BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF046B04

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004491086.1|  PREDICTED: protein disulfide isomerase-like ...    224   2e-67   Cicer arietinum [garbanzo]
ref|XP_010913398.1|  PREDICTED: protein disulfide isomerase-like 2-3    224   2e-67   Elaeis guineensis
ref|XP_009804684.1|  PREDICTED: protein disulfide isomerase-like 2-3    223   4e-67   Nicotiana sylvestris
ref|XP_009606235.1|  PREDICTED: protein disulfide isomerase-like 2-3    222   8e-67   Nicotiana tomentosiformis
ref|XP_011085485.1|  PREDICTED: protein disulfide isomerase-like 2-3    221   2e-66   Sesamum indicum [beniseed]
ref|XP_004243508.1|  PREDICTED: protein disulfide isomerase-like 2-3    221   4e-66   Solanum lycopersicum
ref|XP_006357974.1|  PREDICTED: protein disulfide isomerase-like ...    219   1e-65   Solanum tuberosum [potatoes]
ref|XP_003519441.1|  PREDICTED: protein disulfide isomerase-like ...    218   3e-65   Glycine max [soybeans]
ref|XP_009365136.1|  PREDICTED: protein disulfide isomerase-like 2-3    218   7e-65   Pyrus x bretschneideri [bai li]
ref|XP_010252582.1|  PREDICTED: protein disulfide isomerase-like 2-3    217   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008805603.1|  PREDICTED: protein disulfide isomerase-like 2-3    216   2e-64   Phoenix dactylifera
ref|NP_001236576.1|  protein disulfide isomerse like protein prec...    216   2e-64   Glycine max [soybeans]
ref|XP_004304072.1|  PREDICTED: protein disulfide isomerase-like 2-3    216   3e-64   Fragaria vesca subsp. vesca
ref|XP_011003479.1|  PREDICTED: protein disulfide isomerase-like 2-3    216   3e-64   Populus euphratica
ref|XP_008456396.1|  PREDICTED: protein disulfide isomerase-like 2-3    216   4e-64   Cucumis melo [Oriental melon]
ref|XP_002320494.2|  thioredoxin family protein                         215   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_007049203.1|  PDI-like 2-2                                       215   5e-64   Theobroma cacao [chocolate]
ref|XP_007141667.1|  hypothetical protein PHAVU_008G215100g             214   8e-64   Phaseolus vulgaris [French bean]
ref|XP_011100470.1|  PREDICTED: protein disulfide isomerase-like 2-3    214   1e-63   Sesamum indicum [beniseed]
ref|XP_011016519.1|  PREDICTED: protein disulfide isomerase-like 2-3    214   2e-63   Populus euphratica
gb|KDP30825.1|  hypothetical protein JCGZ_13768                         213   2e-63   Jatropha curcas
ref|XP_008342147.1|  PREDICTED: protein disulfide isomerase-like 2-3    213   3e-63   Malus domestica [apple tree]
ref|XP_008379697.1|  PREDICTED: protein disulfide isomerase-like 2-3    212   8e-63   
ref|XP_004165750.1|  PREDICTED: protein disulfide-isomerase like ...    211   2e-62   
ref|XP_004143192.1|  PREDICTED: protein disulfide-isomerase like ...    211   2e-62   Cucumis sativus [cucumbers]
ref|XP_009409222.1|  PREDICTED: protein disulfide isomerase-like ...    211   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003616851.1|  Protein disulfide isomerase family                 211   2e-62   Medicago truncatula
ref|XP_009409223.1|  PREDICTED: protein disulfide isomerase-like ...    211   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB42838.1|  hypothetical protein B456_007G169700                    210   5e-62   Gossypium raimondii
ref|XP_008229815.1|  PREDICTED: protein disulfide isomerase-like 2-3    210   7e-62   Prunus mume [ume]
ref|XP_010035498.1|  PREDICTED: protein disulfide isomerase-like 2-3    209   7e-62   Eucalyptus grandis [rose gum]
gb|AFK43048.1|  unknown                                                 209   1e-61   Lotus japonicus
gb|KHN44746.1|  Protein disulfide isomerase-like 2-3                    209   1e-61   Glycine soja [wild soybean]
ref|XP_006661300.1|  PREDICTED: protein disulfide isomerase-like ...    208   2e-61   
ref|NP_001063331.1|  Os09g0451500                                       208   3e-61   
gb|ACU17741.1|  unknown                                                 208   3e-61   Glycine max [soybeans]
gb|EEC84682.1|  hypothetical protein OsI_31602                          208   4e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_007215346.1|  hypothetical protein PRUPE_ppa005396mg             208   4e-61   Prunus persica
ref|NP_001167822.1|  uncharacterized protein LOC100381521               197   2e-60   
ref|XP_006469595.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    206   2e-60   
ref|XP_002276520.1|  PREDICTED: protein disulfide isomerase-like 2-3    205   5e-60   Vitis vinifera
tpg|DAA40211.1|  TPA: putative thioredoxin superfamily protein          197   8e-60   
ref|XP_006829505.1|  hypothetical protein AMTR_s00074p00124400          204   1e-59   Amborella trichopoda
gb|KJB10306.1|  hypothetical protein B456_001G195100                    203   1e-59   Gossypium raimondii
gb|KJB10301.1|  hypothetical protein B456_001G195100                    203   2e-59   Gossypium raimondii
ref|XP_010270061.1|  PREDICTED: protein disulfide isomerase-like ...    202   2e-59   
ref|XP_003578205.1|  PREDICTED: protein disulfide isomerase-like 2-3    203   2e-59   Brachypodium distachyon [annual false brome]
gb|KDO59567.1|  hypothetical protein CISIN_1g014216mg                   202   3e-59   Citrus sinensis [apfelsine]
ref|XP_010270060.1|  PREDICTED: protein disulfide isomerase-like ...    202   5e-59   Nelumbo nucifera [Indian lotus]
dbj|BAJ84858.1|  predicted protein                                      202   6e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460311.1|  hypothetical protein SORBIDRAFT_02g026300          202   6e-59   Sorghum bicolor [broomcorn]
ref|XP_006447669.1|  hypothetical protein CICLE_v10015327mg             202   6e-59   Citrus clementina [clementine]
ref|XP_010110229.1|  Protein disulfide-isomerase like 2-2               202   7e-59   
ref|NP_001105804.1|  protein disulfide isomerase8 precursor             201   1e-58   Zea mays [maize]
dbj|BAO79454.1|  protein disulfide isomerase family protein 5-1         201   1e-58   Triticum aestivum [Canadian hard winter wheat]
emb|CBG91899.1|  putative PDI-like protein                              201   1e-58   Triticum aestivum [Canadian hard winter wheat]
emb|CBG91909.1|  putative PDI-like protein                              201   2e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004956980.1|  PREDICTED: protein disulfide isomerase-like ...    200   3e-58   Setaria italica
emb|CBG91908.1|  putative PDI-like protein                              199   6e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010556968.1|  PREDICTED: protein disulfide-isomerase like ...    199   8e-58   Tarenaya hassleriana [spider flower]
gb|EYU43141.1|  hypothetical protein MIMGU_mgv1a006693mg                197   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_008668262.1|  PREDICTED: uncharacterized protein LOC100381...    197   4e-57   
ref|XP_010475171.1|  PREDICTED: protein disulfide-isomerase like 2-2    196   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010484503.1|  PREDICTED: protein disulfide-isomerase like ...    195   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009143922.1|  PREDICTED: protein disulfide-isomerase 2-3         194   7e-56   Brassica rapa
emb|CDY52544.1|  BnaA05g35030D                                          194   7e-56   Brassica napus [oilseed rape]
emb|CDY12149.1|  BnaC04g11790D                                          194   8e-56   Brassica napus [oilseed rape]
ref|XP_006418074.1|  hypothetical protein EUTSA_v10007682mg             194   9e-56   Eutrema salsugineum [saltwater cress]
gb|ACN39830.1|  unknown                                                 193   2e-55   Picea sitchensis
ref|XP_010688926.1|  PREDICTED: protein disulfide isomerase-like 2-3    193   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010509948.1|  PREDICTED: protein disulfide-isomerase 2-3 i...    193   2e-55   
ref|XP_010413931.1|  PREDICTED: protein disulfide-isomerase 2-3-like    193   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010469533.1|  PREDICTED: protein disulfide-isomerase 2-3-like    192   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010522374.1|  PREDICTED: protein disulfide-isomerase 2-3-like    191   5e-55   Tarenaya hassleriana [spider flower]
ref|XP_006294195.1|  hypothetical protein CARUB_v10023191mg             191   9e-55   
ref|XP_002881252.1|  hypothetical protein ARALYDRAFT_482234             191   1e-54   
gb|KFK31099.1|  hypothetical protein AALP_AA6G068000                    191   1e-54   Arabis alpina [alpine rockcress]
ref|XP_006410429.1|  hypothetical protein EUTSA_v10016663mg             191   1e-54   Eutrema salsugineum [saltwater cress]
ref|XP_006306333.1|  hypothetical protein CARUB_v10012209mg             190   2e-54   Capsella rubella
gb|AAF40463.1|AC004809_21  Strong simialrity to the disulfide iso...    190   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119218.1|  PREDICTED: protein disulfide-isomerase like 2-2    190   2e-54   Brassica rapa
ref|NP_171990.3|  protein disulfide-isomerase like 2-2                  190   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892256.1|  hypothetical protein ARALYDRAFT_470488             189   4e-54   Arabidopsis lyrata subsp. lyrata
ref|NP_180851.1|  protein disulfide-isomerase like 2-3                  188   1e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY18278.1|  BnaC05g03010D                                          188   1e-53   Brassica napus [oilseed rape]
emb|CDX79497.1|  BnaC03g18330D                                          187   4e-53   
gb|KHN38504.1|  Protein disulfide isomerase-like 2-3                    185   5e-53   Glycine soja [wild soybean]
