEVADGNKDS  221

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEE+RKA  A + E RKV   KEFE+M  L++KK + 
Sbjct  222  PANETEEKEPEDKEMTLEEYEKVLEERRKAFQALKTEGRKVDA-KEFETMQPLSSKKTNH  280

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGS+K+ +K+     EK KK+ SI EFLKPAEGETYY PGGRGRGRG    RGGY
Sbjct  281  DIFIKLGSDKDKRKEALEKEEKSKKSVSITEFLKPAEGETYYNPGGRGRGRGGRGSRGGY  340

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G  T++   PSIED G FPTLG+K
Sbjct  341  RGGATNNAPAPSIEDPGHFPTLGAK  365



>ref|XP_010918620.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Elaeis guineensis]
Length=369

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 138/217 (64%), Gaps = 23/217 (11%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD----AFEKQHGQEDA---  609
            GRG E+KREG+GR NWG+ TD++       I    ++ VN D    A EKQ  Q++A   
Sbjct  159  GRGYEMKREGAGRANWGTATDDV-------IAQATDENVNADDKIPASEKQPEQDNAPSS  211

Query  608  -GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMAL  432
              + +KD   +E E KEP+DKEMTL+EYEK+ EEKRKA+LA + EERKV +DKE +SM  
Sbjct  212  EANKEKDVQANEAEEKEPDDKEMTLEEYEKIREEKRKALLAMKTEERKVEIDKELQSMQQ  271

Query  431  LANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGE---Tyyrpggr  273
            L+ KK +D+VF+KLGS+    K+    +  E+ KK  SINEFLKPAEGE   +    G  
Sbjct  272  LSLKKGNDDVFIKLGSDKDMGKKKDVADRDERAKKPVSINEFLKPAEGERYYSPVGRGRG  331

Query  272  grgrghgsgrggygGNNTSSFET-PSIEDVGQFPTLG  165
                  G  RGG+GG  TS+  T PSIED GQFPTLG
Sbjct  332  RGRGDRGPFRGGFGGRGTSTPATAPSIEDPGQFPTLG  368



>ref|XP_008459799.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=361

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 135/205 (66%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG  TDE A  AEE     VN+       EK   + D   A  D 
Sbjct  163  GRGNEFKREGSGRGNWGRSTDEFAEVAEE----TVNETEKNVGDEKPIQENDTSGANTDD  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  EPE  EPEDKEMTL+EYEKLLE+KRK++LA + EERKV   KEF SM  L++KK+++
Sbjct  219  PAKEPEETEPEDKEMTLEEYEKLLEDKRKSLLALKTEERKVD-PKEFASMQQLSSKKDNN  277

Query  407  EVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSEK+ +K   +  E+ KK+ SINEFL+PAEGE  +   G          RGGY
Sbjct  278  DIFIKLGSEKDKRKEIADKEERTKKSLSINEFLRPAEGE-RHYTPGGRGRGRGRGSRGGY  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G++ S+   PSIED GQFP LG+K
Sbjct  337  SGSSMSNVAAPSIEDPGQFPILGAK  361



>gb|AES80534.2| nuclear RNA-binding-like protein [Medicago truncatula]
Length=583

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 141/205 (69%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG++ KREG+GRGNWG+ TDEIA   EE    V+N+G      EK   + D  +  KDS
Sbjct  178  GRGNDFKREGAGRGNWGTETDEIAQVTEE----VMNEGEKNLGDEKPAVEADVAEGNKDS  233

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEEKRKA+   + EERKV   K FE+M  L+ KK++ 
Sbjct  234  PANEAEEKEPEDKEMTLEEYEKVLEEKRKALQTLKTEERKVDT-KAFETMQALSCKKDNT  292

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F KLG++K+ +K+   +  K KK+ SINEFLKPAEGE++Y  GGRGRGRG    RGG 
Sbjct  293  EIFAKLGADKDKRKEAYDKEEKAKKSVSINEFLKPAEGESHYNSGGRGRGRGGRGARGGG  352

Query  233  gGNNT-SSFETPSIEDVGQFPTLGS  162
               N+ S+   PSIED G FPTL +
Sbjct  353  FRGNSYSNVPAPSIEDPGHFPTLAT  377



>ref|XP_003624316.1| Transcription factor [Medicago truncatula]
Length=625

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 141/204 (69%), Gaps = 8/204 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG++ KREG+GRGNWG+ TDEIA   EE    V+N+G      EK   + D  +  KDS
Sbjct  178  GRGNDFKREGAGRGNWGTETDEIAQVTEE----VMNEGEKNLGDEKPAVEADVAEGNKDS  233

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEK+LEEKRKA+   + EERKV   K FE+M  L+ KK++ 
Sbjct  234  PANEAEEKEPEDKEMTLEEYEKVLEEKRKALQTLKTEERKVDT-KAFETMQALSCKKDNT  292

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F KLG++K+ +K+   +  K KK+ SINEFLKPAEGE++Y  GGRGRGRG    RGG 
Sbjct  293  EIFAKLGADKDKRKEAYDKEEKAKKSVSINEFLKPAEGESHYNSGGRGRGRGGRGARGGG  352

Query  233  gGNNT-SSFETPSIEDVGQFPTLG  165
               N+ S+   PSIED G FPTLG
Sbjct  353  FRGNSYSNVPAPSIEDPGHFPTLG  376



>ref|XP_010531670.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Tarenaya 
hassleriana]
Length=359

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 140/205 (68%), Gaps = 10/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE KREGSGRGNWG+P +E+  E EE         V     EK  G ++A DA K++
Sbjct  158  GRGSEFKREGSGRGNWGTPGEELVAETEETGVETEKKVV-----EKPAGDDEAADANKET  212

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVCLDKEFESMALLANKKN  414
            P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LAS   ERKV L KEFESM  L+NKK 
Sbjct  213  PAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVDL-KEFESMQQLSNKKA  271

Query  413  DDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrg  240
            +DE+F+KLGS+K+ +K      EK KK+ SINEFLKPAEGE YY  GGRGRGRG G G  
Sbjct  272  NDEIFIKLGSDKDKRKDALDKEEKAKKSVSINEFLKPAEGEGYYPRGGRGRGRGRGGGSR  331

Query  239  gygGNNTSSFETPSIEDVGQFPTLG  165
            G G     +   P+IED  QFP+LG
Sbjct  332  GGGYGGYQNKAAPAIEDTAQFPSLG  356



>gb|AFK43517.1| unknown [Lotus japonicus]
Length=370

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 137/207 (66%), Gaps = 10/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS  KREG+GRGNWG+ +DEIA   +E    V N+    +  +++   ED  D  K+S
Sbjct  170  GRGSGFKREGAGRGNWGTQSDEIAQVTDE----VANE-TEKNLSDEKPAVEDVADGNKES  224

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV + KEFESM  L+ KK+++
Sbjct  225  SANENEEKEPEDKEMTLEEYEKVLEEKRKALQAQKTEGRKVDI-KEFESMQPLSCKKDNN  283

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETy--yrpggrgrgrghgsgrg  240
            ++F KLGS+K+ +K+     EK KK+ SINEFLKPAEGETY     G        G G G
Sbjct  284  DIFAKLGSDKDKRKEAFEKEEKAKKSVSINEFLKPAEGETYYPSGRGRGRGRGSRGGGGG  343

Query  239  gygGNNTSSFETPSIEDVGQFPTLGSK  159
             + GN TS+   PSIED G FPTLG K
Sbjct  344  SFRGNATSNAPAPSIEDPGHFPTLGGK  370



>emb|CDY40563.1| BnaC02g33290D [Brassica napus]
Length=330

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 139/205 (68%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+P D+I P  EE    V    V     EK+ G++D  DAKKD+
Sbjct  130  GRGNDLKREGGGRGNWGTPEDDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDT  185

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N+
Sbjct  186  PADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNN  244

Query  410  DEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA+GE Y   GG  RGRG  +G  G
Sbjct  245  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPADGERYNPRGGGYRGRGGRNGGRG  304

Query  236  ygGNNTS-SFETPSIEDVGQFPTLG  165
                  +     P+I D  QFP+LG
Sbjct  305  QRDEKVNEGAPAPAIGDSAQFPSLG  329



>gb|KJB37649.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=307

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 99/128 (77%), Gaps = 5/128 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGSPTD IAPE EE     V +     + EKQ G+EDA DA K++
Sbjct  161  GRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D
Sbjct  217  AANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSND  275

Query  407  EVFVKLGS  384
            ++F+KLGS
Sbjct  276  DIFIKLGS  283



>ref|XP_008798813.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Phoenix dactylifera]
Length=373

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 137/207 (66%), Gaps = 9/207 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRGS IKREGSGRGNWG+PTD+    + EE IN V    +     EK  G+ED     K+
Sbjct  168  GRGSGIKREGSGRGNWGTPTDQGQVKKPEEFINSV---NMYAKFEEKPVGEEDGVAVDKE  224

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKN  414
            +   E + KEPEDKEMTLDEYEKLLEEKRKA+ A  + EERKV +DKEFE M  L+ KKN
Sbjct  225  NAPGETKEKEPEDKEMTLDEYEKLLEEKRKALQALQKIEERKVDVDKEFEFMQQLSAKKN  284

Query  413  DDEVFVKLGSekedkkkeagekvkktKS----INEFLKPAEGETyyrpggrgrgrghgsg  246
            +D+VF+KLGSE+E  ++      + +      IN FL+PAE E +Y PGGRGRGRG    
Sbjct  285  NDDVFIKLGSERESARRRDAADREDSARRPAIINTFLRPAEEERHYNPGGRGRGRGGRGA  344

Query  245  rggygGNNTSSFETPSIEDVGQFPTLG  165
            RGG+G   T +   PSIED G FPTLG
Sbjct  345  RGGFGRTGTMNTPPPSIEDPGHFPTLG  371



>gb|ABD65038.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 138/205 (67%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+P D+I P  EE    V    V     EK+ G++D  DAKKD 
Sbjct  136  GRGNDLKREGGGRGNWGTPEDDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDP  191

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N+
Sbjct  192  PADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNN  250

Query  410  DEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA+GE Y   GG  RGRG  +G  G
Sbjct  251  EEIFIKLGSDKDKRKDAAEKEEKAKKSFSINEFLKPADGERYNPRGGGYRGRGGRNGGRG  310

Query  236  ygGNNTS-SFETPSIEDVGQFPTLG  165
                  +     P+I D  QFP+LG
Sbjct  311  QRDEKVNEGAPAPAIGDSAQFPSLG  335



>ref|XP_008810382.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Phoenix dactylifera]
Length=373

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 136/215 (63%), Gaps = 18/215 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEA-EEPINGVVNDGVNTDAFEKQHGQEDA----GD  603
            GRG E+KREGSGRGNWG+ TD++  +A EE +N  V+D +   A EKQ   +D      +
Sbjct  162  GRGYEMKREGSGRGNWGTATDDVIAQATEENVN--VDDKIL--ASEKQPEHDDVPSSEAN  217

Query  602  AKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
              KD+  +E E KEPEDKEMTL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L+ 
Sbjct  218  KDKDAQANEAEEKEPEDKEMTLEEYEKIREEKRKALLALKTEERKVEIDQELQSMQQLSL  277

Query  422  KKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGE-----Tyyrpggrg  270
            KK +D+VF+KLGS+    K+    +  E+ KK  SINEFLKPAEGE          G   
Sbjct  278  KKRNDDVFMKLGSDKDTGKKKDVADRDERAKKPVSINEFLKPAEGERYYSPVGRGRGRAR  337

Query  269  rgrghgsgrggygGNNTSSFETPSIEDVGQFPTLG  165
              RG   G  G G  + +    PSIED GQFPTLG
Sbjct  338  GDRGQFRGGFGGGRGSGAPATAPSIEDPGQFPTLG  372



>ref|XP_002301233.2| transcription factor family protein [Populus trichocarpa]
 gb|ABK94212.1| unknown [Populus trichocarpa]
 gb|EEE80506.2| transcription factor family protein [Populus trichocarpa]
Length=359

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 136/203 (67%), Gaps = 8/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G G+E+KREG+GRGNWG+ TDE+A   EE    V N+G      EK    E A D  K++
Sbjct  165  GHGNEMKREGAGRGNWGTQTDELAEITEE----VGNEGDKNLGDEKPV-TEAAADGNKEN  219

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EP  KEPE+KEMTL+EYEK+LEEKRKA+LA + EERKV   +EF+SM  +++KK ++
Sbjct  220  LDNEPGEKEPEEKEMTLEEYEKVLEEKRKALLALKTEERKVDT-REFQSMQQISSKKENN  278

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            +VF+KLGS  +DK+KEA EK KK+ SINEFLKPAEGE  Y   G          RG    
Sbjct  279  DVFIKLGS-DKDKRKEASEKAKKSVSINEFLKPAEGE-RYHGSGGRGRGRGRGARGFGNR  336

Query  227  NNTSSFETPSIEDVGQFPTLGSK  159
            +  S+   PSIED GQFPTLG K
Sbjct  337  DGISNVPAPSIEDPGQFPTLGGK  359



>ref|XP_006644341.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=370

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 143/209 (68%), Gaps = 6/209 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG E KREG+GRGNWG+ TDE +A E+ E +N  V   V  D  +++   +   + +K+
Sbjct  162  GRGYETKREGAGRGNWGTVTDESLAQESGEVVNIEVAAAVTEDETKQEDVPQSEVEKRKE  221

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ 
Sbjct  222  GESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVVVDKELQSMQQLSVKKDS  281

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            DEVF+KLGS+K+ KK+      + +K+ SINEFLKPAEGE YY PGGRGRGRG G G  G
Sbjct  282  DEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRG  341

Query  236  ygGNNTSS---FETPSIEDVGQFPTLGSK  159
               +  SS      P+IED  QFP+L  K
Sbjct  342  GFRDGYSSRGPVAAPAIEDQAQFPSLAGK  370



>ref|XP_007142624.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
 gb|ESW14618.1| hypothetical protein PHAVU_007G003500g [Phaseolus vulgaris]
Length=358

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 138/207 (67%), Gaps = 10/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED-AGDAKKD  591
            GRG+E+KREG GRGNWG  TDE+    +E     +N+     +  K  G++D A D  K+
Sbjct  158  GRGNELKREGYGRGNWGLQTDELGQATDE-----INETAKNFSEVKPSGEDDVAADGNKE  212

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P +E E KEPEDKEMTL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK++
Sbjct  213  NPANEAEEKEPEDKEMTLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDN  271

Query  410  DEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGET-yyrpggrgrgrghgsgrg  240
             ++F+KLGSEK+ +K+     EK KK+ SINEFLKP EGE+ Y   G           RG
Sbjct  272  FDIFIKLGSEKDKRKETLEKEEKAKKSVSINEFLKPPEGESFYSAGGRGRGRGRGRGARG  331

Query  239  gygGNNTSSFETPSIEDVGQFPTLGSK  159
            G+GG  T++   PSIED GQFPTLG K
Sbjct  332  GFGGYATANVTAPSIEDPGQFPTLGVK  358



>gb|EAY75654.1| hypothetical protein OsI_03559 [Oryza sativa Indica Group]
Length=332

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 142/212 (67%), Gaps = 15/212 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDA--FEKQHGQEDAGDAK  597
            GRG E+KR+G+GRGNWG+ TDE +A E EE +       V   A   EKQ  Q+DA   +
Sbjct  124  GRGYEMKRDGAGRGNWGTATDEALAQETEEALK------VEESAPIAEKQGEQDDAPTGE  177

Query  596  KDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            KDS       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV +DK+ +SM  L+ 
Sbjct  178  KDSKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVEVDKDLQSMQPLST  237

Query  422  KKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgs  249
            KK +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRGRG   
Sbjct  238  KKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  297

Query  248  grggygGNNTSSFET--PSIEDVGQFPTLGSK  159
            GRG  GG     + T  PSIED  QFPTLG K
Sbjct  298  GRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>ref|XP_009128949.1| PREDICTED: suppressor protein STM1-like [Brassica rapa]
Length=337

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 119/160 (74%), Gaps = 8/160 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+P D+I P  EE    V    V     EK+ G++D  DAKKD+
Sbjct  130  GRGNDLKREGGGRGNWGTPEDDIPPPTEEATTEVEKSPV----AEKEGGEDDTTDAKKDA  185

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N+
Sbjct  186  PADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNN  244

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGE  297
            +E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA+GE
Sbjct  245  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPADGE  284



>ref|XP_004961407.1| PREDICTED: RNA-binding protein FUS-like [Setaria italica]
Length=374

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 138/214 (64%), Gaps = 18/214 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD----AFEKQHGQEDAGDA  600
            GRG E+KREG+GRGNWG+ TDEI       I+    +G+  D      EKQ   EDA  A
Sbjct  168  GRGYEMKREGAGRGNWGTTTDEI-------ISQETEEGLKLDEKAPVPEKQGALEDAPQA  220

Query  599  K--KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
            +  KDS     E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERKV +DK+ +SM  L+
Sbjct  221  EENKDSKDANAEEEKEEDKEMTLEEFEKIREEKRKALLALKTEERKVEVDKDLQSMQPLS  280

Query  425  NKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrg  258
            NKK +DE+FVKLGS+    K+ +  E  E+ KK+ SINEFLKPAEGE +Y   GRGRGRG
Sbjct  281  NKKENDEIFVKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERFYGGRGRGRGRG  340

Query  257  hgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  159
               G  G  G    +    P+I+D  QFP+LG K
Sbjct  341  DRGGFRGGYGGGYRAPPAAPAIQDQSQFPSLGGK  374



>gb|ABD64914.1| nuclear RNA binding protein, putative [Brassica oleracea]
Length=336

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 134/210 (64%), Gaps = 16/210 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR +++KREG GRGNWG+P D+I P  EEP   V    V     EK+ G++   DAKK++
Sbjct  135  GRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEA  190

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND
Sbjct  191  P---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSND  246

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA GETY   GG     G G   G 
Sbjct  247  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPANGETYNPRGGYRGRGGRGQRDGK  306

Query  236  -----ygGNNTSSFETPSIEDVGQFPTLGS  162
                    N  +S   P+I D  QFP+L S
Sbjct  307  VNGGGNQRNGGASAPAPAIGDSAQFPSLAS  336



>ref|XP_010531669.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Tarenaya hassleriana]
Length=359

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 138/205 (67%), Gaps = 10/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE KREGSGRGNWG+P +E+  E EE         V     EK  G ++A DA K++
Sbjct  158  GRGSEFKREGSGRGNWGTPGEELVAETEETGVETEKKVV-----EKPAGDDEAADANKET  212

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAI--LASRPEERKVCLDKEFESMALLANKKN  414
            P +  E KEPEDKEMTLDEYEK+LEEKRKA+  LAS   ERKV L KEFESM  L+NKK 
Sbjct  213  PAEAEEEKEPEDKEMTLDEYEKILEEKRKALQSLASSDFERKVDL-KEFESMQQLSNKKA  271

Query  413  DDEVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrg  240
            +DE F+KLGS+K+ +K      EK KK  SINEFLKPA+GE YY  GGRGRGRG G G  
Sbjct  272  NDEFFIKLGSDKDKRKDALDKEEKAKKAVSINEFLKPADGEGYYPRGGRGRGRGRGGGSR  331