gb|KHG30032.1|  Protein disulfide-isomerase like 2-2                    181   6e-51   Gossypium arboreum [tree cotton]
emb|CDP05711.1|  unnamed protein product                                174   7e-50   Coffea canephora [robusta coffee]
gb|KDO59568.1|  hypothetical protein CISIN_1g014216mg                   176   2e-49   Citrus sinensis [apfelsine]
gb|KHG02314.1|  Protein disulfide-isomerase like 2-2                    171   1e-47   Gossypium arboreum [tree cotton]
gb|EEE54954.1|  hypothetical protein OsJ_02527                          168   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001780684.1|  predicted protein                                  164   1e-44   
gb|EMT02125.1|  Protein disulfide-isomerase A6                          161   8e-44   
ref|XP_002976616.1|  hypothetical protein SELMODRAFT_232834             162   1e-43   Selaginella moellendorffii
ref|XP_002973288.1|  hypothetical protein SELMODRAFT_232026             161   1e-43   Selaginella moellendorffii
gb|EMS60415.1|  hypothetical protein TRIUR3_13550                       148   8e-42   Triticum urartu
dbj|BAJ90795.1|  predicted protein                                      129   9e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAE88097.1|  unnamed protein product                                125   1e-31   Macaca fascicularis [crab eating macaque]
gb|EAX00949.1|  protein disulfide isomerase family A, member 6, i...    125   1e-31   Homo sapiens [man]
ref|XP_004642404.1|  PREDICTED: protein disulfide-isomerase A6          128   4e-31   
ref|XP_419952.1|  PREDICTED: protein disulfide-isomerase A6 isofo...    127   4e-31   Gallus gallus [bantam]
ref|XP_011397768.1|  Protein disulfide-isomerase like 2-2               130   4e-31   Auxenochlorella protothecoides
ref|XP_010706217.1|  PREDICTED: protein disulfide-isomerase A6          127   6e-31   Meleagris gallopavo [common turkey]
ref|NP_001253564.1|  protein disulfide-isomerase A6 precursor           126   1e-30   Macaca mulatta [rhesus macaque]
ref|NP_001080305.1|  protein disulfide isomerase family A, member...    126   1e-30   Xenopus laevis [clawed frog]
ref|NP_001233576.1|  protein disulfide-isomerase A6 precursor           126   1e-30   Pan troglodytes
ref|XP_010627358.1|  PREDICTED: protein disulfide-isomerase A6          126   1e-30   
ref|NP_001126483.1|  protein disulfide-isomerase A6 precursor           126   1e-30   Pongo abelii [orang utan]
ref|NP_005733.1|  protein disulfide-isomerase A6 isoform d precursor    126   1e-30   Homo sapiens [man]
ref|XP_004028893.1|  PREDICTED: protein disulfide-isomerase A6 is...    126   1e-30   
gb|AAB50217.1|  protein disulfide isomerase-related protein 5           125   1e-30   Homo sapiens [man]
ref|NP_001269636.1|  protein disulfide-isomerase A6 isoform e pre...    126   1e-30   Homo sapiens [man]
ref|NP_001269635.1|  protein disulfide-isomerase A6 isoform c           126   1e-30   Homo sapiens [man]
ref|XP_009181940.1|  PREDICTED: protein disulfide-isomerase A6 is...    125   1e-30   
dbj|BAH12614.1|  unnamed protein product                                126   2e-30   Homo sapiens [man]
ref|XP_003272792.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    125   2e-30   
ref|XP_007529904.1|  PREDICTED: protein disulfide-isomerase A6          125   2e-30   Erinaceus europaeus [common hedgehog]
ref|XP_010377997.1|  PREDICTED: protein disulfide-isomerase A6          126   2e-30   Rhinopithecus roxellana
gb|EHH21891.1|  hypothetical protein EGK_05054                          126   2e-30   Macaca mulatta [rhesus macaque]
dbj|BAG54757.1|  unnamed protein product                                126   2e-30   Homo sapiens [man]
ref|XP_003908325.1|  PREDICTED: protein disulfide-isomerase A6 is...    125   2e-30   Papio anubis [baboon]
ref|XP_005044328.1|  PREDICTED: protein disulfide-isomerase A6          125   2e-30   Ficedula albicollis
ref|NP_001269634.1|  protein disulfide-isomerase A6 isoform b           126   2e-30   Homo sapiens [man]
ref|XP_004274932.1|  PREDICTED: protein disulfide-isomerase A6          125   2e-30   
ref|XP_001948267.2|  PREDICTED: protein disulfide-isomerase A6          125   2e-30   Acyrthosiphon pisum
gb|KFO31202.1|  Protein disulfide-isomerase A6                          125   2e-30   Fukomys damarensis [Damara mole rat]
dbj|BAC86977.1|  unnamed protein product                                125   2e-30   Homo sapiens [man]
ref|XP_004310310.1|  PREDICTED: protein disulfide-isomerase A6 is...    125   2e-30   
ref|NP_001269633.1|  protein disulfide-isomerase A6 isoform a           125   2e-30   Homo sapiens [man]
ref|XP_007933283.1|  PREDICTED: protein disulfide-isomerase A6          125   2e-30   Orycteropus afer afer
ref|XP_001744606.1|  hypothetical protein                               125   3e-30   Monosiga brevicollis MX1
ref|XP_004870016.1|  PREDICTED: protein disulfide-isomerase A6          125   3e-30   Heterocephalus glaber [naked mole rat]
gb|EHB04452.1|  Protein disulfide-isomerase A6                          125   3e-30   Heterocephalus glaber [naked mole rat]
ref|XP_002758076.1|  PREDICTED: protein disulfide-isomerase A6          125   3e-30   Callithrix jacchus [common marmoset]
ref|XP_010280693.1|  PREDICTED: protein disulfide-isomerase A6          125   4e-30   Phaethon lepturus
gb|AAI48887.1|  PDIA6 protein                                           125   4e-30   Bos taurus [bovine]
gb|KFQ65954.1|  Protein disulfide-isomerase A6                          124   4e-30   Phaethon lepturus
ref|XP_006257985.1|  PREDICTED: protein disulfide-isomerase A6          125   4e-30   
ref|NP_001086643.1|  protein disulfide isomerase family A, member...    124   4e-30   Xenopus laevis [clawed frog]
ref|XP_002117070.1|  hypothetical protein TRIADDRAFT_50999              124   4e-30   Trichoplax adhaerens
ref|XP_006021844.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    124   4e-30   
ref|XP_004887060.1|  PREDICTED: protein disulfide-isomerase A6          125   4e-30   
ref|XP_004005735.1|  PREDICTED: protein disulfide-isomerase A6 is...    124   5e-30   
ref|XP_004696438.1|  PREDICTED: protein disulfide-isomerase A6          124   5e-30   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004005734.1|  PREDICTED: protein disulfide-isomerase A6 is...    124   5e-30   
ref|NP_001193274.1|  protein disulfide-isomerase A6 precursor           124   5e-30   Bos taurus [bovine]
ref|XP_005327417.1|  PREDICTED: protein disulfide-isomerase A6          122   5e-30   
ref|XP_005687063.1|  PREDICTED: protein disulfide-isomerase A6          124   5e-30   
gb|ELR58675.1|  Protein disulfide-isomerase A6                          124   6e-30   Bos mutus
gb|ELK29163.1|  Protein disulfide-isomerase A6                          124   6e-30   Myotis davidii
ref|XP_005366580.1|  PREDICTED: protein disulfide-isomerase A6          124   7e-30   Microtus ochrogaster [prairie voles]
ref|XP_006976688.1|  PREDICTED: protein disulfide-isomerase A6          125   7e-30   Peromyscus maniculatus bairdii
ref|XP_004459385.1|  PREDICTED: protein disulfide-isomerase A6          124   8e-30   Dasypus novemcinctus
ref|XP_532876.2|  PREDICTED: protein disulfide-isomerase A6             124   8e-30   Canis lupus familiaris [dogs]
gb|AAH06865.2|  Protein disulfide isomerase associated 6                124   9e-30   Mus musculus [mouse]
ref|NP_082235.1|  protein disulfide-isomerase A6 precursor              124   9e-30   
ref|XP_010850414.1|  PREDICTED: protein disulfide-isomerase A6          124   9e-30   Bison bison bison
ref|XP_006140909.1|  PREDICTED: protein disulfide-isomerase A6          124   9e-30   
dbj|BAE39477.1|  unnamed protein product                                124   1e-29   Mus musculus [mouse]
sp|Q922R8.3|PDIA6_MOUSE  RecName: Full=Protein disulfide-isomeras...    124   1e-29   Mus musculus [mouse]
ref|XP_011062424.1|  PREDICTED: protein disulfide-isomerase A6          124   1e-29   Acromyrmex echinatior
ref|XP_008848336.1|  PREDICTED: protein disulfide-isomerase A6          123   1e-29   Nannospalax galili
ref|XP_003787439.1|  PREDICTED: protein disulfide-isomerase A6          123   1e-29   Otolemur garnettii
ref|XP_006765261.1|  PREDICTED: protein disulfide-isomerase A6          124   1e-29   
ref|XP_003411934.1|  PREDICTED: protein disulfide-isomerase A6          123   1e-29   Loxodonta africana [African bush elephant]
tpg|DAA24511.1|  TPA: protein disulfide isomerase family A, member 6    124   1e-29   Bos taurus [bovine]
ref|XP_004373116.1|  PREDICTED: protein disulfide-isomerase A6          123   1e-29   Trichechus manatus latirostris
ref|XP_003462749.1|  PREDICTED: protein disulfide-isomerase A6 is...    123   1e-29   Cavia porcellus [guinea pig]
ref|XP_006073828.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    124   2e-29   
ref|XP_005000363.1|  PREDICTED: protein disulfide-isomerase A6 is...    123   2e-29   Cavia porcellus [guinea pig]
ref|XP_010336276.1|  PREDICTED: protein disulfide-isomerase A6          124   2e-29   Saimiri boliviensis boliviensis
gb|KFP75924.1|  Protein disulfide-isomerase A6                          122   2e-29   Acanthisitta chloris
ref|XP_008160636.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Eptesicus fuscus
ref|XP_007127699.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   
ref|XP_007456979.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Lipotes vexillifer [baiji]
ref|XP_006903376.1|  PREDICTED: protein disulfide-isomerase A6-like     123   2e-29   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006869520.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Chrysochloris asiatica
ref|XP_008570350.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Galeopterus variegatus [Malayan flying lemur]