Query  239  gygGNNTSSFETPSIEDVGQFPTLG  165
            G G     +   P+IED  QFP+LG
Sbjct  332  GGGYGGYQNKAAPAIEDTAQFPSLG  356



>ref|XP_009395730.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like [Musa 
acuminata subsp. malaccensis]
Length=381

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 135/216 (63%), Gaps = 17/216 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQED--AGDAK  597
            GRG E+KR G+GRGNWGS TDE I  E EE    ++N G  T A EKQ   E+  + D  
Sbjct  170  GRGYEMKRNGAGRGNWGSATDESILQENEE----IINVGDKTVATEKQVEPEEVPSSDVN  225

Query  596  KDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            K++         ++ EDKEMTL+EYEK+ EEKRKA+ A + EERKV +DK+ +SM  L+ 
Sbjct  226  KENKEGAANDAEEKEEDKEMTLEEYEKVREEKRKALAAMKSEERKVEMDKDLQSMKQLSL  285

Query  422  KKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAEGE--Tyyrpggrgrgr  261
            KK +D++FVKLGS+K+  KK+       + KK  SINEFLKPAEGE        GRGRGR
Sbjct  286  KKENDDIFVKLGSDKDTGKKKENTDRDERNKKPMSINEFLKPAEGERYYNSGGRGRGRGR  345

Query  260  ghgsgrggygGNNTSSFET--PSIEDVGQFPTLGSK  159
            G      G      S+F T  PSIED GQFPTLG K
Sbjct  346  GGRGQFRGGFMGGVSTFTTDAPSIEDPGQFPTLGGK  381



>ref|XP_006280739.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
 gb|EOA13637.1| hypothetical protein CARUB_v10026708mg [Capsella rubella]
Length=346

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 135/203 (67%), Gaps = 9/203 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS++KREG GRGNWG+  D+IAP  EE    V      + A EKQ G ED  DA K++
Sbjct  150  GRGSDLKREGGGRGNWGTTEDDIAPATEEATTEVEK----SPAAEKQGG-EDETDASKEA  204

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN-D  411
               E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKKN +
Sbjct  205  AAAEQAQKEAEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKNTE  263

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            +E+FVKLGS ++DK+K+A EK KK+ SINEFLKPA+GETY   GG     G G      G
Sbjct  264  EEIFVKLGS-EKDKRKDAAEKAKKSLSINEFLKPAKGETYNPRGGNRGRGGRGGREQRGG  322

Query  230  GNNTSS-FETPSIEDVGQFPTLG  165
            GN +      P I D  QFP+LG
Sbjct  323  GNQSHREAAAPVIGDTAQFPSLG  345



>dbj|BAE71297.1| hypothetical protein [Trifolium pratense]
Length=371

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 134/202 (66%), Gaps = 11/202 (5%)
 Frame = -1

Query  752  IKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA-GDAKKDSPLde  576
             KREG+GRGNWG+ +DEIA   EE    V N+     A EK  G EDA  +  KD+P +E
Sbjct  172  FKREGAGRGNWGTQSDEIAQVTEE----VSNEPEKNVAEEKPAGGEDATAEGNKDAPANE  227

Query  575  pevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFV  396
             E KEPEDKEMTL+EYEK+LEEKRKA+ A + E RKV   KEFESM  L+ KK +DE+F 
Sbjct  228  AEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEGRKVDT-KEFESMKPLSCKKENDEIFA  286

Query  395  KLGSekedkkke-agekvkktKSINEFLKPAEGE----Tyyrpggrgrgrghgsgrggyg  231
            KLGS+K+ +K     EK KK  SINEFLKPAEGE       R G  GRG   GS  GGYG
Sbjct  287  KLGSDKDKRKDAFEKEKAKKALSINEFLKPAEGEKYYNPGGRGGRGGRGGRGGSRGGGYG  346

Query  230  GNNTSSFETPSIEDVGQFPTLG  165
            GN  S+   PSIED GQFPTLG
Sbjct  347  GNAYSNVPAPSIEDPGQFPTLG  368



>emb|CDY43435.1| BnaAnng07070D [Brassica napus]
Length=339

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 136/214 (64%), Gaps = 20/214 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR +++KREG GRGNWG+P D+I P  EEP   V    V     EK+ G++   DAKK++
Sbjct  134  GRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEA  189

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND
Sbjct  190  P---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTND  245

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA GETY   GG     G   GRG 
Sbjct  246  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPANGETYNPRGGYRGRGGRSGGRGQ  305

Query  236  ygGN---------NTSSFETPSIEDVGQFPTLGS  162
              G            +S   P+I D  QFP+LG+
Sbjct  306  RDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLGN  339



>ref|XP_009101440.1| PREDICTED: suppressor protein STM1 [Brassica rapa]
Length=333

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 132/207 (64%), Gaps = 11/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR +++KREG GRGNWG+  D+I P   EP   V    V     E   G++D  DAKKDS
Sbjct  131  GRSNDVKREGGGRGNWGTTEDDIPPPTVEPTTEVEKSPV----AENDGGEDDTTDAKKDS  186

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P  E E KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK N+
Sbjct  187  PAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTNN  245

Query  410  DEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA+GE Y  P G  RGRG   G  G
Sbjct  246  EEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKPADGERYNNPRGGYRGRGGRGGGRG  305

Query  236  ygGNNTSSF---ETPSIEDVGQFPTLG  165
                          P+I D  QFP+LG
Sbjct  306  QRDGGNQRHGGAPAPAIGDSAQFPSLG  332



>ref|XP_003556572.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
[Glycine max]
Length=332

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 137/207 (66%), Gaps = 10/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED-AGDAKKD  591
            GRG+E KREG+GRGNWG  TDE A   +E     VN+       EK  G++D A    K+
Sbjct  132  GRGNEFKREGAGRGNWGVQTDEFAQATDE-----VNETSKNFGDEKPSGEDDVAAIGNKE  186

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +P +E E KEPEDKEMTL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK+ 
Sbjct  187  NPANEAEEKEPEDKEMTLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDI  245

Query  410  DEVFVKLGSekedkkkeagekvkktKS--INEFLKPAEGETyyr-pggrgrgrghgsgrg  240
            D++F+KLGS+K+ +++   ++ K  KS  INEFLK  EGE+YY   G   R       RG
Sbjct  246  DDIFIKLGSDKDKRRETLEKEDKSKKSVNINEFLKSPEGESYYNPGGHGRRHGRGRGARG  305

Query  239  gygGNNTSSFETPSIEDVGQFPTLGSK  159
            GYGG  T++   PSIED GQFPTLG K
Sbjct  306  GYGGYATANIPAPSIEDPGQFPTLGVK  332



>emb|CDY67886.1| BnaCnng56800D [Brassica napus]
Length=361

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 135/210 (64%), Gaps = 16/210 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR +++KREG GRGNWG+P D+I P  EEP   V    V     EK+ G++   DAKK++
Sbjct  160  GRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSPVA----EKEGGEDATTDAKKEA  215

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND
Sbjct  216  P---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKSND  271

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETy-----yrpggrgrgrghg  252
            +E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA GETY     YR  G    R   
Sbjct  272  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPANGETYNPRGGYRGRGGRGQRDGK  331

Query  251  sgrggygGNNTSSFETPSIEDVGQFPTLGS  162
               GG   N  +S   P+I D  QFP+L S
Sbjct  332  VNGGGNQRNGGASAPAPAIGDSAQFPSLAS  361



>ref|XP_009114287.1| PREDICTED: uncharacterized protein LOC103839539 [Brassica rapa]
Length=343

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 136/214 (64%), Gaps = 20/214 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR +++KREG GRGNWG+P D+I P  EEP   V    V     EK+ G++   DAKK++
Sbjct  138  GRSNDVKREGGGRGNWGTPEDDIQPATEEPTTEVEKSPV----AEKEGGEDATTDAKKEA  193

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P      +EPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND
Sbjct  194  P---EVEQEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KAFESMQQLSNKKTND  249

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K   E  EK KK+ SIN+FLKPA GETY   GG     G   GRG 
Sbjct  250  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINQFLKPANGETYNPRGGYRGRGGRSGGRGQ  309

Query  236  ygGN---------NTSSFETPSIEDVGQFPTLGS  162
              G            +S   P+I D  QFP+LG+
Sbjct  310  RDGKVNGGGNQRNGGASAPAPAIGDSAQFPSLGN  343



>gb|KJB37650.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=284

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KR+GSGRGNWGSPTD IAPE EE     V +     + EKQ G+EDA DA K++
Sbjct  161  GRGNEFKRDGSGRGNWGSPTDGIAPETEE----NVPENEKNVSIEKQSGEEDAMDAGKEN  216

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D
Sbjct  217  AANEAEEKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSND  275

Query  407  EVFVKL  390
            ++F+KL
Sbjct  276  DIFIKL  281



>gb|EAZ13376.1| hypothetical protein OsJ_03294 [Oryza sativa Japonica Group]
Length=332

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 142/212 (67%), Gaps = 15/212 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDA--FEKQHGQEDAGDAK  597
            GRG E+KR+G+GRGNWG+ TDE +A E EE +       V   A   EKQ  Q+DA   +
Sbjct  124  GRGYEMKRDGAGRGNWGTATDEALAQETEEALK------VEESAPIAEKQGEQDDAPTGE  177

Query  596  KDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            KD+       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV +DK+ +SM  L+ 
Sbjct  178  KDNKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVEVDKDLQSMQPLST  237

Query  422  KKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgs  249
            KK +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRGRG   
Sbjct  238  KKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  297

Query  248  grggygGNNTSSFET--PSIEDVGQFPTLGSK  159
            GRG  GG     + T  PSIED  QFPTLG K
Sbjct  298  GRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  329



>ref|XP_010919739.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Elaeis guineensis]
Length=376

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 131/208 (63%), Gaps = 11/208 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTD-EIAPEAEEPINGVVNDGVNTDAFEKQH-GQEDAGDAKK  594
            GRGS IKREGSGRGNWG+ TD E   + EE     +N G     FE+   G+ED     K
Sbjct  171  GRGSGIKREGSGRGNWGTLTDQEQVKKPEE----FINRGNMHAKFEENPVGEEDGVAVDK  226

Query  593  DSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKK  417
            ++   E E KEPEDKEMTLDEYEKLLEEKRKA+ A  R EERKV +DKEFE M  L+ KK
Sbjct  227  ENAPAEIEEKEPEDKEMTLDEYEKLLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKK  286

Query  416  NDDEVFVKLGSekedkkkeagekvkktKS----INEFLKPAEGETyyrpggrgrgrghgs  249
            NDD+VF+KLGSE++  ++      +        IN FL+PAE E  + PGGRGRGRG   
Sbjct  287  NDDDVFIKLGSERDSARRRDTADREDLTRRPAIINTFLRPAEEERQHNPGGRGRGRGGRD  346

Query  248  grggygGNNTSSFETPSIEDVGQFPTLG  165
            G  G G     +   PSIED G FPTLG
Sbjct  347  GGIGSGRTGAMNTTPPSIEDPGHFPTLG  374



>ref|XP_004140509.1| PREDICTED: uncharacterized protein LOC101209927 [Cucumis sativus]
 ref|XP_004166646.1| PREDICTED: uncharacterized LOC101209927 [Cucumis sativus]
 gb|KGN46515.1| hypothetical protein Csa_6G106180 [Cucumis sativus]
Length=361

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 134/205 (65%), Gaps = 8/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG  TDE A  A E     VN+       EK   ++D      ++
Sbjct  163  GRGNEFKREGSGRGNWGRSTDEFAEVAGE----TVNETEKNVGDEKPIQEDDTSGVNTEN  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  EP+  EPEDKEMTL+EYEKLLE+KRKA+LA + EERKV   KEF SM  L++KK+++
Sbjct  219  PAKEPQETEPEDKEMTLEEYEKLLEDKRKALLALKTEERKVD-PKEFASMQQLSSKKDNN  277

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGSEK+ +K+ A ++ +  K  SINEFL+PA+GE  +   G          RGGY
Sbjct  278  DIFIKLGSEKDKRKEMADKEERTKKSLSINEFLRPADGE-RHYAPGGRGRGRGRGSRGGY  336

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             G+  S+   PSI D GQFPTLG+K
Sbjct  337  SGSPMSNVAAPSIGDPGQFPTLGAK  361



>ref|XP_002870130.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46389.1| hypothetical protein ARALYDRAFT_493188 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 137/208 (66%), Gaps = 14/208 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNT--DAFEKQHGQEDAGDAKK  594
            GRGS+ KR+GSGRGNWG+P +E+A E E         GV+T  D  EK    + A DA K
Sbjct  160  GRGSDFKRDGSGRGNWGTPGEELAAETEAVA------GVDTEKDVGEKLAVDDVAADANK  213

Query  593  DSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN  414
            ++ +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK+
Sbjct  214  ENTV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLATSERKVDT-KVFESMQQLSNKKS  270

Query  413  DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            +DE+F+KLGS+K+ +K E  EK KK  SINEFLKPAEGE YYR GGRG     G GRGG 
Sbjct  271  NDEIFIKLGSDKDKRKDEKEEKAKKAVSINEFLKPAEGENYYRGGGRGGRGRGGRGRGGV  330

Query  233  gGNNTSSFE---TPSIEDVGQFPTLGSK  159
                +  +     P+I D  QFP+LG K
Sbjct  331  SSGESGGYRNEAAPAIGDAAQFPSLGGK  358



>ref|XP_002870099.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46358.1| hypothetical protein ARALYDRAFT_493124 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 116/155 (75%), Gaps = 6/155 (4%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E+KR+G+GRGNWG+  D+IAP  EE  + VV+  +     EKQ G+ +A DA K++P 
Sbjct  150  GNEVKRDGAGRGNWGTTQDDIAPVTEE-TSAVVDKNL---TVEKQGGEGEATDANKETPA  205

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            +    ++PEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DE
Sbjct  206  EVQAEEKPEDKEMTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDE  264

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEG  300
            VF+KLG+EK+ +  E  EK +K+ SINEFLKPA+G
Sbjct  265  VFIKLGTEKDKRVTEREEKTRKSLSINEFLKPADG  299



>gb|KJB22277.1| hypothetical protein B456_004G038700 [Gossypium raimondii]
Length=366

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 137/213 (64%), Gaps = 15/213 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG++++REG GRGNWG+ T+E+A   EE    V N+G      EK     D GDA K+S
Sbjct  159  GRGNKLEREGFGRGNWGTQTNELARVTEE----VANEGNQNLGDEKLARDGDGGDADKES  214

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+K MTL+EYEKL+EEKRKA+ A + E RKV   KEFESM  L+NKK++D
Sbjct  215  LTNELEEKEPEEKVMTLEEYEKLMEEKRKALQALKTEGRKVDA-KEFESMQQLSNKKSND  273

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAE--------GETyyrpggrgrgrg  258
            E+F+KLGS+K+ +K+     E+ KK+ SINEFLKPAE        G    R  G+ +GRG
Sbjct  274  EIFIKLGSDKDKRKEAYEKEERAKKSLSINEFLKPAERKRYYNPSGRGRGRVQGQDQGRG  333

Query  257  hgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            H S   G G   +S    PSIED   FPTLG K
Sbjct  334  HSSRGFGGGNARSSMAAAPSIEDRSHFPTLGGK  366



>ref|NP_001044098.1| Os01g0721900 [Oryza sativa Japonica Group]
 dbj|BAB84432.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 dbj|BAF06012.1| Os01g0721900 [Oryza sativa Japonica Group]
Length=380

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 142/210 (68%), Gaps = 11/210 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG E+KR+G+GRGNWG+ TDE +A E EE +    +  +     EKQ  Q+DA   +KD
Sbjct  172  GRGYEMKRDGAGRGNWGTATDEALAQETEEALKVEESAPI----AEKQGEQDDAPTGEKD  227

Query  590  SP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
            +       E ++ EDKEMTL+E+EKL EEKRKA+LA + EERKV +DK+ +SM  L+ KK
Sbjct  228  NKEGAANEEEEKEEDKEMTLEEFEKLREEKRKALLAFKAEERKVEVDKDLQSMQPLSTKK  287

Query  416  NDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgr  243
             +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRGRG   GR
Sbjct  288  GNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGR  347

Query  242  ggygGNNTSSFET--PSIEDVGQFPTLGSK  159
            G  GG     + T  PSIED  QFPTLG K
Sbjct  348  GYGGGYQRGPYSTSAPSIEDQAQFPTLGGK  377



>ref|XP_010449600.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1 [Camelina 
sativa]
Length=387

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 114/158 (72%), Gaps = 6/158 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G GSE KR+G+GRGNWG+  D+IAP  +E     V   V  D   KQ G+ +A DA K++
Sbjct  152  GHGSEFKRDGAGRGNWGTTEDDIAPVTDEST-AAVEKNVTVD---KQGGEGEATDANKET  207

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P +E   KEPE+KEMTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+
Sbjct  208  PAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNN  266

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  297
            DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  267  DEVFIKLGTEKDKRVTEREEKTKKSLSINEFLKPANGE  304



>ref|XP_010434652.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=389

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 114/158 (72%), Gaps = 6/158 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G GSE KR+G+GRGNWG+  D+IAP  +E    V  +       EKQ G+ +A DA K++
Sbjct  155  GHGSEFKRDGAGRGNWGTTEDDIAPVTDESTAAVEKNVT----VEKQGGEGEATDANKET  210

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P +E   KEPE+KEMTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+
Sbjct  211  PAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNN  269

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  297
            DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  270  DEVFIKLGTEKDKRVMEREEKTKKSLSINEFLKPANGE  307



>ref|XP_010449710.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=263

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 133/208 (64%), Gaps = 15/208 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KR+GSGRGNWG+P +E+A E E         GV+T   EK  G++ A DA  + 
Sbjct  66   GRGGDFKRDGSGRGNWGTPGEELAAETEAVA------GVDT---EKAVGEKPAVDADANK  116

Query  587  P-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
                E E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +
Sbjct  117  ENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKAN  175

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GRGRG      G  
Sbjct  176  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGV  235

Query  230  GN----NTSSFETPSIEDVGQFPTLGSK  159
             N       +   P+IED  QFP+LG K
Sbjct  236  SNEEHVGYRNEAAPAIEDTAQFPSLGGK  263



>ref|XP_002458112.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
 gb|EES03232.1| hypothetical protein SORBIDRAFT_03g027110 [Sorghum bicolor]
Length=366

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 138/211 (65%), Gaps = 14/211 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG E+KREGSGRGNWG+ TDE +A EA      V  +G      E +  +    +A+K 
Sbjct  162  GRGYEMKREGSGRGNWGTVTDEALAQEA------VETEGTPVAEDENKLEEVPQSEAEKG  215

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +  E +EPEDKEMTL+EYEK+LEEKRKA+L  +PEERKV +DKE +SM  L+ KK  
Sbjct  216  KEGEPTEAEEPEDKEMTLEEYEKVLEEKRKALLGLKPEERKVEVDKELQSMQQLSVKKGA  275

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            DE+F+KLGS+K+ KK+      + KK+ SINEFLKPAEG+ YY PGGRGRGRG G G  G
Sbjct  276  DEIFIKLGSDKDKKKENTERDERAKKSVSINEFLKPAEGQRYYSPGGRGRGRGRGRGDRG  335

Query  236  ygGNNTSSFET-----PSIEDVGQFPTLGSK  159
                  S  E      P+I+D  QFP+LG K
Sbjct  336  GFRGGYSPREVAAAPAPAIQDQAQFPSLGGK  366