ref|XP_009068583.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Acanthisitta chloris
ref|XP_003984581.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   
ref|XP_004436529.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   
ref|XP_010962323.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Camelus bactrianus [camel]
ref|XP_006197174.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Vicugna pacos
ref|XP_005967905.1|  PREDICTED: protein disulfide-isomerase A6          122   2e-29   Pantholops hodgsonii [Tibetan antelope]
gb|EPQ08422.1|  Protein disulfide-isomerase A6                          122   2e-29   Myotis brandtii
ref|XP_005085000.1|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005867329.1|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   
ref|XP_004609467.1|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   
ref|XP_007607763.1|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   
ref|XP_006102414.1|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   
ref|XP_006191925.1|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   Camelus ferus
ref|XP_001502324.3|  PREDICTED: protein disulfide-isomerase A6          122   3e-29   
ref|NP_001182048.1|  protein disulfide-isomerase A6 precursor           122   3e-29   Sus scrofa [pigs]
ref|XP_001602967.1|  PREDICTED: probable protein disulfide-isomer...    122   3e-29   Nasonia vitripennis
ref|XP_009940378.1|  PREDICTED: protein disulfide-isomerase A6          122   4e-29   Opisthocomus hoazin [hoatzin]
ref|NP_001004442.1|  protein disulfide-isomerase A6 precursor           122   4e-29   Rattus norvegicus [brown rat]
gb|AGX25157.1|  disulfide-isomerase                                     117   4e-29   Leptinotarsa decemlineata
gb|KFR16570.1|  Protein disulfide-isomerase A6                          122   4e-29   Opisthocomus hoazin [hoatzin]
emb|CAA55891.1|  CaBP1                                                  121   5e-29   Rattus norvegicus [brown rat]
ref|XP_005238268.1|  PREDICTED: protein disulfide-isomerase A6          122   5e-29   
sp|Q63081.2|PDIA6_RAT  RecName: Full=Protein disulfide-isomerase ...    121   5e-29   Rattus norvegicus [brown rat]
ref|XP_007080745.1|  PREDICTED: protein disulfide-isomerase A6          119   5e-29   
gb|EPY75602.1|  protein disulfide-isomerase A6                          122   5e-29   Camelus ferus
ref|XP_002921563.2|  PREDICTED: protein disulfide-isomerase A6          122   5e-29   Ailuropoda melanoleuca
ref|XP_005404513.1|  PREDICTED: protein disulfide-isomerase A6          123   5e-29   
gb|EGW08481.1|  Protein disulfide-isomerase A6                          119   6e-29   Cricetulus griseus [Chinese hamsters]
ref|XP_004665748.1|  PREDICTED: protein disulfide-isomerase A6          121   7e-29   Jaculus jaculus
ref|XP_010018621.1|  PREDICTED: protein disulfide-isomerase A6          121   7e-29   Nestor notabilis
gb|KFU90776.1|  Protein disulfide-isomerase A6                          121   7e-29   Chaetura pelagica
gb|KFQ44656.1|  Protein disulfide-isomerase A6                          121   7e-29   Nestor notabilis
ref|XP_009997534.1|  PREDICTED: protein disulfide-isomerase A6          121   8e-29   Chaetura pelagica
ref|XP_004746019.1|  PREDICTED: protein disulfide-isomerase A6          121   8e-29   
ref|XP_010073176.1|  PREDICTED: protein disulfide-isomerase A6          121   9e-29   Pterocles gutturalis
gb|KFU96864.1|  Protein disulfide-isomerase A6                          121   9e-29   Pterocles gutturalis
ref|XP_006745860.1|  PREDICTED: protein disulfide-isomerase A6          120   9e-29   Leptonychotes weddellii
gb|KFV66878.1|  Protein disulfide-isomerase A6                          120   9e-29   Picoides pubescens
ref|XP_004401842.1|  PREDICTED: protein disulfide-isomerase A6          120   9e-29   Odobenus rosmarus divergens
ref|XP_005146160.1|  PREDICTED: protein disulfide-isomerase A6          121   1e-28   Melopsittacus undulatus
ref|XP_009898142.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Picoides pubescens
ref|XP_006818500.1|  PREDICTED: protein disulfide-isomerase A6-like     116   1e-28   Saccoglossus kowalevskii
ref|XP_005432317.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   
gb|ELK13980.1|  Protein disulfide-isomerase A6                          120   1e-28   Pteropus alecto
ref|XP_009330780.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Pygoscelis adeliae
ref|XP_009585693.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Fulmarus glacialis
ref|XP_010304195.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Balearica regulorum gibbericeps
gb|KFW86281.1|  Protein disulfide-isomerase A6                          120   1e-28   Phalacrocorax carbo [common cormorant]
gb|KFW73081.1|  Protein disulfide-isomerase A6                          120   1e-28   Pygoscelis adeliae
ref|XP_009489926.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Pelecanus crispus
ref|XP_009513284.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Phalacrocorax carbo [common cormorant]
ref|XP_003757912.1|  PREDICTED: protein disulfide-isomerase A6          120   1e-28   Sarcophilus harrisii
gb|ERE68284.1|  protein disulfide-isomerase A6-like protein             115   1e-28   Cricetulus griseus [Chinese hamsters]
gb|KGL97075.1|  Protein disulfide-isomerase A6                          120   1e-28   Charadrius vociferus
gb|KFO12540.1|  Protein disulfide-isomerase A6                          120   1e-28   Balearica regulorum gibbericeps
gb|KFQ57711.1|  Protein disulfide-isomerase A6                          120   1e-28   Pelecanus crispus
gb|KFV98779.1|  Protein disulfide-isomerase A6                          120   2e-28   Fulmarus glacialis
emb|CAJ82905.1|  protein disulfide isomerase family A, member 6         120   2e-28   Xenopus tropicalis [western clawed frog]
ref|XP_009273886.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
ref|XP_009806227.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Gavia stellata
ref|XP_011160406.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Solenopsis invicta [imported red fire ant]
gb|KFV71961.1|  Protein disulfide-isomerase A6                          120   2e-28   Struthio camelus australis
ref|XP_007476199.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Monodelphis domestica
ref|XP_006817847.1|  PREDICTED: protein disulfide-isomerase A6-like     118   2e-28   Saccoglossus kowalevskii
ref|XP_009638086.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Egretta garzetta
ref|XP_002002212.1|  GI13846                                            120   2e-28   Drosophila mojavensis
ref|XP_010391624.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Corvus cornix cornix
ref|XP_009981655.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Tauraco erythrolophus
ref|XP_009874965.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Apaloderma vittatum
ref|XP_008639999.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Corvus brachyrhynchos
ref|XP_010564977.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Haliaeetus leucocephalus
ref|XP_010145729.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Eurypyga helias
ref|XP_009913272.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Haliaeetus albicilla
ref|XP_009961799.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Tyto alba [Schleiereule]
gb|KFQ00948.1|  Protein disulfide-isomerase A6                          120   2e-28   Haliaeetus albicilla
ref|XP_010114738.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Chlamydotis macqueenii
ref|NP_001007974.1|  protein disulfide-isomerase A6 precursor           120   2e-28   Xenopus tropicalis [western clawed frog]
gb|KFM05020.1|  Protein disulfide-isomerase A6                          120   2e-28   Aptenodytes forsteri
ref|XP_009463744.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    120   2e-28   Nipponia nippon
ref|XP_005521916.1|  PREDICTED: protein disulfide-isomerase A6 is...    120   2e-28   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFV91574.1|  Protein disulfide-isomerase A6                          120   2e-28   Eurypyga helias
gb|KFO65258.1|  Protein disulfide-isomerase A6                          120   2e-28   Corvus brachyrhynchos
gb|KFV15259.1|  Protein disulfide-isomerase A6                          120   2e-28   Tauraco erythrolophus
gb|KFQ83261.1|  Protein disulfide-isomerase A6                          120   2e-28   Phoenicopterus ruber ruber
gb|EMC90288.1|  Protein disulfide-isomerase A6                          120   2e-28   
ref|XP_009888074.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Charadrius vociferus
gb|KFZ68639.1|  Protein disulfide-isomerase A6                          120   2e-28   Podiceps cristatus
gb|KFV41194.1|  Protein disulfide-isomerase A6                          120   2e-28   Gavia stellata
gb|KFP35427.1|  Protein disulfide-isomerase A6                          120   2e-28   Chlamydotis macqueenii
ref|XP_008930983.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
gb|KFQ39965.1|  Protein disulfide-isomerase A6                          120   2e-28   Mesitornis unicolor
gb|KFP92383.1|  Protein disulfide-isomerase A6                          120   2e-28   Apaloderma vittatum
gb|KFP16755.1|  Protein disulfide-isomerase A6                          120   2e-28   Egretta garzetta
ref|XP_008935557.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Merops nubicus
ref|XP_009666708.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Struthio camelus australis
ref|XP_005521917.1|  PREDICTED: protein disulfide-isomerase A6 is...    120   2e-28   
gb|KFQ26878.1|  Protein disulfide-isomerase A6                          120   2e-28   Merops nubicus