>ref|XP_008798814.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Phoenix dactylifera]
Length=372

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 136/207 (66%), Gaps = 10/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  IKREGSGRGNWG+PTD+    + EE IN V    +     EK  G+ED     K+
Sbjct  168  GRGG-IKREGSGRGNWGTPTDQGQVKKPEEFINSV---NMYAKFEEKPVGEEDGVAVDKE  223

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKN  414
            +   E + KEPEDKEMTLDEYEKLLEEKRKA+ A  + EERKV +DKEFE M  L+ KKN
Sbjct  224  NAPGETKEKEPEDKEMTLDEYEKLLEEKRKALQALQKIEERKVDVDKEFEFMQQLSAKKN  283

Query  413  DDEVFVKLGSekedkkkeagekvkktKS----INEFLKPAEGETyyrpggrgrgrghgsg  246
            +D+VF+KLGSE+E  ++      + +      IN FL+PAE E +Y PGGRGRGRG    
Sbjct  284  NDDVFIKLGSERESARRRDAADREDSARRPAIINTFLRPAEEERHYNPGGRGRGRGGRGA  343

Query  245  rggygGNNTSSFETPSIEDVGQFPTLG  165
            RGG+G   T +   PSIED G FPTLG
Sbjct  344  RGGFGRTGTMNTPPPSIEDPGHFPTLG  370



>gb|EPS72575.1| hypothetical protein M569_02184 [Genlisea aurea]
Length=362

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 131/208 (63%), Gaps = 16/208 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQE-----DAGD  603
            GRGSEIKREGSGRGNWGS  DE+AP     ++ VV++G      EK  G+E      A D
Sbjct  164  GRGSEIKREGSGRGNWGSQNDEVAP----VVDRVVDEGDKNQPTEKPSGEEPAAAAAAAD  219

Query  602  AKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
               ++  D  E KE  DKEMTL+EYEK+LEEKRK + + + EERKV   KEFE+M  L+N
Sbjct  220  GDGETVKDGGEEKEAGDKEMTLEEYEKVLEEKRKGLQSLKTEERKVDA-KEFEAMQQLSN  278

Query  422  KKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgs  249
            KK  D +F+KLGSEK+ KK   E  E+ KK+ SINEFLK  EGE           RG G 
Sbjct  279  KKTGDHIFIKLGSEKDRKKEVAEKEERAKKSVSINEFLKAGEGEK----YYNNPSRGRGR  334

Query  248  grggygGNNTSSFETPSIEDVGQFPTLG  165
            GRG  GG N    + PSIED G+FP+LG
Sbjct  335  GRGSRGGGNVGGVQAPSIEDPGEFPSLG  362



>ref|XP_006414296.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
 gb|ESQ55749.1| hypothetical protein EUTSA_v10025552mg [Eutrema salsugineum]
Length=359

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 136/209 (65%), Gaps = 11/209 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG + KREGSGRGNWG+P +E+ A E EE    V       +A EK  G + A DA K+
Sbjct  156  GRGGDFKREGSGRGNWGTPGEEVFAGETEE----VAGAETEKNAVEKPAGDDVAADANKE  211

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +  +  E KEPE+KEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++
Sbjct  212  NTAEAEEEKEPENKEMTLDEYEKILEEKKKALQSQTTSERKVDT-KVFESMQQLSNKKSN  270

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR GGRG     G GRG  G
Sbjct  271  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGGRGGRERGGRGRGRGG  330

Query  230  GNNTS-----SFETPSIEDVGQFPTLGSK  159
             ++       S   P I D  QFP+LG K
Sbjct  331  ASSGGFGGHRSEAAPVIGDTAQFPSLGGK  359



>ref|XP_004150996.1| PREDICTED: uncharacterized protein LOC101210473 [Cucumis sativus]
 ref|XP_004166647.1| PREDICTED: uncharacterized LOC101210473 [Cucumis sativus]
 gb|KGN46514.1| hypothetical protein Csa_6G105680 [Cucumis sativus]
Length=360

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 142/206 (69%), Gaps = 10/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E KREGSGRGNWG   +E  PE  E  N     G      EK   ++D      ++
Sbjct  162  GRGNEFKREGSGRGNWGRSAEEF-PEVAEEANESQKLGD-----EKPVHEDDTAGVNTEN  215

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E E KEPEDKEMTL+EYEKLL+EKRK++LA + EERKV   KEF S+  L++KK + 
Sbjct  216  PAKESEEKEPEDKEMTLEEYEKLLDEKRKSLLALKTEERKVD-PKEFASLQQLSSKKENQ  274

Query  407  EVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            ++F+KLGS+K+ +K+ A ++ +  K  SINEFLKPAEGE +Y PGGRGRGRG GS  GGY
Sbjct  275  DIFIKLGSDKDKRKETADKEERTKKSVSINEFLKPAEGEKHYTPGGRGRGRGRGSRGGGY  334

Query  233  gGNNTSS-FETPSIEDVGQFPTLGSK  159
             G++ SS    PSIED GQFPTLG+K
Sbjct  335  VGSSMSSNVAAPSIEDPGQFPTLGAK  360



>ref|XP_010481348.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=349

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 13/206 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+  D+IAP  EEP   V    V     EKQ G+++  DA K++
Sbjct  151  GRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA  206

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
              +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  +
Sbjct  207  --EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTE  263

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            +E+FVKLGS  +DK+K+A EK KK+ SINEFLKPA+G      GGRG   G G      G
Sbjct  264  EEIFVKLGS-DKDKRKDAAEKTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGG  322

Query  230  G----NNTSSFETPSIEDVGQFPTLG  165
                 N       P+I D  QFP+LG
Sbjct  323  SNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010481347.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=349

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 134/206 (65%), Gaps = 13/206 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+  D+IAP  EEP   V    V     EKQ G+++  DA K++
Sbjct  151  GRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA  206

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
              +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  +
Sbjct  207  --EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTE  263

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAE----GETyyrpggrgrgrghgsgr  243
            +E+FVKLGS  +DK+K+A EK KK+ SINEFLKPA+    G    R G  GRG     G 
Sbjct  264  EEIFVKLGS-DKDKRKDAAEKTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGG  322

Query  242  ggygGNNTSSFETPSIEDVGQFPTLG  165
            G  G N       P+I D  QFP+LG
Sbjct  323  GNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010441486.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 133/206 (65%), Gaps = 13/206 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+  D+IAP  EEP   V    V     EKQ G+++  DA K++
Sbjct  151  GRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA  206

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
              +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK  +
Sbjct  207  --EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTTE  263

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            +E+FVKLGS  +DK+K+A EK KK+ SINEFLKPA+G      GGRG   G G      G
Sbjct  264  EEIFVKLGS-DKDKRKDAAEKTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGG  322

Query  230  G----NNTSSFETPSIEDVGQFPTLG  165
                 N       P+I D  QFP+LG
Sbjct  323  SNGGENQRRGPSAPAIGDTAQFPSLG  348



>gb|KJB24892.1| hypothetical protein B456_004G166300 [Gossypium raimondii]
Length=333

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREGSGRGNWG+ TDE+A   E     V N+G      EK  G+EDA +A K+S
Sbjct  164  GRGNELKREGSGRGNWGTQTDELAQVTE-----VTNEGERNLGDEKPAGEEDAREANKES  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +EPE KEPEDKEMTL+EYEK+LEEKRKA+ A + EERKV   KEFESM  L+NKKN+D
Sbjct  219  ASNEPEEKEPEDKEMTLEEYEKVLEEKRKALQALKIEERKVDA-KEFESMQQLSNKKNND  277

Query  407  EVFVKLGS  384
            EVF+KLGS
Sbjct  278  EVFIKLGS  285



>ref|XP_009772180.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Nicotiana sylvestris]
Length=334

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 142/197 (72%), Gaps = 19/197 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG           E EEP    VN+G      EKQ  Q DA DA KDSP  EP+
Sbjct  157  RRSGTGRG-----------EKEEP----VNEGEKIVVTEKQAVQADAEDASKDSPAAEPQ  201

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  390
             KEPE+KEMTL+EYEKLLEEKRKA+LA +PEERKV LDKE ESM LL+NKK+DDEVF+KL
Sbjct  202  EKEPEEKEMTLEEYEKLLEEKRKALLALKPEERKVNLDKELESMQLLSNKKSDDEVFIKL  261

Query  389  GSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSSF  210
            GS ++DK+KEA EK KKTKSINEFLKPA+GE+YY  GGRGRG       G  G N+ S+ 
Sbjct  262  GS-EKDKRKEAVEKAKKTKSINEFLKPADGESYYGRGGRGRGGRDRGRDGFVGNNSVSA-  319

Query  209  ETPSIEDVGQFPTLGSK  159
              PSIEDV QFP+LG+K
Sbjct  320  --PSIEDVRQFPSLGAK  334



>ref|XP_010449709.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
Length=352

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 133/208 (64%), Gaps = 15/208 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KR+GSGRGNWG+P +E+A E E         GV+T   EK  G++ A DA  + 
Sbjct  155  GRGGDFKRDGSGRGNWGTPGEELAAETEAVA------GVDT---EKAVGEKPAVDADANK  205

Query  587  P-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
                E E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +
Sbjct  206  ENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKAN  264

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GRGRG      G  
Sbjct  265  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRGGV  324

Query  230  GN----NTSSFETPSIEDVGQFPTLGSK  159
             N       +   P+IED  QFP+LG K
Sbjct  325  SNEEHVGYRNEAAPAIEDTAQFPSLGGK  352



>ref|XP_009396539.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 137/214 (64%), Gaps = 15/214 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQED--AGDAK  597
            GRG E+KR G+GRGNWG+ TD+ IA E EE    V+N    T A EKQ  Q++  + +  
Sbjct  176  GRGYEMKRSGAGRGNWGAATDDDIAQEKEE----VLNADDKTIATEKQAEQDEVPSPEVN  231

Query  596  KDSP-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            KD+        ++ EDKEMTL+EYEK+ EEKRKA+LA + EERKV +D+E +SM  L+ K
Sbjct  232  KDNEGAPNEGEEKEEDKEMTLEEYEKVREEKRKALLAMKNEERKVEIDEELQSMKQLSVK  291

Query  419  KNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghg  252
            K +D+VFVKLGS+    K+ +  +  E+ KK+ SINEFLKP EGE      GRGRGRG  
Sbjct  292  KGNDDVFVKLGSDKDIGKKKENIDRDERSKKSMSINEFLKPTEGERNRGGRGRGRGRGGR  351

Query  251  sgrggygGNNTSSF---ETPSIEDVGQFPTLGSK  159
               G   G   S+F     PSIED GQFPTLG K
Sbjct  352  GQFGSGFGGEGSTFAAAAAPSIEDPGQFPTLGGK  385



>ref|XP_010439990.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like [Camelina 
sativa]
Length=390

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 113/158 (72%), Gaps = 6/158 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G GSE KR+G+GRGNWG+  D+IAP  +E    V  +       EKQ G+ +A  A K++
Sbjct  155  GHGSEFKRDGAGRGNWGTTEDDIAPVTDESTAAVEKNVT----VEKQSGEGEATIANKET  210

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P +E   KEPE+KEMTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+
Sbjct  211  PAEEQPEKEPENKEMTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNN  269

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  297
            DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE
Sbjct  270  DEVFIKLGTEKDKRVTEREEKTKKSLSINEFLKPANGE  307



>ref|XP_009145376.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 ref|XP_009145384.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Brassica rapa]
 emb|CDY42945.1| BnaA01g18090D [Brassica napus]
Length=304

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 133/205 (65%), Gaps = 11/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG + KREG+GRGNWG+P +E+ A E EE   GV N+    D  EK        DA K+
Sbjct  109  GRGGDFKREGAGRGNWGTPGEEVLAVETEEVAAGVENE---KDVVEKPADD----DANKE  161

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKN  414
            +  +  E KEPE KEMTLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK+
Sbjct  162  NTTEVEEQKEPEVKEMTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKS  220

Query  413  DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            +DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GRGRG     GG 
Sbjct  221  NDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRVSSGGG  280

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
               N S    P+I D  QFP+LG K
Sbjct  281  FSGNRSE-AAPAIADTAQFPSLGGK  304



>ref|XP_002440366.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
 gb|EES18796.1| hypothetical protein SORBIDRAFT_09g030400 [Sorghum bicolor]
Length=378

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 130/209 (62%), Gaps = 9/209 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG E+KREGSGRGNWG+ TDE +A +  + +N      V  D  + +   +   +  KD
Sbjct  169  GRGYEMKREGSGRGNWGTATDEGLAQDTADALNPEETSAVVEDEKKPEDAPQSEVEKDKD  228

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +E E KEPEDKEMTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ KK+ 
Sbjct  229  GAENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEIDKELQSMQQLSVKKDA  288

Query  410  DEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGE-----Tyyrpggrgrgrgh  255
            DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE     +    G        
Sbjct  289  DEVFIKLGSDKDLKKKENAEREERAKKSLSINEFLKPAEGERYYNPSSRGRGRGRGRGER  348

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTL  168
            G  RGGY G+       P+IED  QFP L
Sbjct  349  GGFRGGYNGSYRGPAAAPAIEDQAQFPAL  377



>ref|XP_009145362.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
 ref|XP_009145369.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X1 [Brassica rapa]
Length=335

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 133/205 (65%), Gaps = 11/205 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG + KREG+GRGNWG+P +E+ A E EE   GV N+    D  EK        DA K+
Sbjct  140  GRGGDFKREGAGRGNWGTPGEEVLAVETEEVAAGVENE---KDVVEKPADD----DANKE  192

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKN  414
            +  +  E KEPE KEMTLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK+
Sbjct  193  NTTEVEEQKEPEVKEMTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKS  251

Query  413  DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            +DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GRGRG     GG 
Sbjct  252  NDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRVSSGGG  311

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
               N S    P+I D  QFP+LG K
Sbjct  312  FSGNRSEA-APAIADTAQFPSLGGK  335



>ref|XP_010494951.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Camelina sativa]
Length=349

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 132/206 (64%), Gaps = 13/206 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+  D+IAP  EEP   V    V     EKQ G+++  DA K++
Sbjct  151  GRGTDLKREGGGRGNWGTTEDDIAPATEEPTTEVEKSPV----AEKQGGEDETADAAKEA  206

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
              +E   KE EDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K F+SM  L+NKK  +
Sbjct  207  --EEKAQKEAEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFDSMQQLSNKKTTE  263

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            +E+FVKLGS  +DK+K+  EK KK+ SINEFLKPA+G      GGRG   G G      G
Sbjct  264  EEIFVKLGS-DKDKRKDTAEKTKKSLSINEFLKPADGARGGYRGGRGGRGGRGGRDQRGG  322

Query  230  G----NNTSSFETPSIEDVGQFPTLG  165
                 N       P+I D  QFP+LG
Sbjct  323  SNGGENQRRGPSAPAIGDTAQFPSLG  348



>ref|XP_010919740.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein 
isoform X2 [Elaeis guineensis]
Length=375

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 130/208 (63%), Gaps = 12/208 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTD-EIAPEAEEPINGVVNDGVNTDAFEKQH-GQEDAGDAKK  594
            GRG  IKREGSGRGNWG+ TD E   + EE     +N G     FE+   G+ED     K
Sbjct  171  GRGG-IKREGSGRGNWGTLTDQEQVKKPEE----FINRGNMHAKFEENPVGEEDGVAVDK  225

Query  593  DSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKK  417
            ++   E E KEPEDKEMTLDEYEKLLEEKRKA+ A  R EERKV +DKEFE M  L+ KK
Sbjct  226  ENAPAEIEEKEPEDKEMTLDEYEKLLEEKRKALQALQRTEERKVDVDKEFEFMQQLSAKK  285

Query  416  NDDEVFVKLGSekedkkkeagekvkktKS----INEFLKPAEGETyyrpggrgrgrghgs  249
            NDD+VF+KLGSE++  ++      +        IN FL+PAE E  + PGGRGRGRG   
Sbjct  286  NDDDVFIKLGSERDSARRRDTADREDLTRRPAIINTFLRPAEEERQHNPGGRGRGRGGRD  345

Query  248  grggygGNNTSSFETPSIEDVGQFPTLG  165
            G  G G     +   PSIED G FPTLG
Sbjct  346  GGIGSGRTGAMNTTPPSIEDPGHFPTLG  373



>gb|ABR25759.1| nuclear antigen [Oryza sativa Indica Group]
Length=243

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 117/160 (73%), Gaps = 3/160 (2%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  +KREG+GRGNWG+ TDE +A E+ E ++  V+  V  +  ++   Q D  +  K+
Sbjct  55   GRGYGMKREGAGRGNWGTVTDEALAQESGEAVSIEVSVTVTEENKQEDVPQSDEVEKHKE  114

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ 
Sbjct  115  GESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDS  174

Query  410  DEVFVKLGSekedkkk--eagekvkktKSINEFLKPAEGE  297
            DEVF+KLGS+K+ KK+  E  E+ +K+ SINEFLKPAEGE
Sbjct  175  DEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGE  214



>ref|NP_001078399.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83810.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=265

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 133/205 (65%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KR+GSGRGNWG+P +EIA E  E + GV  +    D  EK    + A DA K+ 
Sbjct  68   GRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVETE---KDVGEKPAVDDVAADANKED  123

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++D
Sbjct  124  TV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSND  180

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            E+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG  YYR G  GRGRG     G   G
Sbjct  181  EIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSG  240

Query  227  NNTSSFE--TPSIEDVGQFPTLGSK  159
             +        P+I D  QFP+LG K
Sbjct  241  ESGGYRNEAAPAIGDAAQFPSLGGK  265



>ref|NP_001043502.1| Os01g0603000 [Oryza sativa Japonica Group]
 dbj|BAD52651.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAD53119.1| putative nuclear RNA binding protein [Oryza sativa Japonica Group]
 dbj|BAF05416.1| Os01g0603000 [Oryza sativa Japonica Group]
 gb|EAZ12602.1| hypothetical protein OsJ_02509 [Oryza sativa Japonica Group]
Length=378

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 141/209 (67%), Gaps = 6/209 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  +KREG+GRGNWG+ TDE +A E+ E ++  V+  V  +  ++   Q D  +  K+
Sbjct  167  GRGYGMKREGAGRGNWGTVTDEALAQESGEAVSIEVSVTVTEENKQEDVPQSDEVEKHKE  226

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ 
Sbjct  227  GESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDS  286

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            DEVF+KLGS+K+ KK+      + +K+ SINEFLKPAEGE YY PGGRGRGRG G G  G
Sbjct  287  DEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGDRG  346

Query  236  ygGNNTSS---FETPSIEDVGQFPTLGSK  159
               +  SS      P IED  QFP L  +
Sbjct  347  GFRDGYSSRGPVAAPRIEDQAQFPGLAGR  375



>ref|XP_004969088.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Setaria italica]
Length=371

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 139/210 (66%), Gaps = 11/210 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQE-DAGDAKKD  591
            GRG E+KREG+GRGNWG+ TDE    A+E +  V  +G    A ++   +E    + +K 
Sbjct  166  GRGYEMKREGAGRGNWGTVTDE----AQETLEAVNTEGTPAVAEDENKLEEVPHSEVEKG  221

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +  E +EPEDKEMTL+EYEK+LEEKRKA+L  + E RKV +DKE +SM  L+ KK  
Sbjct  222  KEGEPTEEEEPEDKEMTLEEYEKVLEEKRKALLGLKTEVRKVEVDKELQSMQQLSVKKGS  281

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            DE+F+KLGS+KE KK+ A    + KK+ SINEFLKPAEGE YY PGGRGRGRG G G  G
Sbjct  282  DEIFIKLGSDKEKKKENAERDERAKKSVSINEFLKPAEGERYYSPGGRGRGRGRGRGDRG  341

Query  236  ygGNNTSSFE----TPSIEDVGQFPTLGSK  159
               +  S  E     P+I+D  QFP+LG K
Sbjct  342  GFRSGYSPREPGALAPAIQDQAQFPSLGGK  371



>gb|KFK22256.1| hypothetical protein AALP_AAs66747U001100 [Arabis alpina]
Length=374

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 132/213 (62%), Gaps = 16/213 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVV--NDGVNT--DAFEKQHGQEDAGDA  600
            GRGS+ KR+GSGRGNWG+P +E+    ++ + G     DGV T  +  EK  G + A D+
Sbjct  168  GRGSDFKRDGSGRGNWGTPGEEV---FDQTLTGETKEGDGVETEKNVVEKPAGDDVAADS  224

Query  599  KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
             K++       +E E ++MTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NK
Sbjct  225  IKEN--TTEAEEEKEPEQMTLDEYEKILEEKKKALQSETVSERKVDT-KVFESMQQLSNK  281

Query  419  KNDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrg  240
            K++DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE Y+R GGRG     G G  
Sbjct  282  KSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYHRGGGRGGRGRGGRGGR  341

Query  239  gygGNNTSSFE------TPSIEDVGQFPTLGSK  159
            G        F        P+I D  QFP+LG K
Sbjct  342  GGNSTGGGGFAGYRNEPAPAIADTAQFPSLGGK  374



>ref|XP_011101848.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Sesamum indicum]
Length=369

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 145/206 (70%), Gaps = 9/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED-AGDAKKD  591
            GRG+E+KREG+GR NWG+ TDE+A   EE    VVN+G  +   EK  G ED   D  K+
Sbjct  170  GRGNEMKREGAGRANWGTHTDELAEVTEE----VVNEGEKSLNVEKPSGDEDPPADGDKE  225

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            +       ++PEDKEMTL+EYEKLLEEKRKA+ A + EERKV + KEFE+M  LANKK +
Sbjct  226  A-ATTEVEEKPEDKEMTLEEYEKLLEEKRKALQALKTEERKVDV-KEFETMQQLANKKAN  283

Query  410  DEVFVKLGS--ekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            D+VF+KLGS  +K+ +  E  E+ KK+ SINEFLKPAEGE YY  GGRGRGRG GS  G 
Sbjct  284  DDVFIKLGSDKDKKKELAEKEERAKKSVSINEFLKPAEGEAYYNRGGRGRGRGRGSRGGY  343

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             GG+   + E P+IED GQFPTLG K
Sbjct  344  TGGSKMGNAEAPAIEDPGQFPTLGGK  369



>gb|KJB37652.1| hypothetical protein B456_006G214200 [Gossypium raimondii]
Length=335

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 130/198 (66%), Gaps = 19/198 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG     T+E  PE E+ +           + EKQ G+EDA DA K++  +E E
Sbjct  156  RRSGTGRGE----TEENVPENEKNV-----------SIEKQSGEEDAMDAGKENAANEAE  200

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKL  390
             KEPE+KEMTL+EYEK++EEKRKA+LA + EERKV   KEFESM  L++KK++D++F+KL
Sbjct  201  EKEPENKEMTLEEYEKIVEEKRKALLALKTEERKVDT-KEFESMQQLSSKKSNDDIFIKL  259

Query  389  GSekedkkkeagekv-kktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNTSS  213
            GSEK+ +K    E+  KK+ SINEFLKPAEGE     G           RGGYGGN  SS
Sbjct  260  GSEKDKRKDADKEERVKKSVSINEFLKPAEGER--YYGPGRGRGRGRGPRGGYGGNTASS  317

Query  212  FETPSIEDVGQFPTLGSK  159
               PSIED G FP+LG K
Sbjct  318  VLAPSIEDPGHFPSLGGK  335



>dbj|BAG90611.1| unnamed protein product [Oryza sativa Japonica Group]
Length=221

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 12/212 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   E A  A   K
Sbjct  13   GRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAPEGAPQADENK  69

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
             +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK
Sbjct  70   DNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKK  129

Query  416  NDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrgh  255
             +DEVF+KLGS+    K+ +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   
Sbjct  130  ENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  189

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G   G+ +++   P I+D  QFPTLG K
Sbjct  190  GFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  221



>ref|XP_009410905.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=387

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 137/216 (63%), Gaps = 17/216 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQED--AGDAK  597
            GRG E KR G+GRGNWGS TDE +A E EE +N   +D   T A EKQ   +   + +  
Sbjct  176  GRGYETKRNGAGRGNWGSATDETVAQEKEETLN--TDD--KTVATEKQVELDGVPSSEVN  231

Query  596  KDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            KD+         ++ EDKEMTL+EYEKL EEKRKA+LA + EERKV +D+E +SM  L+ 
Sbjct  232  KDNKEGATNETEEKEEDKEMTLEEYEKLREEKRKALLALKNEERKVEIDEELQSMKQLSV  291

Query  422  KKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAEGETyyr--pggrgrgr  261
            KK +D+VFVKLGS+K+  KK+       + KK+  I EFLKPAEGE YY     GRGRGR
Sbjct  292  KKGNDDVFVKLGSDKDTGKKKENADRDERSKKSMRITEFLKPAEGERYYSPGGRGRGRGR  351

Query  260  ghgsgrggygGNNTSSF--ETPSIEDVGQFPTLGSK  159
            G     GG  G   S+F    PSIED GQFPTLG K
Sbjct  352  GGRGQYGGGFGGGVSTFPAAAPSIEDPGQFPTLGGK  387



>emb|CDY35615.1| BnaC01g21370D [Brassica napus]
Length=338

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 130/210 (62%), Gaps = 15/210 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KREG+GRGNWG+P +E+     E + GV  +    D  EK        DA K++
Sbjct  137  GRGGDFKREGAGRGNWGTPGEEVLAVETEEVAGVETE---KDVVEKPADD----DANKEN  189

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKND  411
              +  E KEPE KEMTLDEYEK+LEEKRKA+ +    ERKV   K FESM  L+N KK++
Sbjct  190  TAEVEEQKEPEVKEMTLDEYEKILEEKRKALQSQNTSERKVDT-KVFESMQQLSNKKKSN  248

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPA+GE YYR G  GRGRG    R    
Sbjct  249  DEIFIKLGSDKDKRKDDKEEKPKKAVSINEFLKPADGENYYRGGRGGRGRGGRESRDRGA  308

Query  230  GNNTSSF------ETPSIEDVGQFPTLGSK  159
              ++  +        P+I D  QFP+LG K
Sbjct  309  RASSGGYGGNRSEAAPAIADTAQFPSLGGK  338



>ref|NP_193416.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAF14243.1|AF110227_1 nuclear RNA binding protein [Arabidopsis thaliana]
 emb|CAB10456.1| nuclear antigen homolog [Arabidopsis thaliana]
 emb|CAB80954.1| nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAL36252.1| putative nuclear antigen homolog [Arabidopsis thaliana]
 gb|AAM20150.1| putative nuclear antigen-like protein [Arabidopsis thaliana]
 gb|AAM83242.1| AT4g16830/dl4440w [Arabidopsis thaliana]
 gb|AAN18128.1| At4g16830/dl4440w [Arabidopsis thaliana]
 gb|AEE83809.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=355

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 133/205 (65%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KR+GSGRGNWG+P +EIA E  E + GV  +    D  EK    + A DA K+ 
Sbjct  158  GRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVETE---KDVGEKPAVDDVAADANKED  213

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++D
Sbjct  214  TV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSND  270

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            E+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG  YYR G  GRGRG     G   G
Sbjct  271  EIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSG  330

Query  227  NNTSSFE--TPSIEDVGQFPTLGSK  159
             +        P+I D  QFP+LG K
Sbjct  331  ESGGYRNEAAPAIGDAAQFPSLGGK  355



>gb|AAM64962.1| nuclear RNA binding protein A-like protein [Arabidopsis thaliana]
Length=360

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 97/217 (45%), Positives = 135/217 (62%), Gaps = 24/217 (11%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E KR+G+GR NWG+P D+I P  EE    VV+  +     EKQ G+ +A DAK ++P 
Sbjct  149  GNEEKRDGAGRANWGTPQDDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPA  204

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            ++ E K  + + MTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DE
Sbjct  205  EKAEEKPEDKE-MTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDE  262

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN  225
            VF+KLG+EK+ +  E  EK +K+ SINEFLKPA+G++YYRP G  +G   G G       
Sbjct  263  VFIKLGTEKDKRITEREEKTRKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQR  322

Query  224  N-----------------TSSFETPSIEDVGQFPTLG  165
            +                  +   TP+I D  QFPTLG
Sbjct  323  DGGRNQREGGRNQRDGGAAAQAPTPAIGDSAQFPTLG  359



>ref|XP_004148350.1| PREDICTED: uncharacterized protein LOC101207608 [Cucumis sativus]
 ref|XP_004166199.1| PREDICTED: uncharacterized protein LOC101223435 [Cucumis sativus]
 gb|KGN60476.1| hypothetical protein Csa_3G914560 [Cucumis sativus]
Length=358

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 139/207 (67%), Gaps = 10/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGD--AKK  594
            GRG+E KREG+GR NWG+P DE AP+ EEP    V +     A E+Q G++   D   K 
Sbjct  158  GRGNEFKREGAGRRNWGAPGDENAPDVEEP----VAENEKNVAPEQQLGEDGVVDDNNKT  213

Query  593  DSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN  414
            +  + EPE KEPEDKEMTL EYEKL EE RK  L ++ E RK  +D+E E+M  L++KK 
Sbjct  214  EEAVKEPEEKEPEDKEMTLKEYEKLREESRK--LLAKTEVRKAEVDEELENMQQLSSKKT  271

Query  413  DDEVFVKLGSekedkkkeagekvkktKS--INEFLKPAEGETyyrpggrgrgrghgsgrg  240
            +DE+F KLG++K+ +K  A ++ +  KS  I EFLKPAEGE YY PGGRGRGRG GS  G
Sbjct  272  NDEIFAKLGTDKDKRKDAADKEERAKKSVTITEFLKPAEGERYYNPGGRGRGRGRGSRGG  331

Query  239  gygGNNTSSFETPSIEDVGQFPTLGSK  159
               G+N  +   PSIED GQFP+L +K
Sbjct  332  FNNGSNRMNVAAPSIEDPGQFPSLSAK  358



>emb|CDY28966.1| BnaA02g25100D [Brassica napus]
Length=340

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 8/160 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+++KREG GRGNWG+P D+I P  EEP   V    V     EK+ G+++  DAKKD+
Sbjct  133  GRGNDLKREGGGRGNWGTPEDDIPPPTEEPTTEVEKSPV----AEKEGGEDNTTDAKKDA  188

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P DE + KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L++KK N+
Sbjct  189  PADEGKEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSSKKTNN  247

Query  410  DEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGE  297
            +E+F+KLGS+K+ +K   E  EK KK+ SINEFLKPA+GE
Sbjct  248  EEIFIKLGSDKDKRKDAAEKEEKAKKSLSINEFLKPADGE  287



>ref|NP_001078400.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE83811.1| hyaluronan / mRNA binding domain-containing protein [Arabidopsis 
thaliana]
Length=345

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 133/205 (65%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KR+GSGRGNWG+P +EIA E  E + GV  +    D  EK    + A DA K+ 
Sbjct  148  GRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVETE---KDVGEKPAVDDVAADANKED  203

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++D
Sbjct  204  TV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSND  260

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            E+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG  YYR G  GRGRG     G   G
Sbjct  261  EIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRGGRGGRGRGGRGRGGVSSG  320

Query  227  NNTSSFE--TPSIEDVGQFPTLGSK  159
             +        P+I D  QFP+LG K
Sbjct  321  ESGGYRNEAAPAIGDAAQFPSLGGK  345



>ref|XP_010434762.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Camelina sativa]
 ref|XP_010434763.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Camelina sativa]
Length=347

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 130/206 (63%), Gaps = 13/206 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KR+GSGRGNWG+P +E+A E E         GV+T   EK  G+  A DA  + 
Sbjct  152  GRGGDFKRDGSGRGNWGTPGEELAAETEAVA------GVDT---EKAVGETPAVDADANK  202

Query  587  P-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
                E + KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK +
Sbjct  203  ENTAEVDEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKAN  261

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR G  GRGRG         
Sbjct  262  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGRGGRGRGGRGRGRVSS  321

Query  230  GNN--TSSFETPSIEDVGQFPTLGSK  159
              +    +   P+I D  QFP+LG K
Sbjct  322  EEHGGYRNEAAPAIGDTAQFPSLGGK  347



>ref|XP_010925494.1| PREDICTED: protein argonaute 2-like [Elaeis guineensis]
Length=378

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 148/219 (68%), Gaps = 26/219 (12%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTD----AFEKQHGQEDA--G  606
            GRG E+KREG+GRGNWG+ TD++  +A E       D VNTD    + EKQ  QEDA   
Sbjct  166  GRGYEMKREGAGRGNWGTSTDDVLAQATE-------DNVNTDEKVASPEKQPEQEDAPFA  218

Query  605  DAKKDSP---LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  435
            +A KD+    ++E E KEPEDKEMTL+EYEK+ EEKRKA+LA +PEERKV LDKEFESM 
Sbjct  219  EANKDTKEGEVNEAEEKEPEDKEMTLEEYEKIKEEKRKALLALKPEERKVQLDKEFESMQ  278

Query  434  LLANKKNDDEVFVKLG----SekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgr  267
             L+ KK DD VFVKLG    S K+    + GE+ +K+ SINEFLKPAEGE YY P GRGR
Sbjct  279  QLSLKKGDD-VFVKLGTDKDSSKKRDNADRGERARKSFSINEFLKPAEGERYYSPAGRGR  337

Query  266  grghgsgrggygGN-----NTSSFETPSIEDVGQFPTLG  165
            GRG G G     G+      T +   PSIED GQFPTLG
Sbjct  338  GRGRGRGDRRTFGDGFGRGGTIAAAAPSIEDPGQFPTLG  376



>ref|XP_008465866.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=358

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 139/206 (67%), Gaps = 9/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKK-D  591
            GRG+E KR+G+GR NWG+P DE AP+ EEP    V +     A E+Q G++   D  K +
Sbjct  159  GRGNEFKRDGAGRRNWGAPGDENAPDVEEP----VAENEKNVAPEQQLGEDGVDDNNKAE  214

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
              + EPE KEPEDKEMTL EYEKL EE RK  L ++ E RK  +D+E E+M  L++KK +
Sbjct  215  EAVKEPEEKEPEDKEMTLKEYEKLREESRK--LLAKTEVRKAEVDEELENMQQLSSKKTN  272

Query  410  DEVFVKLGSekedkkkeagekvkktKS--INEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            DE+F KLG++K+ +K  A ++ +  KS  I EFLKPAEGE YY PGGRGRGRG GS  G 
Sbjct  273  DEIFAKLGTDKDKRKDVADKEERAKKSVTITEFLKPAEGERYYNPGGRGRGRGRGSRGGF  332

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
              G+N  +   PSIED GQFP+L +K
Sbjct  333  NNGSNRMNVAAPSIEDPGQFPSLSAK  358



>gb|EYU40365.1| hypothetical protein MIMGU_mgv1a008102mg [Erythranthe guttata]
Length=385

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 146/212 (69%), Gaps = 15/212 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA---GDAK  597
            GRG+E KREG+GRGNWG+ TDE+A   EE     V +G    + EK  G+ DA   GD +
Sbjct  179  GRGNEFKREGAGRGNWGTHTDELAEVTEE----AVIEGEKAPSVEKPSGEVDATADGDKE  234

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRP--EERKVCLDKEFESMALLAN  423
              +   E E KEPEDKEMTL+EYEK+LEEKRK++LA +   E RKV + KEFESM  L++
Sbjct  235  AAA-ATEVEEKEPEDKEMTLEEYEKVLEEKRKSLLALKADSEARKVDV-KEFESMQQLSS  292

Query  422  KK-NDDEVFVKLGS--ekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghg  252
            KK ++D++F+KLGS  +K+ +  E  E+ KK+ SINEFLKPAEGE +Y  GGRGRGRG G
Sbjct  293  KKRSNDDIFIKLGSEKDKKKELAEKEERAKKSVSINEFLKPAEGERHYSSGGRGRGRGRG  352

Query  251  sgrggygGNNTS-SFETPSIEDVGQFPTLGSK  159
            S  GG  G   + +   P+IED GQFPTLG K
Sbjct  353  SRGGGGYGVGGNENVRAPAIEDPGQFPTLGGK  384



>ref|XP_004961035.1| PREDICTED: insulin receptor substrate 4-like [Setaria italica]
Length=373

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 135/214 (63%), Gaps = 16/214 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA--GDAKK  594
            GRG E+KREG+GRGNWG+ TDE+   A++ +   VN    T   E +   EDA   + +K
Sbjct  163  GRGYEMKREGAGRGNWGTVTDEVL--AQDTVE-AVNPEETTAVAEDEKKPEDAPQSEVEK  219

Query  593  DSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            D    E E +E E ++  MTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+ K
Sbjct  220  DKEGVENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEIDKELQSMQQLSIK  279

Query  419  KNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgs  249
            K+ DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGR  G 
Sbjct  280  KDADEVFIKLGSDKDLKKKENAERDERAKKSLSINEFLKPAEGERYYNPSGRGRGRSRGR  339

Query  248  grggygGNNTS------SFETPSIEDVGQFPTLG  165
            G  G      +      +   P+IED  QFP L 
Sbjct  340  GERGGFYGGYNGGYRGPAAAAPAIEDQAQFPALA  373



>gb|ABD65067.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY52558.1| BnaC08g48170D [Brassica napus]
Length=367

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 111/157 (71%), Gaps = 9/157 (6%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E KR+G+GRGNWG+  DEI P  EE    V  D     A EK+    +A DA K++P+
Sbjct  139  GNEFKRDGAGRGNWGTTEDEIPPVTEESATVVEKD----LAVEKEG---EATDANKETPV  191

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            +    KEPED EMTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++KK N+DE
Sbjct  192  EAQAEKEPEDTEMTLEEYEKVLEEKRKALQATKVEERKVDT-KVFEAMQQLSSKKSNNDE  250

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  294
            VF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE+
Sbjct  251  VFIKLGTEKDKRPVEREEKTKKSLSINEFLKPANGES  287



>gb|AAM61393.1| nuclear antigen homolog [Arabidopsis thaliana]
Length=354

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 132/205 (64%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KR+GSGRGNWG+P +EIA E  E + GV       D  EK    + A DA K++
Sbjct  157  GRGSDFKRDGSGRGNWGTPGEEIAAET-EAVAGVE---TQKDVGEKPAVDDVAADANKEN  212

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             +   E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++D
Sbjct  213  TV--VEEKEPEDKEMTLDEYEKILEEKKKALQSLTTSERKVDT-KVFESMQQLSNKKSND  269