gb|KFO87204.1|  Protein disulfide-isomerase A6                          120   2e-28   Buceros rhinoceros silvestris
ref|XP_008493616.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   Calypte anna
gb|KFV46902.1|  Protein disulfide-isomerase A6                          120   2e-28   Tyto alba [Schleiereule]
ref|XP_010130331.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
ref|XP_009557934.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
ref|XP_005506964.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
ref|XP_007668730.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
gb|KFO75223.1|  Protein disulfide-isomerase A6                          120   2e-28   
ref|XP_006012215.1|  PREDICTED: protein disulfide-isomerase A6 is...    120   2e-28   
gb|KFW88870.1|  Protein disulfide-isomerase A6                          120   2e-28   
ref|XP_006910476.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
gb|KFO95889.1|  Protein disulfide-isomerase A6                          119   2e-28   
ref|XP_011343321.1|  PREDICTED: protein disulfide-isomerase A6 is...    119   2e-28   
ref|XP_011343320.1|  PREDICTED: protein disulfide-isomerase A6 is...    119   2e-28   
ref|XP_010189304.1|  PREDICTED: protein disulfide-isomerase A6          120   2e-28   
ref|XP_006626132.1|  PREDICTED: protein disulfide-isomerase A6-like     119   2e-28   
ref|XP_011206958.1|  PREDICTED: protein disulfide-isomerase A6          119   3e-28   
ref|XP_002052260.1|  GJ17455                                            119   3e-28   
ref|XP_010222649.1|  PREDICTED: protein disulfide-isomerase A6          119   3e-28   
gb|KGL83930.1|  Protein disulfide-isomerase A6                          119   3e-28   
ref|XP_009702308.1|  PREDICTED: protein disulfide-isomerase A6          119   3e-28   
gb|ACI33422.1|  disulfide-isomerase A6 precursor                        119   3e-28   
ref|XP_008528120.1|  PREDICTED: protein disulfide-isomerase A6          119   3e-28   
ref|XP_395981.2|  PREDICTED: protein disulfide-isomerase A6-like ...    119   3e-28   
ref|XP_006612487.1|  PREDICTED: protein disulfide-isomerase A6-like     119   3e-28   
ref|XP_007640104.1|  PREDICTED: protein disulfide-isomerase A6          119   4e-28   
ref|XP_007423659.1|  PREDICTED: protein disulfide-isomerase A6          119   4e-28   
ref|XP_003693801.1|  PREDICTED: protein disulfide-isomerase A6-like     119   4e-28   
ref|XP_010836180.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    119   4e-28   
ref|XP_003971872.1|  PREDICTED: protein disulfide-isomerase A6-like     119   4e-28   
ref|XP_001996440.1|  GH25032                                            119   4e-28   
gb|KFP66932.1|  Protein disulfide-isomerase A6                          119   4e-28   
ref|XP_004686132.1|  PREDICTED: protein disulfide-isomerase A6          119   4e-28   
ref|XP_005293176.1|  PREDICTED: protein disulfide-isomerase A6          119   5e-28   
ref|XP_007053233.1|  PREDICTED: protein disulfide-isomerase A6          118   6e-28   
ref|XP_011363442.1|  PREDICTED: protein disulfide-isomerase A6          120   6e-28   
emb|CDQ71639.1|  unnamed protein product                                118   7e-28   
gb|ETE67495.1|  Protein disulfide-isomerase A6                          118   8e-28   
ref|XP_009946939.1|  PREDICTED: protein disulfide-isomerase A6          118   9e-28   
ref|XP_011301143.1|  PREDICTED: protein disulfide-isomerase A6          118   9e-28   
ref|XP_002586165.1|  hypothetical protein BRAFLDRAFT_289141             118   9e-28   
ref|XP_008063733.1|  PREDICTED: protein disulfide-isomerase A6          119   9e-28   
ref|XP_004518575.1|  PREDICTED: protein disulfide-isomerase A6-like     118   9e-28   
gb|KFQ08834.1|  Protein disulfide-isomerase A6                          118   9e-28   
ref|XP_006138598.1|  PREDICTED: protein disulfide-isomerase A6          118   9e-28   
ref|XP_003215468.2|  PREDICTED: protein disulfide-isomerase A6          118   1e-27   
ref|XP_010166959.1|  PREDICTED: protein disulfide-isomerase A6          117   1e-27   
gb|KIZ01312.1|  protein disulfide isomerase family A, member 6          119   1e-27   
ref|XP_011139061.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   1e-27   
ref|XP_011139060.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   1e-27   
ref|XP_005246202.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   1e-27   
ref|XP_004582660.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   2e-27   
emb|CAG03659.1|  unnamed protein product                                117   2e-27   
ref|XP_004083501.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   2e-27   
ref|XP_011489880.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   2e-27   
ref|XP_004582659.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   2e-27   
ref|XP_005963820.1|  PREDICTED: protein disulfide-isomerase A6-like     117   2e-27   
ref|XP_003488434.1|  PREDICTED: protein disulfide-isomerase A6-like     117   2e-27   
tpg|DAA24981.1|  TPA: PDIA6 protein-like                                117   2e-27   
ref|XP_002953269.1|  hypothetical protein VOLCADRAFT_105867             117   2e-27   
ref|XP_003398403.1|  PREDICTED: protein disulfide-isomerase A6-like     117   2e-27   
emb|CDY23780.1|  BnaC04g43420D                                          117   3e-27   
ref|XP_006711919.1|  PREDICTED: protein disulfide-isomerase A6 is...    117   3e-27   
ref|XP_009093512.1|  PREDICTED: protein disulfide-isomerase A6          116   3e-27   
gb|KIH51511.1|  hypothetical protein ANCDUO_18403                       111   4e-27   
gb|KDR20898.1|  Protein disulfide-isomerase A6                          116   4e-27   
gb|KFP27162.1|  Protein disulfide-isomerase A6                          116   4e-27   
ref|XP_005487253.1|  PREDICTED: protein disulfide-isomerase A6 is...    116   4e-27   
ref|XP_008287318.1|  PREDICTED: protein disulfide-isomerase A6          116   4e-27   
ref|XP_002196421.2|  PREDICTED: protein disulfide-isomerase A6          116   4e-27   
ref|XP_002015314.1|  GL18482                                            116   4e-27   
ref|XP_005420347.1|  PREDICTED: protein disulfide-isomerase A6          116   4e-27   
ref|XP_005487254.1|  PREDICTED: protein disulfide-isomerase A6 is...    116   4e-27   
ref|XP_005803193.1|  PREDICTED: protein disulfide-isomerase A6-li...    116   4e-27   
gb|ADK26817.1|  protein disulfide isomerase family A, member 6          116   4e-27   
ref|XP_010206382.1|  PREDICTED: protein disulfide-isomerase A6          116   4e-27   
ref|XP_005014200.1|  PREDICTED: protein disulfide-isomerase A6          115   5e-27   
ref|XP_005803194.1|  PREDICTED: protein disulfide-isomerase A6-li...    116   5e-27   
ref|XP_008248061.1|  PREDICTED: protein disulfide-isomerase A6          116   5e-27   
ref|XP_011294207.1|  PREDICTED: probable protein disulfide-isomer...    115   5e-27   
ref|XP_007546392.1|  PREDICTED: protein disulfide-isomerase A6 is...    115   6e-27   
ref|XP_007546385.1|  PREDICTED: protein disulfide-isomerase A6 is...    115   6e-27   
ref|XP_001690462.1|  protein disulfide isomerase                        115   7e-27   
gb|EFB24563.1|  hypothetical protein PANDA_010457                       115   8e-27   
ref|XP_003706812.1|  PREDICTED: protein disulfide-isomerase A6-like     115   9e-27   
ref|XP_008395805.1|  PREDICTED: protein disulfide-isomerase A6 is...    115   9e-27   
ref|XP_008395804.1|  PREDICTED: protein disulfide-isomerase A6 is...    115   1e-26   
ref|XP_002038169.1|  GM17901                                            115   1e-26   
ref|XP_006792591.1|  PREDICTED: protein disulfide-isomerase A6-li...    115   1e-26   
ref|XP_002079636.1|  GD21912                                            115   1e-26   
ref|NP_609792.1|  calcium-binding protein 1, isoform A                  115   1e-26   
ref|XP_008543798.1|  PREDICTED: protein disulfide-isomerase A6          115   1e-26   
ref|XP_006792592.1|  PREDICTED: protein disulfide-isomerase A6-li...    115   1e-26   
ref|XP_007195772.1|  PREDICTED: protein disulfide-isomerase A6          115   1e-26   
gb|ADK26725.1|  protein disulfide isomerase family A, member 6          114   1e-26   
ref|XP_001356908.2|  GA19146                                            114   1e-26   
gb|KIH43421.1|  hypothetical protein ANCDUO_26572                       111   2e-26   
ref|XP_005731103.1|  PREDICTED: protein disulfide-isomerase A6-like     114   2e-26   
gb|EFX87790.1|  hypothetical protein DAPPUDRAFT_306380                  114   2e-26   
ref|XP_005645986.1|  protein disulfide isomerase                        114   2e-26   
ref|XP_003458276.1|  PREDICTED: protein disulfide-isomerase A6-like     114   2e-26   
ref|XP_001965403.1|  GF20619                                            114   2e-26   
ref|XP_004211312.1|  PREDICTED: protein disulfide-isomerase A6-like     114   2e-26   
ref|XP_001660597.1|  AAEL010065-PA                                      114   3e-26   
ref|XP_004568810.1|  PREDICTED: protein disulfide-isomerase A6-li...    114   3e-26   
ref|XP_004568809.1|  PREDICTED: protein disulfide-isomerase A6-li...    114   3e-26   
ref|XP_001976216.1|  GG20128                                            113   4e-26   
ref|XP_011187125.1|  PREDICTED: probable protein disulfide-isomer...    113   4e-26   
ref|XP_009045951.1|  hypothetical protein LOTGIDRAFT_151365             113   4e-26   
ref|XP_002090414.1|  GE12817                                            113   5e-26   
gb|KFB40746.1|  hypothetical protein ZHAS_00008173                      113   5e-26   
gb|ETN79262.1|  protein disulfide-isomerase domain protein              113   5e-26   