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            E+F+KLGS+K+ +K +  EK KK  SINEFLKPA G  YYR G  GRGRG     G   G
Sbjct  270  EIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAGGGDYYRGGRGGRGRGGRGRGGVSSG  329

Query  227  NNTSSFE--TPSIEDVGQFPTLGSK  159
             +        P+I D  QFP+LG K
Sbjct  330  ESGGYRNEAAPAIGDAAQFPSLGGK  354



>ref|NP_001148572.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACG32086.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=364

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 133/206 (65%), Gaps = 9/206 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG  +KREG+GRGNWG+ TDE     E+     VN    T   E +   EDA  +   K
Sbjct  161  GRGYGMKREGAGRGNWGTATDEGL---EQDTVDAVNPEETTAVVEDEKKPEDAPQSEVEK  217

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
                 +  E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DKE ++M  L+ KK
Sbjct  218  DKEGAENEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVEIDKELQAMQQLSVKK  277

Query  416  NDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsg  246
            + DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGRG G  
Sbjct  278  DGDEVFIKLGSDKDLKKKESAEREERGKKSLSINEFLKPAEGERYYNPSGRGRGRGRGGF  337

Query  245  rggygGNNTSSFETPSIEDVGQFPTL  168
            RGGY G        P+IED  QFP L
Sbjct  338  RGGYNGGYRGPAAAPAIEDQAQFPAL  363



>ref|NP_001056139.1| Os05g0533100 [Oryza sativa Japonica Group]
 dbj|BAF18053.1| Os05g0533100, partial [Oryza sativa Japonica Group]
Length=286

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 12/212 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   E A  A   K
Sbjct  78   GRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAPEGAPQADENK  134

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
             +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK
Sbjct  135  DNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKK  194

Query  416  NDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrgh  255
             +DEVF+KLGS+    K+ +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   
Sbjct  195  ENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  254

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G   G+ +++   P I+D  QFPTLG K
Sbjct  255  GFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  286



>emb|CDX76586.1| BnaA08g08140D [Brassica napus]
Length=342

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 136/210 (65%), Gaps = 16/210 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KREG+GRGNWG+P +E+     E + GV          EK  G E A DAKK++
Sbjct  142  GRGGDFKREGAGRGNWGTPGEEVLVVETEEVAGVET--------EKPAGDEVAADAKKEN  193

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKND  411
              +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV   K FESM  L+N KK++
Sbjct  194  TAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT-KVFESMQQLSNKKKSN  252

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR GGRG GRG G G    G
Sbjct  253  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRG  312

Query  230  GNNTSSFE------TPSIEDVGQFPTLGSK  159
              +   F+       P+I D  QFP+LG K
Sbjct  313  VVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  342



>ref|XP_006285507.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
 gb|EOA18405.1| hypothetical protein CARUB_v10006948mg [Capsella rubella]
Length=363

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 112/155 (72%), Gaps = 6/155 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G G E KR+G+GRGNWG+  D+IAP  +E  +  V++   T   EKQ G+ +A DA K+ 
Sbjct  151  GHGCEFKRDGAGRGNWGTAEDDIAPVTDE--SAAVDEKNLT--VEKQGGEGEATDANKEI  206

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
              +E   KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  LANKK N+
Sbjct  207  SAEEQAEKEPEDKEMTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLANKKSNN  265

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPA  306
            DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA
Sbjct  266  DEVFIKLGTEKDKRITEREEKTKKSLSINEFLKPA  300



>ref|XP_002863351.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39610.1| hypothetical protein ARALYDRAFT_494257 [Arabidopsis lyrata subsp. 
lyrata]
Length=363

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 134/212 (63%), Gaps = 17/212 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD-  591
            GRG+ +KR+G GRGNWG+  D+I P  EEP   V    V     EKQ G+++  +A K+ 
Sbjct  157  GRGNGLKRDGGGRGNWGTTEDDIPPVTEEPTTEVEKSPV----AEKQGGEDETAEANKEP  212

Query  590  --SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
                  + E +E E +EMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK
Sbjct  213  TAEEKAQKEAEEAEAREMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKK  271

Query  416  N-DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE-------Tyyrpggrgrgr  261
            N D+E+F+KLGS ++DK+K+A EK KK+ SINEFLKPA+GE          R G  GRG 
Sbjct  272  NTDEEIFIKLGS-EKDKRKDAAEKTKKSLSINEFLKPADGERYNGRGGHRGRGGCGGRGG  330

Query  260  ghgsgrggygGNNTSSFETPSIEDVGQFPTLG  165
                G GG   N   +   P+I D  QFP+LG
Sbjct  331  REHRGDGGNQRNVKPAAPAPAIGDTAQFPSLG  362



>ref|XP_006414219.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
 gb|ESQ55672.1| hypothetical protein EUTSA_v10025512mg [Eutrema salsugineum]
Length=368

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 114/158 (72%), Gaps = 9/158 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G+G+E KR+G+GRGNWG+  DEI P  EE    VV   +   A EK  G+++A    KD+
Sbjct  143  GQGNEFKRDGAGRGNWGTTEDEITPVTEESTT-VVEKNL---AVEKLGGEDEA---NKDT  195

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P+ E   +EPEDK MTL+EYEK+LEEKR+A+ A++ EERKV   K FE+M  +++KK N+
Sbjct  196  PVKEKAEEEPEDKSMTLEEYEKVLEEKRQALQATKVEERKVDT-KAFETMQQISSKKSNN  254

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE  297
            D+VF+KLG+EK+ +  E  EK KK+ SINEFLKPA+GE
Sbjct  255  DDVFIKLGTEKDKRTTEKEEKTKKSLSINEFLKPADGE  292



>gb|AFW81314.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=365

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 133/207 (64%), Gaps = 10/207 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA--GDAKK  594
            GRG  +KREG+GRGNWG+ TDE     E+     VN    T   E +   EDA   + +K
Sbjct  161  GRGYGMKREGAGRGNWGTATDEGL---EQDTVDAVNPEETTAVVEDEKKPEDAPQSEVEK  217

Query  593  DSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            D    E E +E E ++  MTL+EYEK+LEEKRKA+L+ + EERKV +DKE ++M  L+ K
Sbjct  218  DKEGAENEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKAEERKVEIDKELQAMQQLSVK  277

Query  419  KNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgs  249
            K+ DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGRG G 
Sbjct  278  KDGDEVFIKLGSDKDLKKKESAEREERGKKSLSINEFLKPAEGERYYNPSGRGRGRGRGG  337

Query  248  grggygGNNTSSFETPSIEDVGQFPTL  168
             RGGY G        P+IED  QFP L
Sbjct  338  FRGGYNGGYRGPAAAPAIEDQAQFPAL  364



>ref|XP_009416461.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Musa acuminata subsp. malaccensis]
Length=389

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 132/217 (61%), Gaps = 18/217 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQED--AGDAK  597
            GRG E+KR+G+GRGNWG+  DE +A E +E    V+N        EKQ  QE   A +  
Sbjct  177  GRGYEMKRDGAGRGNWGTVADETLAQEKDE----VLNFDDKMLVTEKQQEQEKTPATEES  232

Query  596  KDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            K++         ++ EDKEMTL+EYEK+ EEKRKA+LA + EERKV +DKE +SM  L+ 
Sbjct  233  KENKEGTTNEAEEKEEDKEMTLEEYEKIREEKRKALLAMKAEERKVEIDKELQSMQQLST  292

Query  422  KKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEG-----ETyyrpggrg  270
            KK +D +FVKLGS+    K+ +  +  E+ KK+ SINEFLKPAEG           G   
Sbjct  293  KKENDPIFVKLGSDKDFGKKKENADRDERSKKSLSINEFLKPAEGGRYYSPGGRGRGRGR  352

Query  269  rgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
              RG   G  G GG++ ++   PSIED GQFPTLG K
Sbjct  353  GDRGPLRGSYGGGGSSFAAAAAPSIEDPGQFPTLGGK  389



>ref|XP_006284012.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
 gb|EOA16910.1| hypothetical protein CARUB_v10005134mg [Capsella rubella]
Length=354

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 132/206 (64%), Gaps = 13/206 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGS+ KR+GSGRGNWG+P +E+A E E         GV+T   EK  G++ A DA  + 
Sbjct  159  GRGSDFKRDGSGRGNWGTPGEELASETEAVA------GVDT---EKDVGEKPAVDADANK  209

Query  587  P-LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
                E E KEPEDKEMTLDEYEK+LEEK+KA+ +    ERKV   K FESM  L+NKK++
Sbjct  210  ENTAEVEEKEPEDKEMTLDEYEKILEEKKKALQSLTTTERKVDT-KVFESMQQLSNKKSN  268

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEG+ +YR G  GRGRG     G   
Sbjct  269  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGQNFYRGGRGGRGRGGRGRGGVSS  328

Query  230  GNNTSSFE--TPSIEDVGQFPTLGSK  159
              +        P+I D   FP+LG K
Sbjct  329  EEHGGYRNEPAPAIGDTTHFPSLGGK  354



>gb|EAY74854.1| hypothetical protein OsI_02745 [Oryza sativa Indica Group]
Length=380

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 131/211 (62%), Gaps = 8/211 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  +KREG+GRGNWG+ TDE +A E+ E ++  V+  V  +  ++   Q D  +  K+
Sbjct  167  GRGYGMKREGAGRGNWGTVTDEALAQESGEAVSIEVSVTVTEENKQEDVPQSDEVEKHKE  226

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               +E E KEPEDKEMTL+EYEK+LEEKRKA+L+ + EERKV +DKE +SM  L+ KK+ 
Sbjct  227  GESNEEEEKEPEDKEMTLEEYEKVLEEKRKALLSLKVEERKVVVDKELQSMQQLSVKKDS  286

Query  410  DEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyr-----pggrgrgrghg  252
            DEVF+KLGS+K+ KK+      + +K+ SINEFLKPAEGE YY       G         
Sbjct  287  DEVFIKLGSDKDKKKENVERDERTRKSLSINEFLKPAEGERYYSPGGRGRGRGRGRGRGD  346

Query  251  sgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
             G    G ++      P IED  QFP L  +
Sbjct  347  RGGFRDGYSSRGPVAAPRIEDQAQFPGLAGR  377



>ref|NP_001056483.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|AAT38003.1| putative nuclear RNA binding protein A [Oryza sativa Japonica 
Group]
 gb|AAT58811.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18397.1| Os05g0589600 [Oryza sativa Japonica Group]
 gb|EEE64880.1| hypothetical protein OsJ_19739 [Oryza sativa Japonica Group]
Length=383

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 133/212 (63%), Gaps = 9/212 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG E+KREGSGRGNWG+ TDE +A E  E +N         D  + +   +   D  K+
Sbjct  172  GRGYELKREGSGRGNWGTVTDEGLAQEVAEAVNTEEAPATAEDEKKPEDVPQSEVDKDKE  231

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            SP +E E KEPEDKEMTL+EYEK+LEEKRKA+LA + EERKV +DKE ++M  L+ KK +
Sbjct  232  SPENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKAN  291

Query  410  DEVFVKLGS---ekedkkkeagekvkktKSINEFLKPAEGE-----Tyyrpggrgrgrgh  255
            +EVF+KLGS    K+ +K E  E+ KK+ SINEFLKPAEGE        R  GRGRG   
Sbjct  292  EEVFIKLGSDKDLKKKEKDEKDERTKKSLSINEFLKPAEGERYYNPGRGRGRGRGRGDRG  351

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G  G         P IED  QFP+LG K
Sbjct  352  GFYGGYNGNGGRRQAAAPVIEDQAQFPSLGGK  383



>ref|XP_004969787.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A-like [Setaria italica]
Length=375

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 131/210 (62%), Gaps = 11/210 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEI-APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---  600
            GRG E+KR+G+GRGNWG+ TDE+ A E EE +   V +G      EKQ  Q DA  A   
Sbjct  170  GRGYEMKRDGAGRGNWGTATDEVLAQETEEALK--VEEGAPI--AEKQGEQNDAPAADEN  225

Query  599  KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            K +      E ++ EDKEMTL+E+EK+ EEKRKA+LA + EER+V +DK+ +S+  L+NK
Sbjct  226  KDNKDAAADEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERRVEVDKDLQSLQPLSNK  285

Query  419  KNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPA-EGETyyrpggrgrgrghgs  249
            K +DEVF+KLGS+K+ KK+ A    + KK+ SINEFLKPA     Y   G        G 
Sbjct  286  KENDEVFIKLGSDKDKKKESAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGERGG  345

Query  248  grggygGNNTSSFETPSIEDVGQFPTLGSK  159
              G +GG +      P+IED  QFP+LG K
Sbjct  346  RGGYFGGYHRGPAAAPAIEDQAQFPSLGGK  375



>gb|KEH17858.1| nuclear RNA-binding-like protein [Medicago truncatula]
Length=373

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 130/209 (62%), Gaps = 13/209 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED--AGDAKK  594
            GRG   KREG+GRGNWG+ +DEIA   +E    V N+     A +K  G+ED  A D  K
Sbjct  167  GRGGGFKREGAGRGNWGTQSDEIAQVTDE----VANETEKNVAEDKPVGEEDAAAADGNK  222

Query  593  DSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN  414
            ++P  E E KEPEDKEMTL+EYEK+LEEKRKA+       RKV   KEFES+  L+ KK 
Sbjct  223  ETPAPEAEEKEPEDKEMTLEEYEKVLEEKRKALNVKTDGGRKVDT-KEFESLKPLSCKKE  281

Query  413  DDEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGE-----Tyyrpggrgrgrghg  252
            +DE+F KLGS+K+ +K    ++  +   SINEFLKPAEGE           G   GRG  
Sbjct  282  NDEIFAKLGSDKDRRKDAIEKEKARKALSINEFLKPAEGEKYYNPGGRGGRGGRGGRGGS  341

Query  251  sgrggygGNNTSSFETPSIEDVGQFPTLG  165
             G GGYGGN   +   PSIED GQFPTLG
Sbjct  342  RGGGGYGGNAYGNVSAPSIEDPGQFPTLG  370



>ref|XP_009108277.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Brassica rapa]
Length=273

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 134/210 (64%), Gaps = 16/210 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KREG+GRGNWG+P +E+     E + G           EK  G E   DAKK++
Sbjct  73   GRGGDFKREGAGRGNWGTPGEEVLVVETEEVAGA--------EIEKPAGDEVVADAKKEN  124

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKND  411
              +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV   K FESM  L+N KK++
Sbjct  125  AAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT-KVFESMQQLSNKKKSN  183

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR GGRG GRG G G    G
Sbjct  184  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRG  243

Query  230  GNNTSSFE------TPSIEDVGQFPTLGSK  159
              +   F+       P+I D  QFP+LG K
Sbjct  244  VVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  273



>gb|EEE64473.1| hypothetical protein OsJ_19323 [Oryza sativa Japonica Group]
Length=392

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 12/212 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   E A  A   K
Sbjct  184  GRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAPEGAPQADENK  240

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
             +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK
Sbjct  241  DNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKK  300

Query  416  NDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrgh  255
             +DEVF+KLGS+    K+ +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   
Sbjct  301  ENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  360

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G   G+ +++   P I+D  QFPTLG K
Sbjct  361  GFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  392



>gb|EEC79581.1| hypothetical protein OsI_20751 [Oryza sativa Indica Group]
Length=381

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 12/212 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   E A  A   K
Sbjct  173  GRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAPEGAPQADENK  229

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
             +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK
Sbjct  230  DNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKK  289

Query  416  NDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrgh  255
             +DEVF+KLGS+    K+ +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   
Sbjct  290  ENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  349

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G   G+ +++   P I+D  QFPTLG K
Sbjct  350  GFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  381



>ref|XP_006477113.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Citrus sinensis]
Length=342

 Score =   110 bits (276),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 20/200 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG           E EEP    V +  NT+A EK  G+E+A DA K++P+DE E
Sbjct  160  RRSGTGRG-----------ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQE  203

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVK  393
             KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K
Sbjct  204  EKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIK  263

Query  392  LGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT  219
            +GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + 
Sbjct  264  VGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSG  323

Query  218  SSFETPSIEDVGQFPTLGSK  159
            ++   P IED GQFP+LG K
Sbjct  324  NAA-APKIEDPGQFPSLGGK  342



>gb|AAT47083.1| unknown protein [Oryza sativa Japonica Group]
Length=390

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 12/212 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG E+KREGSGRGNWG+ TDEI   A+E    +  D       EKQ   E A  A   K
Sbjct  182  GRGYEMKREGSGRGNWGTTTDEIL--AQETGEALKLD-EKAPVTEKQGAPEGAPQADENK  238

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
             +  +   E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK
Sbjct  239  DNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDLKSMQPLSNKK  298

Query  416  NDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPA--EGETyyrpggrgrgrgh  255
             +DEVF+KLGS+    K+ +  E  E+ KK+ SINEFLKPA  E     R  GRGRG   
Sbjct  299  ENDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  358

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G   G+ +++   P I+D  QFPTLG K
Sbjct  359  GFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK  390



>gb|KDO57094.1| hypothetical protein CISIN_1g017915mg [Citrus sinensis]
Length=342

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 20/200 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG           E EEP    V +  NT+A EK  G+E+A DA K++P+DE E
Sbjct  160  RRSGTGRG-----------ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQE  203

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVK  393
             KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K
Sbjct  204  EKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIK  263

Query  392  LGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT  219
            +GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  + 
Sbjct  264  VGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSG  323

Query  218  SSFETPSIEDVGQFPTLGSK  159
            ++   P IED GQFP+LG K
Sbjct  324  NAA-APKIEDPGQFPSLGGK  342



>emb|CDY65881.1| BnaAnng21260D [Brassica napus]
Length=333

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 131/209 (63%), Gaps = 19/209 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQE---DAGDAK  597
              G E+KR+G+GRGNWG+  D+I P         V +G +T   EK    E   +A DA 
Sbjct  135  AHGHELKRDGAGRGNWGTIEDDIPP---------VTEG-STPVVEKDLAVEKEGEATDAN  184

Query  596  KDSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            K++P++    KEPE ++  MTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++
Sbjct  185  KETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKVDT-KAFETMQQLSS  243

Query  422  KK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETy--yrpggrgrgrghg  252
            KK N+DEVF+KLG++K+ +  E  EK KK+ SINEFLKPA GE Y     GGRGRG   G
Sbjct  244  KKSNNDEVFIKLGTDKDKRPVEKEEKTKKSLSINEFLKPANGERYRGADEGGRGRGAEGG  303

Query  251  sgrggygGNNTSSFETPSIEDVGQFPTLG  165
                  G +  ++   P IED   FPTLG
Sbjct  304  GRGPKGGADRKAAAPAPKIEDAAHFPTLG  332



>ref|XP_006654864.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=379

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 138/218 (63%), Gaps = 19/218 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  +KREG+GRGNWG+ TDE +A E  E    VVN        E++   EDA  ++ D
Sbjct  166  GRGYGMKREGAGRGNWGTVTDEGLAQETVE----VVNTEETAATAEEEKKPEDAPQSEVD  221

Query  590  -----SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
                    +E E KEPED EMTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+
Sbjct  222  KDKEGLENEEEEEKEPEDTEMTLEEYEKVLEEKRKALLALKAEERKVEVDKELQSMQQLS  281