gb|EFA11123.1|  hypothetical protein TcasGA2_TC004723                   113   5e-26   
sp|P38660.1|PDIA6_MESAU  RecName: Full=Protein disulfide-isomeras...    113   5e-26   
gb|EMP42001.1|  Protein disulfide-isomerase A6                          113   5e-26   
ref|XP_008200598.1|  PREDICTED: protein disulfide-isomerase A6          113   6e-26   
ref|XP_790496.3|  PREDICTED: protein disulfide-isomerase A6-like        112   7e-26   
gb|KHN88358.1|  putative protein disulfide-isomerase A6                 112   8e-26   
ref|XP_010738984.1|  PREDICTED: protein disulfide-isomerase A6          112   8e-26   
ref|XP_008487078.1|  PREDICTED: protein disulfide-isomerase A6-like     112   9e-26   
ref|XP_001848695.1|  disulfide-isomerase A6                             112   1e-25   
gb|EYB96325.1|  hypothetical protein Y032_0151g2809                     112   1e-25   
gb|EYB96326.1|  hypothetical protein Y032_0151g2809                     112   1e-25   
ref|XP_008311310.1|  PREDICTED: protein disulfide-isomerase A6          112   1e-25   
gb|ADD24382.1|  Probable protein disulfide-isomerase A6                 112   1e-25   
gb|KHJ46223.1|  protein disulfide-isomerase domain protein              111   2e-25   
ref|XP_003117834.1|  CRE-TAG-320 protein                                111   2e-25   
gb|KFD51103.1|  hypothetical protein M513_08003                         111   2e-25   
emb|CDW52124.1|  protein disulfide isomerase A6                         111   3e-25   
ref|XP_010887778.1|  PREDICTED: protein disulfide-isomerase A6          111   3e-25   
ref|XP_011505126.1|  PREDICTED: probable protein disulfide-isomer...    110   3e-25   
ref|XP_004932411.1|  PREDICTED: protein disulfide-isomerase A6-like     110   4e-25   
ref|XP_002066865.1|  GK24326                                            109   7e-25   
ref|XP_002428877.1|  protein disulfide isomerase, putative              109   9e-25   
ref|XP_011266529.1|  PREDICTED: protein disulfide-isomerase A6          109   1e-24   
emb|CEF61969.1|  Protein disulfide-isomerase A6                         109   1e-24   
gb|ADY90107.1|  protein disulfide isomerase A6                          109   1e-24   
ref|XP_003744350.1|  PREDICTED: protein disulfide-isomerase A6-like     109   1e-24   
ref|XP_011446200.1|  PREDICTED: protein disulfide-isomerase A6-like     108   1e-24   
gb|KHJ93089.1|  protein disulfide-isomerase domain protein              108   1e-24   
gb|KFM68865.1|  Protein disulfide-isomerase A6                          108   2e-24   
gb|ETN58364.1|  protein disulfide-isomerase A6 precursor                108   2e-24   
emb|CDJ95511.1|  Thioredoxin domain containing protein                  108   2e-24   
gb|EHJ66984.1|  hypothetical protein KGM_18501                          108   2e-24   
ref|XP_321144.3|  AGAP001919-PA                                         108   2e-24   
ref|XP_002587888.1|  hypothetical protein BRAFLDRAFT_124879             109   2e-24   
gb|EGT52939.1|  CBN-TAG-320 protein                                     108   3e-24   
ref|XP_001629218.1|  predicted protein                                  108   3e-24   
gb|ACN60302.1|  disulfide-isomerase A6 precursor                        105   4e-24   
ref|XP_007260937.1|  PREDICTED: protein disulfide-isomerase A6-like     105   5e-24   
gb|ELT97169.1|  hypothetical protein CAPTEDRAFT_222278                  107   6e-24   
ref|XP_010781928.1|  PREDICTED: protein disulfide-isomerase A6          107   8e-24   
ref|XP_007902471.1|  PREDICTED: protein disulfide-isomerase A6-like     107   8e-24   
gb|EFO25483.2|  TAG-320 protein                                         107   9e-24   
ref|XP_003138581.1|  TAG-320 protein                                    106   9e-24   
ref|NP_509190.1|  Protein TAG-320                                       106   1e-23   
emb|CDQ62935.1|  unnamed protein product                                106   1e-23   
gb|ACI34364.1|  disulfide-isomerase A6 precursor                        106   2e-23   
ref|XP_007257385.1|  PREDICTED: protein disulfide-isomerase A6          106   2e-23   
gb|AAK71636.1|AF387900_1  protein disulfide isomerase-related pro...    105   2e-23   
gb|EFN84761.1|  Protein disulfide-isomerase A6                          105   2e-23   
gb|EJW84631.1|  hypothetical protein WUBG_04457                         104   3e-23   
gb|ELK31098.1|  Protein disulfide-isomerase A6                          101   3e-23   
ref|NP_001265732.1|  protein disulfide-isomerase A6 precursor           105   4e-23   
ref|XP_002644986.1|  C. briggsae CBR-TAG-320 protein                    105   4e-23   
dbj|BAF63672.1|  protein disulfide isomerase-1                          104   5e-23   
emb|CDP96040.1|  Protein BM-TAG-320, isoform b                          104   5e-23   
ref|XP_003741496.1|  PREDICTED: protein disulfide-isomerase A6-like     106   6e-23   
ref|XP_001898144.1|  Probable protein disulfide isomerase A6 prec...    104   6e-23   
gb|KDD74013.1|  hypothetical protein H632_c1651p0                       104   6e-23   
ref|XP_007895303.1|  PREDICTED: protein disulfide-isomerase A6          103   8e-23   
ref|NP_922915.2|  protein disulfide-isomerase A6 precursor              104   8e-23   
ref|XP_002408975.1|  protein disulfide isomerase 1, putative            103   1e-22   
ref|XP_004994815.1|  Pdip5 protein                                      102   4e-22   
gb|ERL94682.1|  hypothetical protein D910_11957                         102   5e-22   
gb|ENN76828.1|  hypothetical protein YQE_06669                          101   5e-22   
ref|XP_002528963.1|  protein disulfide isomerase, putative              100   7e-22   
ref|XP_003388369.1|  PREDICTED: probable protein disulfide-isomer...    101   1e-21   
emb|CDI95688.1|  protein disulfide isomerase A6                       99.4    6e-21   
emb|CBN79875.1|  expressed unknown protein                            96.3    2e-20   
ref|XP_005845285.1|  hypothetical protein CHLNCDRAFT_136996           97.1    5e-20   
gb|EUB64344.1|  putative protein disulfide-isomerase A6               93.2    7e-20   
ref|XP_005108921.1|  PREDICTED: protein disulfide-isomerase A6-like   95.9    7e-20   
emb|CDS17285.1|  protein disulfide isomerase A6                       93.2    8e-20   
emb|CDJ05042.1|  protein disulfide isomerase A6                       92.4    1e-19   
ref|XP_009009748.1|  hypothetical protein HELRODRAFT_63467            94.4    3e-19   
ref|XP_002179049.1|  predicted protein                                92.8    3e-19   
gb|AEB26317.1|  protein disulfide isomerase                           94.0    3e-19   
gb|EDM03148.1|  rCG62282, isoform CRA_b                               89.4    4e-19   
ref|XP_004037455.1|  protein disulfide isomerase family protein, ...  93.2    7e-19   
ref|XP_011269957.1|  hypothetical protein CAOG_08387                  92.0    9e-19   
gb|ELW72031.1|  Protein disulfide-isomerase A6                        91.7    3e-18   
ref|XP_002051733.1|  GJ10673                                          91.3    4e-18   
ref|XP_009857523.1|  PREDICTED: protein disulfide-isomerase A6-like   90.9    5e-18   
gb|KJE88440.1|  dolichyl-diphosphooligosaccharide-protein glycosy...  92.4    7e-18   
emb|CAX70320.1|  hypothetical protein                                 87.0    1e-17   
gb|AAW25458.1|  SJCHGC05888 protein                                   87.0    1e-17   
emb|CAX70321.1|  hypothetical protein                                 86.7    2e-17   
gb|EDK98488.1|  protein disulfide isomerase associated 6, isoform...  88.6    2e-17   
dbj|BAB24354.1|  unnamed protein product                              88.2    2e-17   
ref|XP_008686251.1|  PREDICTED: protein disulfide-isomerase A6        89.7    3e-17   
gb|EDK98487.1|  protein disulfide isomerase associated 6, isoform...  88.2    3e-17   
ref|XP_001010336.1|  protein disulfide-isomerase domain containin...  87.0    1e-16   
dbj|GAA54880.1|  protein disulfide-isomerase A6                       84.7    6e-16   
dbj|BAM19465.1|  protein disulfide-isomerase A6 precursor             83.6    7e-16   
gb|KGB39409.1|  putative protein disulfide-isomerase A6               84.0    7e-16   
ref|XP_009177268.1|  hypothetical protein T265_12068                  84.7    7e-16   
ref|XP_002641016.1|  Hypothetical protein CBG11768                    83.6    2e-15   
ref|XP_001988906.1|  GH10318                                          82.4    4e-15   
ref|NP_499613.1|  Protein Y49E10.4                                    81.3    1e-14   
ref|XP_005760643.1|  hypothetical protein EMIHUDRAFT_428303           79.3    6e-14   
gb|EGT53613.1|  hypothetical protein CAEBREN_31752                    78.2    6e-14   
ref|XP_003094567.1|  hypothetical protein CRE_30155                   79.3    7e-14   
ref|XP_001438686.1|  hypothetical protein                             79.0    7e-14   
ref|XP_008864870.1|  protein disulfide-isomerase domain               78.6    1e-13   
ref|XP_008609528.1|  hypothetical protein SDRG_05583                  78.2    2e-13   
ref|XP_001439775.1|  hypothetical protein                             77.4    2e-13   
emb|CDW81458.1|  protein disulfide-isomerase domain containing pr...  77.0    3e-13   
ref|XP_009834821.1|  protein disulfide-isomerase domain               77.0    4e-13   
gb|EGT47278.1|  hypothetical protein CAEBREN_31162                    75.5    5e-13   
gb|KDO29489.1|  hypothetical protein SPRG_06029                       76.6    5e-13   
emb|CBY37570.1|  unnamed protein product                              72.4    1e-12   
emb|CBY07145.1|  unnamed protein product                              72.4    1e-12   
gb|AER42678.1|  protein disulfide isomerase A6                        67.4    2e-11   



>ref|XP_004491086.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Cicer arietinum]
Length=436

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ LLSVAEKFK  PYSYVW AAGKQPDLEK+VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNKYLQQLLSVAEKFKRSPYSYVWVAAGKQPDLEKNVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ +HI EFV+E G  GG+G NLPL+GTPTIVKTEPWDGKDGEI+EE
Sbjct  360  NIKKAVYAPLKSAFELEHIIEFVKEAGR-GGKG-NLPLSGTPTIVKTEPWDGKDGEIIEE  417

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  418  DEFSLEELMGEDASSKDE  435



>ref|XP_010913398.1| PREDICTED: protein disulfide isomerase-like 2-3 [Elaeis guineensis]
Length=429

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAAGKQPDLEK VGVGGYGYPALV L
Sbjct  293  PDILDSKAEGRNKYLELLLSVAEKFKRSPYSYVWAAAGKQPDLEKQVGVGGYGYPALVAL  352

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  +YAPL+S+FQHD I EFV+E G  GG+G NLPL  TP++++TEPWDGKDGEI+EE
Sbjct  353  NVKKGIYAPLRSAFQHDQIMEFVKEAGR-GGKG-NLPLEKTPSVIQTEPWDGKDGEIIEE  410

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+DT  KDE
Sbjct  411  DEFSLEELMGEDTATKDE  428


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 15/70 (21%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP*HFGLQGRGKEQIP*DIVICC*EVQNEALQLC  409
            PEV+ELTGPDVMEEKC+SAA+CF    P               DI+    E +N+ L+L 
Sbjct  266  PEVSELTGPDVMEEKCASAAICFVAFLP---------------DILDSKAEGRNKYLELL  310

Query  408  LGCCR*ATRS  379
            L       RS
Sbjct  311  LSVAEKFKRS  320



>ref|XP_009804684.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana sylvestris]
Length=432

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYSYVW AAGKQPDLEKHVGVGGYGYPA+V L
Sbjct  296  PDILDSKAEGRNKYLEMLLSVAEKFKRNPYSYVWVAAGKQPDLEKHVGVGGYGYPAMVAL  355

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+FQ   I +FV+E G LGG+G NLPL  TP+IVKTE WDGKDGEI+EE
Sbjct  356  NVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLPLAATPSIVKTEAWDGKDGEIIEE  413

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGDDT NKDE
Sbjct  414  DEFSLEELMGDDTPNKDE  431



>ref|XP_009606235.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana tomentosiformis]
Length=432

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYSYVW AAGKQPDLEKHVGVGGYGYPA+V L
Sbjct  296  PDILDSKAEGRNKYLEMLLSVAEKFKRNPYSYVWVAAGKQPDLEKHVGVGGYGYPAMVAL  355

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+FQ   I +FV+E G LGG+G NLPL  TP+IVKTE WDGKDGEI+EE
Sbjct  356  NVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLPLAATPSIVKTEAWDGKDGEIIEE  413

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGDDT NKDE
Sbjct  414  DEFSLEELMGDDTPNKDE  431



>ref|XP_011085485.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=432

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKF+  PYSY+WAAAGKQPDLEKHVGVGGYGYPALV L
Sbjct  296  PDILDSKAEGRNKYLELLLSVAEKFRKSPYSYLWAAAGKQPDLEKHVGVGGYGYPALVAL  355

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K + YAPL+S+F+ DHI EFV+E G  GG+G  +PL G+P IVKTEPWDGKDG+I+EE
Sbjct  356  NLKKKAYAPLRSAFERDHIIEFVKEAGR-GGKGI-VPLEGSPVIVKTEPWDGKDGQIIEE  413

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGDD+V+KDE
Sbjct  414  DEFSLEELMGDDSVSKDE  431



>ref|XP_004243508.1| PREDICTED: protein disulfide isomerase-like 2-3 [Solanum lycopersicum]
Length=432

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LL+VAEKFK  PYS+VW  AGKQPDLEKHVGVGGYGYPA+V L
Sbjct  296  PDILDSKAEGRNKYLEMLLAVAEKFKRNPYSFVWVGAGKQPDLEKHVGVGGYGYPAMVAL  355

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+FQ   I +FV+E G LGG+G NLPL  TP+IVK+EPWDGKDGEI+EE
Sbjct  356  NVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLPLAATPSIVKSEPWDGKDGEIIEE  413

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGDDT NKDE
Sbjct  414  DEFSLEELMGDDTPNKDE  431



>ref|XP_006357974.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Solanum 
tuberosum]
Length=432

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LL+VAEKFK  PYS+VW  AGKQPDLEKHVGVGGYGYPA+V L
Sbjct  296  PDILDSKAEGRNKYLEMLLAVAEKFKRNPYSFVWVGAGKQPDLEKHVGVGGYGYPAMVAL  355

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+FQ   I +FV+E G LGG+G NLPL  TP+IVK EPWDGKDGEI+EE
Sbjct  356  NVKKGVYAPLKSAFQRQPIIDFVKEAG-LGGKG-NLPLAATPSIVKNEPWDGKDGEIIEE  413

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGDDT NKDE
Sbjct  414  DEFSLEELMGDDTPNKDE  431



>ref|XP_003519441.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Glycine 
max]
Length=438

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+YL+ LLSVAEKFK  PYSYVW AAGKQPDLEK+VGVGGYGYPALV L
Sbjct  302  PDILDSKAEGRNRYLQQLLSVAEKFKRSPYSYVWVAAGKQPDLEKNVGVGGYGYPALVAL  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ D I EFV+E G  GG+G NLP+ GTPTIVKTEPWDGKDGEI+EE
Sbjct  362  NLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPIEGTPTIVKTEPWDGKDGEIIEE  419

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  420  DEFSLEELMGEDASSKDE  437



>ref|XP_009365136.1| PREDICTED: protein disulfide isomerase-like 2-3 [Pyrus x bretschneideri]
Length=435

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY++ LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  299  PDILDSKAEGRNKYIQQLLSVAEKFKRSPYSYVWAAAGKQPDLENRVGVGGYGYPALVAL  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ D I EFVRE G  GG+G NLPL G P+IVK EPWDGKDG+I+EE
Sbjct  359  NAKKGAYAPLKSAFEVDQITEFVREAGR-GGKG-NLPLEGIPSIVKIEPWDGKDGQILEE  416

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+DT NKDE
Sbjct  417  DEFSLEELMGEDTTNKDE  434



>ref|XP_010252582.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nelumbo nucifera]
Length=434

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKA+GRNKYLE LLSVAEKFK  PYS+VWAAAGKQP+LEK VGVGGYGYPALV L
Sbjct  298  PDILDSKADGRNKYLELLLSVAEKFKRNPYSFVWAAAGKQPELEKQVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK +VY PL+S+F+   I EFVRE G  GG+G NLPL  +P IVKTEPWDGKDGEI+EE
Sbjct  358  NVKKRVYTPLRSAFELQQITEFVREAG-YGGKG-NLPLENSPVIVKTEPWDGKDGEILEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGDDT  KDE
Sbjct  416  DEFSLEELMGDDTARKDE  433



>ref|XP_008805603.1| PREDICTED: protein disulfide isomerase-like 2-3 [Phoenix dactylifera]
Length=430

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKF+  PYSYVWAAAGKQPDLEK VGVGGYGYPALV L
Sbjct  294  PDILDSKAEGRNKYLELLLSVAEKFRRSPYSYVWAAAGKQPDLEKQVGVGGYGYPALVAL  353

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  +YAPL+S+F+HD I +FV+E G  GG+G NLPL   P++V+TEPWDGKDGEI+EE
Sbjct  354  NVKKGIYAPLRSAFEHDPIIDFVKEAGR-GGKG-NLPLEKAPSVVQTEPWDGKDGEIIEE  411

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEEL+G+DT  KDE
Sbjct  412  DEFSLEELLGEDTTTKDE  429


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 37/70 (53%), Gaps = 15/70 (21%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP*HFGLQGRGKEQIP*DIVICC*EVQNEALQLC  409
            PEV+ELTGPDVMEEKCSSAA+CF    P               DI+    E +N+ L+L 
Sbjct  267  PEVSELTGPDVMEEKCSSAAICFVAFLP---------------DILDSKAEGRNKYLELL  311

Query  408  LGCCR*ATRS  379
            L       RS
Sbjct  312  LSVAEKFRRS  321



>ref|NP_001236576.1| protein disulfide isomerse like protein precursor [Glycine max]
 dbj|BAF95902.1| protein disulfide isomerase family [Glycine max]
 dbj|BAD42856.2| protein disulfide isomerse like protein [Glycine max]
Length=438

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN YL+ LLSVAEKFK  PYSYVW AAG QPDLEK+VGVGGYGYPALV L
Sbjct  302  PDILDSKAEGRNIYLQQLLSVAEKFKRSPYSYVWVAAGNQPDLEKNVGVGGYGYPALVAL  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ D I EFV+E G  GG+G NLPL GTPTIVKTEPWDGKDGEI+EE
Sbjct  362  NLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLQGTPTIVKTEPWDGKDGEIIEE  419

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  420  DEFSLEELMGEDASSKDE  437



>ref|XP_004304072.1| PREDICTED: protein disulfide isomerase-like 2-3 [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL  LLSVAEKFK  PYSYVWAAAGKQ DLE  VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNKYLHQLLSVAEKFKRSPYSYVWAAAGKQQDLENLVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+ D I EFVRE G  GG+G NLPL GTP IVK+EPWDGKDGEI+EE
Sbjct  360  NVKKGVYAPLKSAFELDQITEFVREAGR-GGKG-NLPLNGTPNIVKSEPWDGKDGEIVEE  417

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+DT +KDE
Sbjct  418  DEFSLEELMGEDTNSKDE  435