Query  425  NKKNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrgh  255
             KK+++EVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE YY P GRGRGRG 
Sbjct  282  VKKDNEEVFIKLGSDKDLKKKEIAERDERAKKSLSINEFLKPAEGERYYNPSGRGRGRGR  341

Query  254  gsgrggygGNNTS------SFETPSIEDVGQFPTLGSK  159
            G G         +          P+IED  QFP+LG K
Sbjct  342  GRGEHRGFYGGFNGNGGRRHASAPAIEDQAQFPSLGGK  379



>ref|XP_009108330.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
 ref|XP_009108331.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
Length=367

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 111/157 (71%), Gaps = 9/157 (6%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E KR+G+GRGNWG+  DE+ P  EE    V  D     A EK+    +A DA K++P+
Sbjct  139  GNEFKRDGAGRGNWGTNEDEVPPVTEESTTVVEKD----LAVEKEG---EATDANKETPV  191

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            +    KEPED EMTL+EYEK+LEEKRKA+ +++ EERKV   K F+SM  L++KK N+DE
Sbjct  192  EAQAEKEPEDTEMTLEEYEKVLEEKRKALQSTKVEERKVDT-KVFDSMQQLSSKKSNNDE  250

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  294
            VF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE+
Sbjct  251  VFIKLGTEKDKRPVEREEKTKKSLSINEFLKPANGES  287



>ref|XP_006440206.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 ref|XP_006440207.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53446.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
 gb|ESR53447.1| hypothetical protein CICLE_v10020747mg [Citrus clementina]
Length=342

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 143/200 (72%), Gaps = 20/200 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLdepe  570
            +R G+GRG           E EEP    V +  NT+A EK  G+E+A DA K++P+DE E
Sbjct  160  RRSGTGRG-----------ETEEP----VAETENTNA-EKPSGEENAADANKENPVDEQE  203

Query  569  vkepedkEMTLDEYEKLLEEKRKAILASR-PEERKVCLDKEFESMALLANKKNDDEVFVK  393
             KEPE+KEMTL+EYEK+LEEKRKA+LA +  EERKV +D+EF+SM  L+NKK++D+VF+K
Sbjct  204  EKEPEEKEMTLEEYEKVLEEKRKALLALKTAEERKVDVDEEFKSMQPLSNKKSNDDVFIK  263

Query  392  LGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT  219
            +GSEK+ +K  A +  K KK+ SINEFLKPAEGE Y+ P GRGRGRG GS  G  G  ++
Sbjct  264  VGSEKDKRKDAADKEEKAKKSVSINEFLKPAEGERYFNPSGRGRGRGRGSRGGYGGSTSS  323

Query  218  SSFETPSIEDVGQFPTLGSK  159
            S+   P IED GQFP+LG K
Sbjct  324  SAA-APKIEDPGQFPSLGGK  342



>emb|CDX76567.1| BnaA08g08330D [Brassica napus]
Length=367

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 111/157 (71%), Gaps = 9/157 (6%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E KR+G+GRGNWG+  DE+ P  EE    V  D     A EK+    +A DA K++P+
Sbjct  139  GNEFKRDGAGRGNWGTTEDELPPVTEESTTVVEKD----LAVEKEG---EATDANKETPV  191

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            +    KEPED EMTL+EYEK+LEEKRKA+ +++ EERKV   K F+SM  L++KK N+DE
Sbjct  192  EAQAEKEPEDTEMTLEEYEKVLEEKRKALQSTKVEERKVDT-KVFDSMQQLSSKKSNNDE  250

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  294
            VF+KLG+EK+ +  E  EK KK+ SINEFLKPA GE+
Sbjct  251  VFIKLGTEKDKRPVEREEKTKKSLSINEFLKPANGES  287



>gb|ACG24258.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
Length=360

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 134/217 (62%), Gaps = 24/217 (11%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E KR+G+GR NWG+  D+I P  EE    VV+  +     EKQ G+ +A DAK ++P 
Sbjct  149  GNEDKRDGAGRANWGTTQDDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPA  204

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            ++ E K  + + MTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DE
Sbjct  205  EKAEEKPEDKE-MTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDE  262

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN  225
            VF+KLG+EK+ +  E  EK +K+ SINEFLKPA+G++YYRP G  +G   G G       
Sbjct  263  VFIKLGTEKDKRITEREEKTRKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQR  322

Query  224  N-----------------TSSFETPSIEDVGQFPTLG  165
            +                  +   TP+I D  QFPTLG
Sbjct  323  DGGRNQREGGRNQRDGGAAAQAPTPAIGDSAQFPTLG  359



>gb|EAY99238.1| hypothetical protein OsI_21200 [Oryza sativa Indica Group]
Length=383

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 133/212 (63%), Gaps = 9/212 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG E+KREGSGRGNWG+ TDE +A E  E +N         D  + +   +   D  K+
Sbjct  172  GRGYELKREGSGRGNWGTVTDEGLAQEVAEAVNTEEAPVTAEDEKKPEDVPQSEVDKDKE  231

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
            SP +E E KEPEDKEMTL+EYEK+LEEKRKA+LA + EERKV +DKE ++M  L+ KK +
Sbjct  232  SPENEEEEKEPEDKEMTLEEYEKVLEEKRKALLALKAEERKVEVDKELQAMQQLSVKKAN  291

Query  410  DEVFVKLGS---ekedkkkeagekvkktKSINEFLKPAEGE-----Tyyrpggrgrgrgh  255
            +EVF+KLGS    K+ +K E  E+ KK+ SINEFLKPAEGE        R  GRGRG   
Sbjct  292  EEVFIKLGSDKDLKKKEKDEKDERTKKSLSINEFLKPAEGERYYNPGRGRGRGRGRGDRG  351

Query  254  gsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
            G   G  G         P IED  QFP+LG K
Sbjct  352  GFYGGYNGNGGRRQAAAPVIEDQAQFPSLGGK  383



>ref|NP_193485.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
 emb|CAB10532.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78755.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL09735.1| AT4g17520/dl4795w [Arabidopsis thaliana]
 gb|AAL91151.1| unknown protein [Arabidopsis thaliana]
 gb|AAN65040.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83906.1| hyaluronan / mRNA binding family [Arabidopsis thaliana]
Length=360

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 134/217 (62%), Gaps = 24/217 (11%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+E KR+G+GR NWG+  D+I P  EE    VV+  +     EKQ G+ +A DAK ++P 
Sbjct  149  GNEDKRDGAGRANWGTTQDDITPVTEEST-AVVDKNL---TVEKQDGEGEATDAKNETPA  204

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
            ++ E K  + + MTL+EYEK+LEEK+KA+ A++ EERKV   K FE+M  L++KK N+DE
Sbjct  205  EKAEEKPEDKE-MTLEEYEKVLEEKKKALQATKVEERKVDT-KAFEAMQQLSSKKSNNDE  262

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGN  225
            VF+KLG+EK+ +  E  EK +K+ SINEFLKPA+G++YYRP G  +G   G G       
Sbjct  263  VFIKLGTEKDKRITEREEKTRKSLSINEFLKPADGKSYYRPRGGYQGGREGRGPREGNQR  322

Query  224  N-----------------TSSFETPSIEDVGQFPTLG  165
            +                  +   TP+I D  QFPTLG
Sbjct  323  DGGRNLREGGRNQRDGGAAAQAPTPAIGDSAQFPTLG  359



>gb|EYU19467.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
 gb|EYU19468.1| hypothetical protein MIMGU_mgv1a008831mg [Erythranthe guttata]
Length=361

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 144/209 (69%), Gaps = 13/209 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGV--VNDGVNTDAFEKQHGQEDAGDAKK  594
            G G+EIKREG GRGNWG+P +EI PE EEP   V  V D       EK+ G+++  DA K
Sbjct  158  GHGNEIKREGFGRGNWGTPNEEIVPEIEEPTTEVKKVIDS------EKKSGEDETDDANK  211

Query  593  DS-PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
            DS P ++ E +  E+KEMTL+EYEK+LEEKRK +L+ + E RKV +DKE ESM LL+NKK
Sbjct  212  DSSPKEKEEKEAEEEKEMTLEEYEKVLEEKRKTLLSMKSEARKVNVDKELESMQLLSNKK  271

Query  416  ND-DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGE--Tyyrpggrgrgrghgsg  246
             D D+VF+KLGS  +DK+KEA EK KK+ SINEFLKP EGE  +     GRGRGRG    
Sbjct  272  IDHDDVFIKLGS-DKDKRKEAAEKAKKSVSINEFLKPVEGEKYSRGGGRGRGRGRGREGF  330

Query  245  rggygGNNTSSFETPSIEDVGQFPTLGSK  159
             GG GG    S   P+IEDV QFP+LG K
Sbjct  331  GGGGGGGFGRSERAPAIEDVDQFPSLGGK  359



>ref|XP_002440127.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
 gb|EES18557.1| hypothetical protein SORBIDRAFT_09g026550 [Sorghum bicolor]
Length=373

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 137/214 (64%), Gaps = 16/214 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAK--  597
            GRG E+KREGSGRGNWG+ TDE IA E EE +       V     EKQ   ED   A+  
Sbjct  165  GRGFEMKREGSGRGNWGTTTDEFIARETEEGLKLEEKAPVP----EKQGALEDTPQAEEN  220

Query  596  ---KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
               KD+     E ++ EDKEMTL+E+EK+ EEKRK++LA + EERKV +D++ +SM  LA
Sbjct  221  KENKDA-TANEEEEKEEDKEMTLEEFEKIREEKRKSLLALKTEERKVEVDRDLQSMQPLA  279

Query  425  NKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrg  258
            NKK +DE+FVKLGS+    K+ +  +  E+ KK+ SINEFLKPAEGE YY   GRGRGRG
Sbjct  280  NKKGNDEIFVKLGSDKDALKKKENADRDERAKKSVSINEFLKPAEGERYYGGRGRGRGRG  339

Query  257  hgsgrggygGNNTSSFE-TPSIEDVGQFPTLGSK  159
               G  G  G    +    P+I+D  QFP+LG K
Sbjct  340  DRGGFRGGYGGGYHAPPAAPAIQDQSQFPSLGGK  373



>ref|XP_009108276.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X1 [Brassica rapa]
Length=342

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 134/210 (64%), Gaps = 16/210 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KREG+GRGNWG+P +E+     E + G           EK  G E   DAKK++
Sbjct  142  GRGGDFKREGAGRGNWGTPGEEVLVVETEEVAGA--------EIEKPAGDEVVADAKKEN  193

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN-KKND  411
              +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERKV   K FESM  L+N KK++
Sbjct  194  AAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKVDT-KVFESMQQLSNKKKSN  252

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            DE+F+KLGS+K+ +K +  EK KK  SINEFLKPAEGE YYR GGRG GRG G G    G
Sbjct  253  DEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGENYYRGGGRGGGRGRGRGGRDRG  312

Query  230  GNNTSSFE------TPSIEDVGQFPTLGSK  159
              +   F+       P+I D  QFP+LG K
Sbjct  313  VVSGGGFDGYRSEAAPAIGDTAQFPSLGGK  342



>ref|NP_001281195.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 gb|ACF84633.1| unknown [Zea mays]
 gb|ACR38621.1| unknown [Zea mays]
 tpg|DAA57852.1| TPA: hypothetical protein ZEAMMB73_322547 [Zea mays]
Length=378

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 138/213 (65%), Gaps = 14/213 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDA--GDAK  597
            G G E+KR+G+GRGNWG+ TDE IA +AE+         V     EKQ  Q DA   D  
Sbjct  170  GHGYEMKRDGAGRGNWGTATDELIAQDAEDSPKMEEAAPV----AEKQGEQNDAPAADEN  225

Query  596  KDS--PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            KD+       E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERKV +DK+ +S+  L+N
Sbjct  226  KDNKDATANEEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERKVEVDKDLQSLQPLSN  285

Query  422  KKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgs  249
            KK +DEVF+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRGRG   
Sbjct  286  KKENDEVFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRG  345

Query  248  grggygGNNTS---SFETPSIEDVGQFPTLGSK  159
            G  G  G   S   +   PSIED  QFP+LG K
Sbjct  346  GFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGGK  378



>ref|XP_003567795.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brachypodium distachyon]
Length=381

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 127/220 (58%), Gaps = 20/220 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAP-EAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---  600
            GRG  +KR+G+GRGNWG+ TDE  P E  EP+N    +       E +   EDA      
Sbjct  165  GRGFGMKRDGAGRGNWGTVTDEGLPQETVEPVN---TEETAAAVAEDEKKPEDAPPTEVE  221

Query  599  --KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
              K+ +  +E E +  EDKEMTL+EYEK+LEEKRKA+LA + EERKV +DKE +SM  L+
Sbjct  222  KDKEGAVNEEEEKEAEEDKEMTLEEYEKVLEEKRKALLALKAEERKVEVDKELQSMQQLS  281

Query  425  NKKNDDEVFVKLGSe---kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrgh  255
             KK  DEVF+KLGS+   K+ +  E  E+ KK+ SINEFLKPAEGE Y   G        
Sbjct  282  VKKVADEVFIKLGSDKELKKKENAEREERAKKSLSINEFLKPAEGERYNPGGRGRGRGFR  341

Query  254  gsgrggygGNNTSSFE--------TPSIEDVGQFPTLGSK  159
            G G    G N               P+IED  QFPTLG K
Sbjct  342  GRGELRGGYNGGGYNGGGGRRQAPAPAIEDQAQFPTLGGK  381



>emb|CAA66481.1| transcription factor [Vicia faba var. minor]
Length=370

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 142/208 (68%), Gaps = 10/208 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE KR+G+GRGNWG+  DE+    +E    VVN+       EK   + D  +  KD+
Sbjct  168  GRGSEFKRDGAGRGNWGTEADEVTQVTDE----VVNEAEKNFGDEKPAAENDVAEGNKDT  223

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KEPEDKEMTL+EYEKLLEEKRKA+ A + EERKV   KEFE+M  L+ KK++ 
Sbjct  224  PANEAEEKEPEDKEMTLEEYEKLLEEKRKALQALKTEERKVDT-KEFETMQALSCKKDNF  282

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGE---Tyyrpggrgrgrghgsgr  243
            E+F KLGS+K+ +K+     EK KK+ SINEFLKPAEGE        GGRGRGRG   G 
Sbjct  283  EIFAKLGSDKDKRKEAFDKEEKAKKSVSINEFLKPAEGEGYYNQGGRGGRGRGRGTRGGF  342

Query  242  ggygGNNTSSFETPSIEDVGQFPTLGSK  159
            GG+ GN+TS+   PSIED G FPTLG+K
Sbjct  343  GGFRGNSTSNVPAPSIEDPGHFPTLGAK  370



>gb|KDP28866.1| hypothetical protein JCGZ_14637 [Jatropha curcas]
Length=384

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 135/217 (62%), Gaps = 19/217 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKREGSGRGNWG+  DEI   +EE    V+N+G      EK  G+++AGD  K+S
Sbjct  173  GRGNEIKREGSGRGNWGTQNDEITQASEE----VINEGEKNLGDEKPVGEDEAGDGNKES  228

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLANKKND  411
              ++PE K+P++KEMTL+EYEK LEEKR+A+ A  + EERKV   KEFESM  L++KK  
Sbjct  229  SANDPEEKKPQEKEMTLEEYEKKLEEKRRALQALKKAEERKVDA-KEFESMLQLSSKKGT  287

Query  410  DEVFVKLGSekedkkkeagekvkktKS--INEFLKPAEGE-----------Tyyrpggrg  270
            D+VF+KLGS+K+ +K+   +  K  KS  INEFLKPAEGE                 G G
Sbjct  288  DDVFIKLGSDKDKRKEAFDKDEKAKKSVTINEFLKPAEGERYFNPGGRGRGRGRGSRGFG  347

Query  269  rgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                  +       +  S+   PSIED G+FPTLG K
Sbjct  348  NTDAMSNVVAPSSTDAMSNVVAPSIEDRGEFPTLGGK  384



>gb|EMS68133.1| hypothetical protein TRIUR3_26332 [Triticum urartu]
Length=785

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 131/225 (58%), Gaps = 21/225 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG EIKREG+GRGNWG+ +DE   +  E     +       A EKQ   EDA  A ++ 
Sbjct  166  GRGYEIKREGAGRGNWGTTSDEFVAQETE----ALKQDEKAPAPEKQGAPEDAPQADENK  221

Query  587  PL----depevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLAN  423
            P        E ++ ED EMTLDE+EK++EEKRKA+ A  + EERKV +DK+ ++M LL+ 
Sbjct  222  PTKDGATVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSEERKVEIDKDLQAMQLLST  281

Query  422  KKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPAEGETyyrpggrgrgrgh  255
            KK +DEVF+KLG++KE  KK+       + KK+ SINEFLKPAEGE +Y   GRG     
Sbjct  282  KKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKPAEGERFYGGRGRGGRGRG  341

Query  254  gsgrggygGNNTSSF---ETPSIEDVGQFPTLGSK*GIKPFLPSS  129
              G    G            P+I+D  QFPTLG K     FL SS
Sbjct  342  DRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGGK-----FLMSS  381



>ref|XP_002511578.1| RNA binding protein, putative [Ricinus communis]
 gb|EEF50247.1| RNA binding protein, putative [Ricinus communis]
Length=295

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G G+E KREG+GRGNWG+ TDEIA   EE     VN+G      EK  G+ +A D KK+S
Sbjct  168  GHGNEFKREGAGRGNWGTNTDEIAQVTEE----AVNEGEKNMGDEKPVGEGEAVDGKKES  223

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +EPE K+PEDKEMTL+EYEK+LEEKRKA+ A++ EERKV   KEF SM  L++KK  D
Sbjct  224  PTNEPEEKQPEDKEMTLEEYEKVLEEKRKALQATKAEERKVDT-KEFASMQQLSSKKGGD  282

Query  407  EVFVKL  390
            ++F+KL
Sbjct  283  DIFIKL  288



>ref|XP_008675099.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Zea mays]
 gb|ACG33523.1| plasminogen activator inhibitor 1 RNA-binding protein [Zea mays]
 tpg|DAA57847.1| TPA: plasminogen activator inhibitor 1 RNA-binding protein [Zea 
mays]
Length=378

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 134/217 (62%), Gaps = 22/217 (10%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEI-------APEAEEPINGVVNDGVNTDAFEKQHGQEDA  609
            G G E+KR+G+GRGNWG+ TDE+       +P+ EE        G   DA         A
Sbjct  170  GHGYEMKRDGAGRGNWGTATDELIAQDAEDSPKMEEAAPVAEKQGEQIDA--------PA  221

Query  608  GDAKKDS--PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMA  435
             D  KD+       E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERKV +DK+  S+ 
Sbjct  222  ADENKDNKDATANEEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERKVEVDKDLRSLQ  281

Query  434  LLANKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgr  261
             L+NKK +DEVF+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRGR
Sbjct  282  PLSNKKENDEVFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGR  341

Query  260  ghgsgrggygGNNTS---SFETPSIEDVGQFPTLGSK  159
            G   G  G  G   S   +   PSIED  QFP+LG K
Sbjct  342  GDRGGFRGGYGGGYSRGPAAAAPSIEDQAQFPSLGGK  378



>gb|ACL54182.1| unknown [Zea mays]
 gb|ACN34418.1| unknown [Zea mays]
Length=204

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 135/208 (65%), Gaps = 14/208 (7%)
 Frame = -1