>ref|XP_011003479.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYLEQLLSVAEKFKRSPYSYVWAAAGKQPDLENQVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ +HI EFV+E G  GG+G NLPL G P IVKTEPWDGKDGEI+EE
Sbjct  358  NAKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLPLNGNPEIVKTEPWDGKDGEIIEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  416  DEFSLEELMGEDAGSKDE  433



>ref|XP_008456396.1| PREDICTED: protein disulfide isomerase-like 2-3 [Cucumis melo]
Length=438

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 120/140 (86%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKF+  PYSYVWAAAGKQPDLEK VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNKYLEQLLSVAEKFRRSPYSYVWAAAGKQPDLEKRVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ +HI EFV+E G  GG+G NLPL  TP IVKTEPWDGKDGE++EE
Sbjct  360  NVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLPLESTPEIVKTEPWDGKDGEVIEE  417

Query  146  DEFSLEELMG--DDTVNKDE  93
            DEFSLEELMG  D+TV KDE
Sbjct  418  DEFSLEELMGGEDETVTKDE  437



>ref|XP_002320494.2| thioredoxin family protein [Populus trichocarpa]
 gb|EEE98809.2| thioredoxin family protein [Populus trichocarpa]
Length=434

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYLEQLLSVAEKFKRSPYSYVWAAAGKQPDLENRVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ +HI EFV+E G  GG+G NLPL G P IVKTEPWDGKDGEI+EE
Sbjct  358  NAKKGAYAPLKSAFELEHIVEFVKEAGR-GGKG-NLPLNGNPEIVKTEPWDGKDGEIIEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  416  DEFSLEELMGEDAGSKDE  433


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP  505
            PEVTELTGPDVMEEKC SAA+CF    P
Sbjct  271  PEVTELTGPDVMEEKCGSAAICFVAFLP  298



>ref|XP_007049203.1| PDI-like 2-2 [Theobroma cacao]
 gb|EOX93360.1| PDI-like 2-2 [Theobroma cacao]
Length=434

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYSYVWAAAGKQPDLE+ VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYLEMLLSVAEKFKRSPYSYVWAAAGKQPDLERRVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F  +HI EFV+E G  GG+G NLPL GTP I KTEPW+GKDGEI+EE
Sbjct  358  NVKKGAYAPLKSAFGLEHIIEFVKEAGR-GGKG-NLPLEGTPDIAKTEPWNGKDGEIIEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  416  DEFSLEELMGEDIASKDE  433



>ref|XP_007141667.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
 gb|ESW13661.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
Length=436

 Score =   214 bits (546),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+YL+ LLSVAEKFK  PYSYVW AAGKQ DLEKHVGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNRYLQQLLSVAEKFKRSPYSYVWVAAGKQLDLEKHVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ D I +FV++ G  GG+G NLPL  TPTIVKTEPWDGKDGEI+EE
Sbjct  360  NLKKAVYAPLKSAFELDQIIQFVKDAGR-GGKG-NLPLQSTPTIVKTEPWDGKDGEIIEE  417

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  418  DEFSLEELMGEDASSKDE  435



>ref|XP_011100470.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=438

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ LLSVAEKF+  PYSY+W AAGKQPDLEKHVGVGGYGYPALV L
Sbjct  302  PDILDSKAEGRNKYLKLLLSVAEKFRKSPYSYLWVAAGKQPDLEKHVGVGGYGYPALVAL  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K + YAPLKS+F+ DHI EFV+  G  GG+G NLPL G+P I+KTEPWDGKDG+I+EE
Sbjct  362  NLKKKAYAPLKSAFERDHIIEFVKAAGR-GGKG-NLPLEGSPEILKTEPWDGKDGQIIEE  419

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL ELMGDD  +KDE
Sbjct  420  DEFSLSELMGDDNGSKDE  437



>ref|XP_011016519.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY+E LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYVEQLLSVAEKFKRSPYSYVWAAAGKQPDLENRVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ +HI EFV+E G  GG+G NLPL G P IVKTEPWDGKDGEI+EE
Sbjct  358  NAKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLPLNGNPEIVKTEPWDGKDGEIIEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  416  DEFSLEELMGEDAGSKDE  433



>gb|KDP30825.1| hypothetical protein JCGZ_13768 [Jatropha curcas]
Length=434

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 118/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKA GRNKYLE LLSVAEKFK  PYSYVWAAAGKQPDLEK VGVGGYGYPALV L
Sbjct  298  PDILDSKAAGRNKYLEQLLSVAEKFKRSPYSYVWAAAGKQPDLEKLVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ +HI EFV+E G  GG+G NL L GTP IVKTEPWDGKDGEI+EE
Sbjct  358  NVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLALGGTPEIVKTEPWDGKDGEIIEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  416  DEFSLEELMGEDVGSKDE  433


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP  505
            PEVTELTGPDVMEEKC SAA+CF    P
Sbjct  271  PEVTELTGPDVMEEKCGSAAICFVAFLP  298



>ref|XP_008342147.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=434

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY++ LLSVAEKFK  PYS+VWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYIQQLLSVAEKFKRSPYSFVWAAAGKQPDLENRVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ D I EFV+E G  GG+G NLPL GTP IVK EPWDGKDGEI+EE
Sbjct  358  NAKKGAYAPLKSAFEVDQITEFVKEAGR-GGKG-NLPLEGTPNIVKIEPWDGKDGEIIEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMG+DT NK+E
Sbjct  416  DEFSLDELMGEDTTNKEE  433


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 35/70 (50%), Gaps = 15/70 (21%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP*HFGLQGRGKEQIP*DIVICC*EVQNEALQLC  409
            PEVTELTGPDVMEEKC SAA+CF    P               DI+    E +N+ +Q  
Sbjct  271  PEVTELTGPDVMEEKCGSAAICFVAFLP---------------DILDSKAEGRNKYIQQL  315

Query  408  LGCCR*ATRS  379
            L       RS
Sbjct  316  LSVAEKFKRS  325



>ref|XP_008379697.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=435

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY++ LLSVAEKFK  PY YVWAAAGKQ DLE  VGVGGYGYPALV L
Sbjct  299  PDILDSKAEGRNKYIQQLLSVAEKFKRSPYXYVWAAAGKQXDLENRVGVGGYGYPALVAL  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ D I EFVRE G  GG+G NLPL GTP+IVK EPWDGKDG+I+EE
Sbjct  359  NAKKGAYAPLKSAFEVDQITEFVREAGR-GGKG-NLPLEGTPSIVKIEPWDGKDGQILEE  416

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+ T NKDE
Sbjct  417  DEFSLEELMGEXTTNKDE  434



>ref|XP_004165750.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Cucumis 
sativus]
Length=438

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+YL+ LLSVAEKF+  PYSY+WAAAGKQPDLE+ VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNRYLKQLLSVAEKFRRSPYSYIWAAAGKQPDLEQRVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ +HI EFV+E G  GG+G NLPL  TP IVKTEPWDGKDGE++EE
Sbjct  360  NVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLPLESTPEIVKTEPWDGKDGEVIEE  417

Query  146  DEFSLEELMG--DDTVNKDE  93
            DEFSLEELMG  D+TV KDE
Sbjct  418  DEFSLEELMGGEDETVTKDE  437



>ref|XP_004143192.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Cucumis 
sativus]
 gb|KGN47008.1| hypothetical protein Csa_6G168250 [Cucumis sativus]
Length=438

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+YL+ LLSVAEKF+  PYSY+WAAAGKQPDLE+ VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNRYLKQLLSVAEKFRRSPYSYIWAAAGKQPDLEQRVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ +HI EFV+E G  GG+G NLPL  TP IVKTEPWDGKDGE++EE
Sbjct  360  NVKKGAYAPLKSAFELEHIIEFVKEAGR-GGKG-NLPLESTPEIVKTEPWDGKDGEVIEE  417

Query  146  DEFSLEELMG--DDTVNKDE  93
            DEFSLEELMG  D+TV KDE
Sbjct  418  DEFSLEELMGGEDETVTKDE  437



>ref|XP_009409222.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=431

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLS+AEKFK  PYS+VW+AAGKQ DLE HVGVGGYGYPALV L
Sbjct  295  PDILDSKAEGRNKYLEHLLSIAEKFKRSPYSFVWSAAGKQADLENHVGVGGYGYPALVAL  354

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  +YAPLKS+F++D I EF++E G  GG+G NLPL  TPTIVK EPWDG DGEI+EE
Sbjct  355  NVKKGIYAPLKSAFENDQIIEFIKEAGR-GGKG-NLPLQNTPTIVKIEPWDGNDGEIIEE  412

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMG+D   KDE
Sbjct  413  DEFSLDELMGEDKSAKDE  430



>ref|XP_003616851.1| Protein disulfide isomerase family [Medicago truncatula]
 gb|AES99809.1| protein disulfide isomerase-like protein [Medicago truncatula]
Length=435

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 3/139 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+YL+ LL+VAEKFK  PYSYVWAAAGKQPDLE+ VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNRYLQQLLTVAEKFKRSPYSYVWAAAGKQPDLEQKVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT-PTIVKTEPWDGKDGEIME  150
            +VK  VYAPLKS+F+ D I EFV+E G  GG+G NLPL  T PTIVKTEPWDGKDGEI+E
Sbjct  358  NVKKGVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLGDTPPTIVKTEPWDGKDGEIVE  415

Query  149  EDEFSLEELMGDDTVNKDE  93
            EDEFSLEELMG+D   KDE
Sbjct  416  EDEFSLEELMGEDASTKDE  434



>ref|XP_009409223.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=430

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLS+AEKFK  PYS+VW+AAGKQ DLE HVGVGGYGYPALV L
Sbjct  294  PDILDSKAEGRNKYLEHLLSIAEKFKRSPYSFVWSAAGKQADLENHVGVGGYGYPALVAL  353