Query  752  IKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDA--GDAKKDS--  588
            +KR+G+GRGNWG+ TDE IA +AE+         V     EKQ  Q DA   D  KD+  
Sbjct  1    MKRDGAGRGNWGTATDELIAQDAEDSPKMEEAAPV----AEKQGEQNDAPAADENKDNKD  56

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
                 E ++ EDKEMTL+E+EK+ EEKRKA+LA + EERKV +DK+ +S+  L+NKK +D
Sbjct  57   ATANEEEEKEEDKEMTLEEFEKIREEKRKALLALKAEERKVEVDKDLQSLQPLSNKKEND  116

Query  407  EVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            EVF+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRGRG   G  G 
Sbjct  117  EVFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGRGDRGGFRGG  176

Query  233  gGNNTS---SFETPSIEDVGQFPTLGSK  159
             G   S   +   PSIED  QFP+LG K
Sbjct  177  YGGGYSRGPAAAAPSIEDQAQFPSLGGK  204



>emb|CDY33522.1| BnaA06g35510D [Brassica napus]
Length=327

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 131/210 (62%), Gaps = 19/210 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR +++KREG+GRGNWG+  D+  P   EP   V    V  D         D  DAKKDS
Sbjct  127  GRSNDVKREGAGRGNWGTTEDDTPPPTVEPTTEVEKSPVAED---------DTTDAKKDS  177

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P  E E KEPEDKEMTL+EYEK+LEEK+KA+ A++ EERKV   K FESM  L+NKK ND
Sbjct  178  PAAEQEEKEPEDKEMTLEEYEKILEEKKKALQATKVEERKVDT-KVFESMQQLSNKKTND  236

Query  410  DEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
            +E+F+KLGS+K+ +K  A ++ K  K  SINEFLKPA+GE Y  P G  RGRG   GR  
Sbjct  237  EEIFIKLGSDKDKRKDAAEKEEKTKKSLSINEFLKPADGERYNNPRGGYRGRGGRGGRRD  296

Query  236  ygGNNTSSFE------TPSIEDVGQFPTLG  165
              G      +       P+I D  QFP+LG
Sbjct  297  GRGQRDGGNQRHGGAPAPAIGDSAQFPSLG  326



>gb|KHN27127.1| hypothetical protein glysoja_032895 [Glycine soja]
Length=319

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 129/198 (65%), Gaps = 10/198 (5%)
 Frame = -1

Query  740  GSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQED-AGDAKKDSPLdepevk  564
            G+GRGNWG  TDE A   +E     VN+       EK  G++D A    K++P +E E K
Sbjct  128  GAGRGNWGVQTDEFAQATDE-----VNETSKNFGDEKPSGEDDVAAIGNKENPANEAEEK  182

Query  563  epedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS  384
            EPEDKEMTL+EYEK+LEE+RKA+ A + EERKV   K FESM  L+NKK+ D++F+KLGS
Sbjct  183  EPEDKEMTLEEYEKVLEERRKALQALKTEERKVDT-KVFESMQQLSNKKDIDDIFIKLGS  241

Query  383  ekedkkkeagekvkktKS--INEFLKPAEGETyyr-pggrgrgrghgsgrggygGNNTSS  213
            +K+ +++   ++ K  KS  INEFLK  EGE+YY   G   R       RGGYGG  T++
Sbjct  242  DKDKRRETLEKEDKSKKSVNINEFLKSPEGESYYNPGGHGRRHGRGRGARGGYGGYATAN  301

Query  212  FETPSIEDVGQFPTLGSK  159
               PSIED GQFPTLG K
Sbjct  302  IPAPSIEDPGQFPTLGVK  319



>gb|KFK24045.1| hypothetical protein AALP_AAs42697U000600 [Arabis alpina]
Length=393

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 107/161 (66%), Gaps = 13/161 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G G+E KREG GRGNWG   D++AP  EE           T A EKQ  + +A DAKK+S
Sbjct  159  GHGNEDKREGGGRGNWGIIKDDVAPVTEE---------SKTVAVEKQGSKGEAADAKKES  209

Query  587  PLdepevkepedkEM--TLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-  417
            P  E    EPE + +  TL+EYEK++EEK+KA+  ++ EERKV   K F+SM  L+NK+ 
Sbjct  210  PAKEQAKSEPEPEPVEFTLEEYEKIMEEKKKALEVTKVEERKVDT-KVFDSMQQLSNKRS  268

Query  416  NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGET  294
            N+DEVF+KLG+EK+ +  E  EK KK+ SINEFLKP  G++
Sbjct  269  NNDEVFIKLGTEKDKRLVEKEEKAKKSLSINEFLKPVNGKS  309



>ref|XP_011093237.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
isoform X2 [Sesamum indicum]
Length=354

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 133/200 (67%), Gaps = 19/200 (10%)
 Frame = -1

Query  749  KREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAG-DAKKDSPLdep  573
            +R G+G+G              E + G    G+N    EK  G+EDA  D   ++  +E 
Sbjct  171  RRSGTGQGEA------------EGVGGEAEKGLNA---EKPSGEEDAAADGDNEAAKNEV  215

Query  572  evkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVK  393
              KEPE+KEMTL+EYEK+LEEKRKA+ A + EERKV + KEFES+  L+NKK +D+VF+K
Sbjct  216  GEKEPENKEMTLEEYEKVLEEKRKALQALKTEERKVDV-KEFESLKPLSNKKTNDDVFIK  274

Query  392  LGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygGNNT  219
            LGSEK+ K+   E  E+ KK  SINEFLKPAEGE YY PGGRGRGRG GS  G  GGN  
Sbjct  275  LGSEKDKKRELAEKEERAKKAVSINEFLKPAEGERYYNPGGRGRGRGRGSRGGYSGGNEM  334

Query  218  SSFETPSIEDVGQFPTLGSK  159
            S+ + PSIED GQFPTLG K
Sbjct  335  SNVKAPSIEDPGQFPTLGGK  354



>gb|EMT09866.1| hypothetical protein F775_32096 [Aegilops tauschii]
Length=339

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 136/217 (63%), Gaps = 18/217 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---  600
            GRG  +KR+G+GRGNWGS TDE +A E +E +   + D  N    EKQ  Q+DA      
Sbjct  127  GRGQGMKRDGAGRGNWGSSTDEGLAQETDEALK--IED--NAPIAEKQGEQDDAPPTTVE  182

Query  599  KKDSP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
            KKD      + E +  EDKEMTL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L+
Sbjct  183  KKDHKDGAAKEEEENEEDKEMTLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPLS  242

Query  425  NKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghg  252
             KK +DEVF+KLGS+KE KK+      + KK+ SINEFLKPAEGE YY   GRGRGRG G
Sbjct  243  TKKANDEVFIKLGSDKEKKKESTERDERAKKSLSINEFLKPAEGERYYGGRGRGRGRGEG  302

Query  251  sgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  159
             G  G                 PSIED  QFPTLG K
Sbjct  303  RGDRGGFRGGFGGGYQHGQAAAPSIEDQSQFPTLGGK  339



>dbj|BAJ89734.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=375

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 127/216 (59%), Gaps = 19/216 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDA-----GD  603
            GRG E+KREG+GRGNWG+  + +A E E      +       A EKQ  +EDA       
Sbjct  166  GRGYEMKREGAGRGNWGASDEFVAQETE-----ALKQDEKAPAPEKQGAREDAPKADENK  220

Query  602  AKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEERKVCLDKEFESMALLA  426
            A KD      E ++ ED EMTLDE+EK++EEKRKA+ A  + EERKV +DK+ ++M LL+
Sbjct  221  ASKDG-AAVVEEEKEEDNEMTLDEFEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLS  279

Query  425  NKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrg  258
             KK +DEVF+KLG++    K+ +  E  E+ KK+ SINEFLKPAEGE +Y   GRG    
Sbjct  280  TKKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKPAEGERFYGGRGRGGRGR  339

Query  257  hgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  159
               G    G            P+I+D  QFPTLG K
Sbjct  340  GDRGGFRGGFGGGGYHNPPPAPAIQDQNQFPTLGGK  375



>ref|XP_004492923.1| PREDICTED: intracellular hyaluronan-binding protein 4-like [Cicer 
arietinum]
Length=373

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 133/205 (65%), Gaps = 7/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE KREG+GRGNWG+ TDEIA   +E +N        +   EK   + +  +  KD+
Sbjct  174  GRGSEFKREGAGRGNWGTETDEIAQVTDEAVNEAEK---KSSGDEKPAVENEVAEGNKDN  230

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P +E E KE EDKEMTL+EYEKLLEEKRK + A + E RKV   KEFESM  L+ KK++ 
Sbjct  231  PANETEEKEAEDKEMTLEEYEKLLEEKRKVLQALKTEARKVDT-KEFESMQALSCKKDNT  289

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            E+F KLGS+K+ +K+     EK KK+ SINEFLKPAEGE  Y   G        + RGG 
Sbjct  290  EIFAKLGSDKDKRKEALDKEEKAKKSVSINEFLKPAEGEA-YYNPGGHGRGRGRATRGGI  348

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
             GN+ S+   PSIED G FPTLG+K
Sbjct  349  RGNSFSNIPAPSIEDPGHFPTLGAK  373



>gb|KHG04303.1| hypothetical protein F383_01005 [Gossypium arboreum]
Length=364

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 133/211 (63%), Gaps = 13/211 (6%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+E+KREG GRGNWG+ TDE+A   EE    V N+G      EK     D GDA K+S
Sbjct  159  GRGNELKREGFGRGNWGTQTDELAQVTEE----VANEGKQNLGDEKLARDGDGGDADKES  214

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+K MTL+EYE+L+EEKRKA+ A + E RKV   KEFESM  L+NKK++D
Sbjct  215  LTNELEEKEPEEKVMTLEEYEELMEEKRKALQALKTEGRKVDA-KEFESMQQLSNKKSND  273

Query  407  EVFVKLGSekedkkke--agekvkktKSINEFLKPAE-----GETyyrpggrgrgrghgs  249
            E+F+KLGS+K+ +K+     E+ KK+ SINEFLKP E      ++    G         S
Sbjct  274  EIFIKLGSDKDKRKEAYEKEERAKKSLSINEFLKPVERKRYYNQSGRGRGRGQDQGRGHS  333

Query  248  grggygGNNTSSF-ETPSIEDVGQFPTLGSK  159
             RG  GGN  SS    PSIED   FPTLG K
Sbjct  334  SRGFGGGNARSSMAAAPSIEDRSHFPTLGGK  364



>ref|XP_009605755.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Nicotiana tomentosiformis]
Length=363

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 135/208 (65%), Gaps = 11/208 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG EIKREG+GRGNWG+  DE+    +E    V N+G      EK   + +AGD KK++
Sbjct  162  GRGGEIKREGAGRGNWGTQADEVTQMTDE----VANEGEKNLNVEKLSTEGEAGDDKKEN  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E E KEPE+KEMTL+EYEKLLEEKR+A+ A + EERKV   KEFESM  L+ KK+ D
Sbjct  218  PAAEAEDKEPENKEMTLEEYEKLLEEKRQALQALKTEERKVDT-KEFESMQQLS-KKSSD  275

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            ++F+KL  + + ++    E+  K   SINEFLKPAEGE YY PGGRGRG      RG   
Sbjct  276  DIFIKLAPKDKRRESAEKEEKAKKAVSINEFLKPAEGERYYAPGGRGRGGRGRGSRGYGE  335

Query  230  G----NNTSSFETPSIEDVGQFPTLGSK  159
                 N TS+ E P IED G FPTLG K
Sbjct  336  DYGGVNTTSNVEAPPIEDPGHFPTLGGK  363



>gb|EMT08444.1| hypothetical protein F775_29168 [Aegilops tauschii]
Length=833

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 135/242 (56%), Gaps = 35/242 (14%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEA-------EEPINGVVNDGVNTDAF---------  636
            GRG EIKREG+GRGNWG+ +DEI  +         E   GVV     T+A          
Sbjct  166  GRGYEIKREGAGRGNWGTTSDEIVAQLFIRRVVKWEVTCGVVLVTRETEALKQDEKAPAP  225

Query  635  EKQHGQEDA-----GDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILA-SRPEE  474
            EKQ   EDA       A KD      E ++ ED EMTLDE+EK++EEKRKA+ A  + EE
Sbjct  226  EKQGAPEDAPQADENKATKDGA-AVVEEEKEEDNEMTLDEFEKVMEEKRKALAALKKSEE  284

Query  473  RKVCLDKEFESMALLANKKNDDEVFVKLGSekedkkkeage----kvkktKSINEFLKPA  306
            RKV +DK+ ++M LL+ KK +DEVF+KLG++KE  KK+       + KK+ SINEFLKPA
Sbjct  285  RKVEIDKDLQAMQLLSTKKGNDEVFIKLGADKEALKKKENAEREERAKKSVSINEFLKPA  344

Query  305  EGETyyrpggrgrgrghgsgrggygGNNTSSF---ETPSIEDVGQFPTLGSK*GIKPFLP  135
            EGE +Y   GRG       G    G            P+I+D  QFPTLG K     FL 
Sbjct  345  EGERFYGGRGRGGRGRGDRGGFRGGFGGGGYHGPPPAPAIQDQNQFPTLGGK-----FLL  399

Query  134  SS  129
            SS
Sbjct  400  SS  401



>gb|ABD65145.1| nuclear RNA binding protein, putative [Brassica oleracea]
 emb|CDY09622.1| BnaC07g34390D [Brassica napus]
Length=353

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 11/155 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            G G+  KR+G+GRGNWG+  DEI P  EE    VV   +   A EK+    +A DA K++
Sbjct  143  GHGNGFKRDGAGRGNWGTNEDEIPPVTEESA-AVVEKSL---AAEKEG---EATDANKET  195

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-ND  411
            P++E    E ++  MTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L+NKK N+
Sbjct  196  PVEEKAEPEDKE--MTLEEYEKVLEEKRKALQATKIEERKVDT-KVFETMQQLSNKKSNN  252

Query  410  DEVFVKLGSekedkkkeagekvkktKSINEFLKPA  306
            DEVF+KLG+EK+ +  E  EK KK+ SINEFLKPA
Sbjct  253  DEVFIKLGTEKDKRPVEKEEKTKKSLSINEFLKPA  287



>emb|CAC85227.1| salt tolerance protein 1 [Beta vulgaris]
Length=356

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 133/206 (65%), Gaps = 10/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG-VNTDAFEKQHGQEDAGDAKKD  591
            GRGSEIKREG+GRGNWG+ +DE+AP  EE   G  N+  +N    E     EDA D  K+
Sbjct  158  GRGSEIKREGAGRGNWGAESDEVAPVTEE--AGEQNEKKLNP---ENLPAVEDAADGIKE  212

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               DE E KEPE+KEMTL+EYEKLLEEKRKA+ A + EERKV +DK+FESM  L NKK D
Sbjct  213  GQPDETEEKEPEEKEMTLEEYEKLLEEKRKALSALKAEERKVEVDKDFESMQQLINKKKD  272

Query  410  -DEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
             D VF+KLGS+K+ KK+ A ++  K   SINEFLKPA  E     G          G G 
Sbjct  273  EDSVFIKLGSDKDKKKEAAEKEKVKKSVSINEFLKPA--EGDRYGGRGRGRGRGPRGGGY  330

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             GGN   S   P+IED G+FPTLG K
Sbjct  331  GGGNRMFSTSAPAIEDPGEFPTLGGK  356



>emb|CDY38403.1| BnaC01g10120D [Brassica napus]
Length=336

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 129/211 (61%), Gaps = 20/211 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAP--EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKK  594
              G E+KR+G+GRGNWG+  D+I P  E   P+       V TD   ++ G+  A DA  
Sbjct  135  AHGHELKRDGAGRGNWGTIEDDIPPVTEGSTPV-------VETDLAVEKEGE--ATDANN  185

Query  593  DSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANK  420
            ++P++    KEPE ++  MTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++K
Sbjct  186  ETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKVDT-KAFETMQQLSSK  244

Query  419  K-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgr  243
            K N+DEVF+KLG++K+ +  E  EK KK+ SINEFLKPA GE Y      GRGRG     
Sbjct  245  KSNNDEVFIKLGTDKDKRPVEKEEKTKKSLSINEFLKPANGERYRGGYRGGRGRGPRGAD  304

Query  242  g-----gygGNNTSSFETPSIEDVGQFPTLG  165
                    G +  ++   P IED   FPTLG
Sbjct  305  EGGRGPKGGADRKAAAPAPKIEDAAHFPTLG  335



>ref|XP_010692032.1| PREDICTED: uncharacterized protein DDB_G0288133-like [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 133/206 (65%), Gaps = 10/206 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDG-VNTDAFEKQHGQEDAGDAKKD  591
            GRGSEIKREG+GRGNWG+ +DE+AP  EE   G  N+  +N    E     EDA D  K+
Sbjct  158  GRGSEIKREGAGRGNWGAESDEVAPVTEE--AGEQNEKKLNP---ENLPAVEDAADGIKE  212

Query  590  SPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND  411
               DE E KEPE+KEMTL+EYEKLLEEKRKA+ A + EERKV +DK+FESM  L NKK D
Sbjct  213  GQPDETEEKEPEEKEMTLEEYEKLLEEKRKALSALKAEERKVEVDKDFESMQQLINKKKD  272

Query  410  -DEVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrgg  237
             D VF+KLGS+K+ KK+ A ++  K   SINEFLKPA  E     G          G G 
Sbjct  273  EDSVFIKLGSDKDKKKEAAEKEKVKKSVSINEFLKPA--EGDRYGGRGRGRGRGPRGGGY  330

Query  236  ygGNNTSSFETPSIEDVGQFPTLGSK  159
             GGN   S   P+IED G+FPTLG K
Sbjct  331  GGGNRMFSTAAPAIEDPGEFPTLGGK  356



>gb|EMS59053.1| hypothetical protein TRIUR3_33029 [Triticum urartu]
Length=296

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 135/217 (62%), Gaps = 18/217 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  +KR+G+GRGNWGS TDE +A E +E +   + D  N    EKQ  Q+DA     +
Sbjct  84   GRGQGMKRDGAGRGNWGSSTDEGLAQETDEALK--IED--NAPIAEKQGEQDDAPPTTVE  139

Query  590  SP-----LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLA  426
            +        + E +  EDKEMTL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L+
Sbjct  140  NKDLKDGAAKEEEENEEDKEMTLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPLS  199

Query  425  NKKNDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghg  252
             KK +DEVF+KLGS+KE KK+      + KK+ SINEFLKPAEGE YY   GRGRGRG G
Sbjct  200  TKKANDEVFIKLGSDKEKKKESTERDERAKKSLSINEFLKPAEGERYYGGRGRGRGRGEG  259

Query  251  sgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  159
             G  G                 PSIED  QFPTLG K
Sbjct  260  RGDRGGFRGGFGGGYQRGQAAAPSIEDRSQFPTLGGK  296



>ref|XP_003569708.1| PREDICTED: RNA-binding protein FUS-like [Brachypodium distachyon]
Length=377

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 130/211 (62%), Gaps = 10/211 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD  591
            GRG  +KR+G+GRGNWGS TDE +A E +E +   + D       + +H      +  KD
Sbjct  169  GRGFGMKRDGAGRGNWGSSTDEGLAQETDEALK--IEDNAPIAEKQDEHDDPPTTEENKD  226

Query  590  SP--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
            +     + E +  EDKEMTL+E+EK+ EEKRKA+LA + EERKV LDK+ +S+  L+ KK
Sbjct  227  NKDVAAKEEEENEEDKEMTLEEFEKIREEKRKALLALKTEERKVELDKDLQSLQPLSTKK  286

Query  416  NDDEVFVKLGSekedkkkeage--kvkktKSINEFLKPAEGETyyrpggrgrgrghgsgr  243
             +DE+F+KLGS+K+ KK+ A    + KK+ SINEFLKPAEGE YY   GRGRG     G 
Sbjct  287  ANDEIFIKLGSDKDKKKESAERDERAKKSVSINEFLKPAEGERYYGGRGRGRGGRGDRGG  346

Query  242  ggygGNNTSSFE---TPSIEDVGQFPTLGSK  159
               G            PSI+D  +FPTLG K
Sbjct  347  FRGGYGGGGYQRGPAAPSIQDQAEFPTLGGK  377



>emb|CDM84169.1| unnamed protein product [Triticum aestivum]
Length=381

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 133/218 (61%), Gaps = 20/218 (9%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---  600
            GRG  +KR+G+GRGNWGS TDE +A E +E +   + D  N    EKQ  Q+DA      
Sbjct  169  GRGQGMKRDGAGRGNWGSSTDEGLAQETDEALK--IED--NAPIAEKQGEQDDAPPTTVE  224

Query  599  ---KKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALL  429
                KD    + E +  EDKEMTL+E+EK+ EE+RKA+LA + EERKV +DK+ +S+  L
Sbjct  225  NKDHKDG-AAKEEEENEEDKEMTLEEFEKIREEQRKALLALKTEERKVEVDKDLQSLQPL  283

Query  428  ANKKNDDEVFVKLGSekedkkkeagekvkktK--SINEFLKPAEGETyyrpggrgrgrgh  255
            + KK +DEVF+KLGS+KE KK+      +  K  SINEFLKPAEGE YY   GRGRGRG 
Sbjct  284  STKKANDEVFIKLGSDKEKKKESTERDERAKKSLSINEFLKPAEGERYYGGRGRGRGRGE  343

Query  254  gsgrggygGNNTSSFE------TPSIEDVGQFPTLGSK  159
            G G  G                 PSIED  QFPTLG K
Sbjct  344  GRGDRGGFRGGFGGGYQRGQAAAPSIEDQSQFPTLGGK  381



>ref|NP_001275394.1| nuclear RNA binding protein [Solanum tuberosum]
 emb|CAR64523.1| nuclear RNA binding protein [Solanum tuberosum]
Length=360

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 135/204 (66%), Gaps = 7/204 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG+EIKREG+GRGNWG+  DE+     E    V ++G      EK   +E+AGD KK++
Sbjct  163  GRGNEIKREGAGRGNWGTEADEVTQMTGE----VADEGEKNLNVEKPSTEEEAGDDKKEN  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E E KEPEDKEMTL+EYEKLLEEKRKA+ A + EERKV   K FESM  ++ KK  D
Sbjct  219  PAAEAEDKEPEDKEMTLEEYEKLLEEKRKALQALKTEERKVDT-KVFESMQQIS-KKPSD  276

Query  407  EVFVKLGSekedkkkeagekvkktK-SINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            E+FVKLGS+ + K+    E+  K   SINEFLKPAEGE YY PGGRGRGRG GS      
Sbjct  277  EIFVKLGSKDKRKESAEKEEKAKKAVSINEFLKPAEGERYYAPGGRGRGRGRGSRGYSGA  336

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
               ++    P IED G FPTLG K
Sbjct  337  NTMSNVEAAPPIEDPGHFPTLGGK  360



>ref|XP_002991714.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
 gb|EFJ07285.1| hypothetical protein SELMODRAFT_448524 [Selaginella moellendorffii]
Length=421

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 124/205 (60%), Gaps = 9/205 (4%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GR + IKR+G+GRGNWG+P D ++ E    I GV  DG   +A E +  + +A    +++
Sbjct  224  GRSTGIKRDGAGRGNWGTPIDPVSVEEGNAIEGVKLDGAKLEAPEAEAPKSEAA---QET  280

Query  587  P--LdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKN  414
            P   +E + +E E+KEMTLDEYEK++EEKRKA+ A + EERKV  D EF+ M L+ +KK 
Sbjct  281  PEVTEEQKEEEKEEKEMTLDEYEKVMEEKRKALTAMKSEERKVVADSEFQKMQLV-DKKA  339

Query  413  DDEVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggy  234
            D+++F+KLG++K  KK+   +   K     EF K    E   + GGRG  RG G GRG  
Sbjct  340  DEDIFIKLGADKAKKKEGEKDDKTKKSVPIEFRK---SEAENQYGGRGGNRGRGRGRGLN  396

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
                 SS   P I D  QFP+LG K
Sbjct  397  NNTRLSSSSAPEIADFQQFPSLGGK  421



>ref|XP_003568032.1| PREDICTED: probable H/ACA ribonucleoprotein complex subunit 1 
[Brachypodium distachyon]
Length=376

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 133/217 (61%), Gaps = 18/217 (8%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDE-IAPEAEEPINGVVNDGVNTDAFEKQHG--QEDAGDAK  597
            GRG E+KREG+GRGNWG+ +DE +A E  E     +     T   EKQ     EDA  A+
Sbjct  164  GRGYEMKREGAGRGNWGTTSDEFLAQETGE----TLKLDEKTPIPEKQGALLTEDAPQAE  219

Query  596  KDS----PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALL  429
            +           E ++ EDKEMTL+E+EK+LEEKRKA+LA + EERKV +DK+ ++M  L
Sbjct  220  ESKVSKEATVNEEEEKEEDKEMTLEEFEKVLEEKRKALLALKSEERKVEIDKDLQAMQQL  279

Query  428  ANKKNDDEVFVKLGSe----kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgr  261
            + KK +DEVF+KLGS+    K+ +  E  E+ KK+ SINEFLKPAEGE +Y   GRGRGR
Sbjct  280  STKKGNDEVFIKLGSDKDALKKKENAERDERAKKSVSINEFLKPAEGERFYGGRGRGRGR  339

Query  260  ghgsgrggygGNNTSSFE---TPSIEDVGQFPTLGSK  159
            G   G    G            P+I+D  QFPTLG K
Sbjct  340  GGDRGGFRGGAGGGGYRGPPAAPAIQDQNQFPTLGGK  376



>dbj|BAJ96699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 126/222 (57%), Gaps = 31/222 (14%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAK--K  594
            GRG  +KR+G+GRGNWG+ TDE  P+             N +A   +     A DAK  +
Sbjct  160  GRGFGMKRDGAGRGNWGTATDEGFPQE------------NVEAVNTEETPAVAEDAKTPE  207

Query  593  DSPLdepev------------kepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKE  450
            D+PL E E             +  EDKEMTL+EYEK+LEEKRKAILA + EERKV +DKE
Sbjct  208  DAPLPEAEKVKEGAENAEEEKEAEEDKEMTLEEYEKVLEEKRKAILALKAEERKVEVDKE  267

Query  449  FESMALLANKKNDDEVFVKLGSekedkkkeagekvkktKS--INEFLKPAE---GETyyr  285
             +SM  L+ KK+ +EVF+KLGS+KE KK  A  + +  KS  INEFLKPAE         
Sbjct  268  LQSMQQLSVKKDAEEVFIKLGSDKEKKKDNAEREERAKKSLNINEFLKPAEGERYNGGRG  327

Query  284  pggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
             G   RGRG   G    GG        P+IED  QFPTLG K
Sbjct  328  RGRGFRGRGEPRGGYNGGGGGRRPAAAPAIEDQSQFPTLGGK  369



>gb|ABI18976.1| nuclear-localized RNA binding protein [Capsicum annuum]
Length=360

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 135/204 (66%), Gaps = 6/204 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSEIKREG+GRGNWG+  DE+     E    V N+G      EK   +E+AGD KK++
Sbjct  162  GRGSEIKREGAGRGNWGTEADEVTQMTGE----VANEGEKNLNVEKPSTEEEAGDDKKEN  217

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
             + E E KEPEDKEMTL+EYEKLLEEKRKA+ A +  E +    K FESM  L+ KK+ D
Sbjct  218  LVAEAEDKEPEDKEMTLEEYEKLLEEKRKALQALKTAEERKVDTKVFESMQQLS-KKSGD  276

Query  407  EVFVKLGSe-kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            E+FVKLGS+ K+ +  E  EK KK  SINEFLKPAEGE YY PGGRGRGRG GS      
Sbjct  277  EIFVKLGSKDKKRESAEKEEKAKKAVSINEFLKPAEGERYYAPGGRGRGRGRGSRGYSGA  336

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
               ++    P IED G FPTLG K
Sbjct  337  STTSNVEAAPPIEDPGHFPTLGGK  360



>ref|XP_004229741.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Solanum lycopersicum]
Length=360

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 135/204 (66%), Gaps = 7/204 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSEIKREG+GRGNWG+  DE+     E    V ++G      EK   +E+AG  KK++
Sbjct  163  GRGSEIKREGAGRGNWGTEADEVTLMTGE----VADEGEKNLNVEKPSTEEEAGVDKKEN  218

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
            P  E   KEPEDKEMTL+EYEKLLEEKRKA+ A + EERKV   K FESM  ++ KK+ D
Sbjct  219  PAAEAADKEPEDKEMTLEEYEKLLEEKRKALQALKTEERKVDT-KVFESMQQIS-KKSSD  276

Query  407  EVFVKLGSe-kedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggyg  231
            E+FVKLGS+ K  +  E  EK KK  SINEFLKPAEGE YY PGGRGRGRG GS      
Sbjct  277  EIFVKLGSKDKRKESAEKEEKAKKAVSINEFLKPAEGERYYAPGGRGRGRGRGSRGYSEA  336

Query  230  GNNTSSFETPSIEDVGQFPTLGSK  159
               ++    P IED G FPTLG K
Sbjct  337  NTMSNVEAAPPIEDPGHFPTLGGK  360



>gb|AAF14245.1|AF110229_1 nuclear RNA binding protein B [Spinacia oleracea]
Length=240

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 134/205 (65%), Gaps = 6/205 (3%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRGSE+KREGSGRGNWG+ ++E+AP  EE   GV     N ++ E     EDA    K+ 
Sbjct  40   GRGSEVKREGSGRGNWGAESEEVAPVNEE---GVEQTEKNVNS-ENLTAVEDAAVGNKEG  95

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +E E KEPE+KEMTL+EYEKLLEEKRKA+LA + EE KV +DKE ESM  L+ +++D 
Sbjct  96   QPEEAEEKEPEEKEMTLEEYEKLLEEKRKALLALKSEEPKVVVDKELESMQQLSKQQDDS  155

Query  407  EVFVKLGS-ekedkkkeagekvkktKSINEFLKPA-EGETyyrpggrgrgrghgsgrggy  234
             VF+KLGS + + K+    EKVKK+ SINEFLKPA       R  GRG     G   GG 
Sbjct  156  SVFIKLGSDKDKKKEALEKEKVKKSVSINEFLKPAEGERFGGRGRGRGGRGSRGGEYGGG  215

Query  233  gGNNTSSFETPSIEDVGQFPTLGSK  159
            GGN T S   P+I D G+FPTLG K
Sbjct  216  GGNRTYSAPAPAIGDPGEFPTLGGK  240



>ref|XP_009130695.1| PREDICTED: intracellular hyaluronan-binding protein 4-like [Brassica 
rapa]
Length=347

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 17/160 (11%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQE---DAGDAK  597
              G E+KR+G+GRGNWG+  D+I P         V +G +T   EK    E   +A DA 
Sbjct  136  AHGHELKRDGAGRGNWGTIEDDIPP---------VTEG-STPVVEKDLAVEKEGEASDAN  185

Query  596  KDSPLdepevkepedkE--MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLAN  423
            K++P++    KEPE ++  MTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L++
Sbjct  186  KETPVEAQAEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKVDT-KAFETMQQLSS  244

Query  422  KK-NDDEVFVKLGSekedkkkeagekvkktKSINEFLKPA  306
            KK N+DEVF+KLG++K+ +  E  EK KK+ SINEFLKPA
Sbjct  245  KKSNNDEVFIKLGTDKDKRPVEKEEKTKKSLSINEFLKPA  284



>emb|CDY43474.1| BnaC08g10790D [Brassica napus]
Length=420

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 131/207 (63%), Gaps = 15/207 (7%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDS  588
            GRG + KRE +GRGNWG+P +E+     E + G           EK  G E A DAKK++
Sbjct  114  GRGGDFKREEAGRGNWGTPGEEVLVVETEEVAGA--------EIEKSAGDEVAADAKKEN  165

Query  587  PLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDD  408
              +  E KEPEDKEMTLDEYEK+LEEK+K++ +    ERK    K FESM  L+NKK++D
Sbjct  166  TAEVEEQKEPEDKEMTLDEYEKILEEKKKSLQSQTTSERKFDT-KVFESMQQLSNKKSND  224

Query  407  EVFVKLGSekedkkkeagekvkktKSINEFLKPAEGETyyrpggrgrgrghgsgrggygG  228
            E+F+KL S+K+ +K +  EK KK  SINEFLKPAEGE +YR GGRG GRG G G    GG
Sbjct  225  EIFIKLDSDKDKRKDDKEEKAKKAVSINEFLKPAEGENHYRGGGRGGGRGRGRGGRDRGG  284

Query  227  NNTSSFE------TPSIEDVGQFPTLG  165
             +   F+        +I D  QFP+LG
Sbjct  285  VSGGVFDGYRSEAASAIGDTAQFPSLG  311



>ref|XP_008459800.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Cucumis melo]
Length=364

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 141/217 (65%), Gaps = 32/217 (15%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTD---EIAPEA--------EEPINGVVNDGVNTDAFEKQHG  621
            GRG+E KREGSGRGNWG  TD   E+A EA        E+P++     GVNT+   K+  
Sbjct  166  GRGNEFKREGSGRGNWGRSTDEFPEVAEEANESQKLGDEKPVHEDGTAGVNTENTAKESE  225

Query  620  QEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFES  441
            +++  D +                 MTL+EYEKLLEEKRK++LA + EERKV   KEF S
Sbjct  226  EKEPEDKE-----------------MTLEEYEKLLEEKRKSLLALKTEERKVDP-KEFAS  267

Query  440  MALLANKKNDDEVFVKLGSekedkk--keagekvkktKSINEFLKPAEGETyyrpggrgr  267
            +  L++KK + +VF+KLGS+K+ +K   +  E+ KK+ SINEFLKPA+GE +Y PGGRGR
Sbjct  268  LQQLSSKKENQDVFIKLGSDKDKRKEIADKEERTKKSVSINEFLKPADGERHYTPGGRGR  327

Query  266  grghgsgrggygGNNTSS-FETPSIEDVGQFPTLGSK  159
            GRG GS  GGY  ++ SS    PSIED GQFPTLG+K
Sbjct  328  GRGRGSRGGGYVSSSMSSNVAAPSIEDPGQFPTLGAK  364



>ref|XP_006655517.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Oryza brachyantha]
Length=363

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 87/131 (66%), Gaps = 6/131 (5%)
 Frame = -1

Query  767  GRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDA---K  597
            GRG E+KREG+GRGNWG+  DEI   A+E    +  D       EKQ   EDA  A   K
Sbjct  167  GRGYEMKREGAGRGNWGTTADEIL--AQETGEALKLD-EKAPVSEKQSPLEDAPQADENK  223

Query  596  KDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK  417
             +      E ++ EDKEMTL+E+EKL EEKRKA+L+ + EERKV +DK+ +SM  L+NKK
Sbjct  224  DNKDATPKEEEKEEDKEMTLEEFEKLREEKRKALLSLKTEERKVEIDKDLQSMQPLSNKK  283

Query  416  NDDEVFVKLGS  384
             +DEVF+KLGS
Sbjct  284  ENDEVFIKLGS  294



>ref|XP_009136852.1| PREDICTED: plasminogen activator inhibitor 1 RNA-binding protein-like 
[Brassica rapa]
Length=353

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+  KR+G+GRGNWG+  DEI P  EE    VV   +   A EK+    +A DA K++  
Sbjct  144  GNGFKRDGAGRGNWGTNEDEIPPVTEESA-AVVEKSL---AVEKEG---EATDANKET-P  195

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
             E +  EPEDKEMTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L+NKK N+DE
Sbjct  196  VEEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKVDT-KVFETMQQLSNKKSNNDE  254

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPA  306
            VF+KLG+EK+ +  E  EK KK+ SINEFLKPA
Sbjct  255  VFIKLGTEKDKRPVEKEEKTKKSLSINEFLKPA  287



>emb|CDX90469.1| BnaA03g43120D [Brassica napus]
Length=353

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 10/153 (7%)
 Frame = -1

Query  761  GSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPL  582
            G+  KR+G+GRGNWG+  DEI P  EE    VV   +   A EK+    +A DA K++  
Sbjct  144  GNGFKRDGAGRGNWGTNEDEIPPVTEESA-AVVEKSL---AVEKEG---EATDANKET-P  195

Query  581  depevkepedkEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKK-NDDE  405
             E +  EPEDKEMTL+EYEK+LEEKRKA+ A++ EERKV   K FE+M  L+NKK N+DE
Sbjct  196  VEEKEPEPEDKEMTLEEYEKVLEEKRKALQATKIEERKVDT-KVFETMQQLSNKKSNNDE  254

Query  404  VFVKLGSekedkkkeagekvkktKSINEFLKPA  306
            VF+KLG+EK+ +  E  EK KK+ SINEFLKPA
Sbjct  255  VFIKLGTEKDKRPVEKEEKTKKSLSINEFLKPA  287



>ref|XP_010053520.1| PREDICTED: H/ACA ribonucleoprotein complex subunit 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW77832.1| hypothetical protein EUGRSUZ_D02118 [Eucalyptus grandis]
Length=352

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 111/173 (64%), Gaps = 10/173 (6%)
 Frame = -1

Query  647  TDAFEKQHGQEDAGDAKKDSPLdepevkepedkEMTLDEYEKLLEEKRKAILASRPEERK  468
            T   EKQ   ED  DA K+ PL+EPE KEPEDKEMTL+EYEK+ EE RK++LA + EERK
Sbjct  180  TGGSEKQLAGEDGADASKEKPLNEPEEKEPEDKEMTLEEYEKVFEENRKSLLALKTEERK  239

Query  467  VCLDKEFESMALLANKKND-DEVFVKLGSekedk--kkeagekvkktKSINEFLKPAEGE  297
            V LDK+ +SM  L+NKK D +++F+KLG EK+ +    E  EK KK+ SINEFLKPAEGE
Sbjct  240  VELDKDLKSMQQLSNKKKDNNDIFIKLGCEKDKRKEAAEKEEKAKKSVSINEFLKPAEGE  299

Query  296  -------TyyrpggrgrgrghgsgrggygGNNTSSFETPSIEDVGQFPTLGSK  159
                        G   RG   G G GG GG        PSIED GQFP+LG K
Sbjct  300  RYYNPGGRGRGRGRGARGGYGGGGGGGGGGGYARDVSAPSIEDPGQFPSLGGK  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890