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  +YAPLKS+F++D I EF++E G  GG+G NLPL  TPTIVK EPWDG DGEI+EE
Sbjct  354  NVKKGIYAPLKSAFENDQIIEFIKEAGR-GGKG-NLPLQNTPTIVKIEPWDGNDGEIIEE  411

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMG+D   KDE
Sbjct  412  DEFSLDELMGEDKSAKDE  429



>gb|KJB42838.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=434

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYLDMLLSVAEKFKRSPYSYVWAAAGKQPDLENRVGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL S+F+ +HI EFV+E G  GG+G NLPL GTP I KTE WDGKDGEI EE
Sbjct  358  NVKKGAYAPLISAFELEHIIEFVKEAGR-GGKG-NLPLEGTPEIAKTEAWDGKDGEIKEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGD T +KDE
Sbjct  416  DEFSLEELMGDFTASKDE  433


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 35/69 (51%), Gaps = 15/69 (22%)
 Frame = -3

Query  585  EVTELTGPDVMEEKCSSAALCFCGISP*HFGLQGRGKEQIP*DIVICC*EVQNEALQLCL  406
            EVTELTGPDVMEEKCSSAA+CF    P               DI+    E +N+ L + L
Sbjct  272  EVTELTGPDVMEEKCSSAAICFVAFLP---------------DILDSKAEGRNKYLDMLL  316

Query  405  GCCR*ATRS  379
                   RS
Sbjct  317  SVAEKFKRS  325



>ref|XP_008229815.1| PREDICTED: protein disulfide isomerase-like 2-3 [Prunus mume]
Length=459

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 117/140 (84%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY++ LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  321  PDILDSKAEGRNKYIQQLLSVAEKFKRSPYSYVWAAAGKQPDLENRVGVGGYGYPALVAL  380

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ D I EFV+E G  GG+G NLPL GTP I K EPWDGKDG+I+EE
Sbjct  381  NVKKGAYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLDGTPNISKIEPWDGKDGQIIEE  438

Query  146  DEFSLEELM--GDDTVNKDE  93
            DEFSLEELM  GDDT +KDE
Sbjct  439  DEFSLEELMGGGDDTTSKDE  458



>ref|XP_010035498.1| PREDICTED: protein disulfide isomerase-like 2-3 [Eucalyptus grandis]
 gb|KCW46917.1| hypothetical protein EUGRSUZ_K00732 [Eucalyptus grandis]
Length=436

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILD+KAEGRN+Y++ LLS AEKFK  PYS+VWA+AGKQPDLEK VGVGGYGYPALV L
Sbjct  300  PDILDTKAEGRNRYIQMLLSAAEKFKRSPYSFVWASAGKQPDLEKLVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPL+S+F+ +HI EFVRE G LGG+G NLP  GTP I  TEPWDGKDGEI+EE
Sbjct  360  NAKKGAYAPLRSAFELNHIVEFVREAG-LGGKG-NLPFEGTPVIAMTEPWDGKDGEILEE  417

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM +D  NKDE
Sbjct  418  DEFSLEELMSEDAPNKDE  435



>gb|AFK43048.1| unknown [Lotus japonicus]
Length=440

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 119/139 (86%), Gaps = 3/139 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+Y++ LLSVAEKFK  PYSYVW AAGKQPDLEK VGVGGYGYPALV L
Sbjct  303  PDILDSKAEGRNRYIQQLLSVAEKFKRSPYSYVWVAAGKQPDLEKSVGVGGYGYPALVAL  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ D I EFV+E G  GG+G NLPL  TP IVKTEPWDGKDGE++EE
Sbjct  363  NIKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLGDTPAIVKTEPWDGKDGEVIEE  420

Query  146  DEFSLEELMG-DDTVNKDE  93
            DEFSL+ELMG +DT +KDE
Sbjct  421  DEFSLDELMGEEDTSSKDE  439



>gb|KHN44746.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=442

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 119/142 (84%), Gaps = 6/142 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPY----SYVWAAAGKQPDLEKHVGVGGYGYPA  339
            PDILDSKAEGRN YL+ LLSVAEKFK  PY    +YVW AAG QPDLEK+VGVGGYGYPA
Sbjct  302  PDILDSKAEGRNIYLQQLLSVAEKFKRSPYRQVKNYVWVAAGNQPDLEKNVGVGGYGYPA  361

Query  338  LVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGE  159
            LV L++K  VYAPLKS+F+ D I EFV+E G  GG+G NLPL GTPTIVKTEPWDGKDGE
Sbjct  362  LVALNLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLQGTPTIVKTEPWDGKDGE  419

Query  158  IMEEDEFSLEELMGDDTVNKDE  93
            I+EEDEFSLEELMG+D  +KDE
Sbjct  420  IIEEDEFSLEELMGEDASSKDE  441



>ref|XP_006661300.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Oryza brachyantha]
Length=425

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQ DLEK VGVGGYGYPA+V L
Sbjct  289  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQADLEKQVGVGGYGYPAMVAL  348

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQ + I EFV+E G  GG+G NLPL GTPTIV++EPWDGKDGE++EE
Sbjct  349  NVKKGAYAPLRSAFQLEEITEFVKEAGR-GGKG-NLPLDGTPTIVQSEPWDGKDGEVIEE  406

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGD++   DE
Sbjct  407  DEFSLEELMGDNSPVNDE  424



>ref|NP_001063331.1| Os09g0451500 [Oryza sativa Japonica Group]
 sp|Q67UF5.1|PDI23_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-3; Short=OsPDIL2-3; 
AltName: Full=Protein disulfide isomerase-like 5-1; 
Short=OsPDIL5-1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD38008.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAD38214.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAF25245.1| Os09g0451500 [Oryza sativa Japonica Group]
Length=441

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQ DLEK VGVGGYGYPA+V L
Sbjct  305  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQADLEKQVGVGGYGYPAMVAL  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQ D I EFV+E G  GG+G NLPL GTPTIV++EPWDGKDGE++EE
Sbjct  365  NVKKGAYAPLRSAFQLDEITEFVKEAGR-GGKG-NLPLDGTPTIVQSEPWDGKDGEVIEE  422

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D++   DE
Sbjct  423  DEFSLEELMADNSPVNDE  440



>gb|ACU17741.1| unknown [Glycine max]
Length=436

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 2/130 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN YL+ LLSVAEKFK  PYSYVW AAG QPDLEK+VGVGGYGYPALV L
Sbjct  302  PDILDSKAEGRNIYLQQLLSVAEKFKRSPYSYVWVAAGNQPDLEKNVGVGGYGYPALVAL  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ D I EFV+E G  GG+G NLPL GTPTIVKTEPWDGKDGEI+EE
Sbjct  362  NLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLQGTPTIVKTEPWDGKDGEIIEE  419

Query  146  DEFSLEELMG  117
            DEFSLEELMG
Sbjct  420  DEFSLEELMG  429



>gb|EEC84682.1| hypothetical protein OsI_31602 [Oryza sativa Indica Group]
Length=455

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQ DLEK VGVGGYGYPA+V L
Sbjct  319  PDILDSKAEGRNKYLELLLSVAEKFKRSPYSFVWTAAGKQADLEKQVGVGGYGYPAMVAL  378

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQ D I EFV+E G  GG+G NLPL GTPTIV++EPWDGKDGE++EE
Sbjct  379  NVKKGAYAPLRSAFQLDEITEFVKEAGR-GGKG-NLPLDGTPTIVQSEPWDGKDGEVIEE  436

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D++   DE
Sbjct  437  DEFSLEELMADNSPVNDE  454


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 36/70 (51%), Gaps = 15/70 (21%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP*HFGLQGRGKEQIP*DIVICC*EVQNEALQLC  409
            PEV+ELTGPD MEEKC+SAA+CF    P               DI+    E +N+ L+L 
Sbjct  292  PEVSELTGPDAMEEKCASAAICFVSFLP---------------DILDSKAEGRNKYLELL  336

Query  408  LGCCR*ATRS  379
            L       RS
Sbjct  337  LSVAEKFKRS  346



>ref|XP_007215346.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
 gb|EMJ16545.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
Length=463

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 117/140 (84%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY++ LLSVAEKFK  PYSYVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  325  PDILDSKAEGRNKYIQQLLSVAEKFKRSPYSYVWAAAGKQPDLENRVGVGGYGYPALVAL  384

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ D I EFV+E G  GG+G NLPL GTP I K EPWDGKDG+I+EE
Sbjct  385  NVKKGAYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPLDGTPNISKIEPWDGKDGQIIEE  442

Query  146  DEFSLEELM--GDDTVNKDE  93
            DEFSLEELM  GD+T +KDE
Sbjct  443  DEFSLEELMGGGDETTSKDE  462



>ref|NP_001167822.1| uncharacterized protein LOC100381521 [Zea mays]
 gb|ACN26216.1| unknown [Zea mays]
Length=153

 Score =   197 bits (501),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEK+K  PYS+VW AAGKQ +LE  VGVGGYGYPA+V L
Sbjct  17   PDILDSKAEGRNKYLELLLSVAEKYKKSPYSFVWTAAGKQANLENQVGVGGYGYPAMVAL  76

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+++FQ D I EFV+E G  GG+G NLPL   PT+V +EPWDGKDGE++EE
Sbjct  77   NVKKGAYAPLRNAFQRDEIIEFVKEAGR-GGKG-NLPLNVAPTVVTSEPWDGKDGEVIEE  134

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGD +   DE
Sbjct  135  DEFSLDELMGDSSSVNDE  152



>ref|XP_006469595.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide isomerase-like 
2-3-like [Citrus sinensis]
Length=439

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK   YS+VWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNKYLEMLLSVAEKFKRGHYSFVWAAAGKQPDLENRVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VY PLKS+F+ +HI EFV+E G  GG+G NLPL GTP+IVKTEPWDGKDG+I+EE
Sbjct  360  NVKKGVYTPLKSAFELEHIVEFVKESGR-GGKG-NLPLDGTPSIVKTEPWDGKDGQIIEE  417

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELM +    KD+
Sbjct  418  DEFSLDELMAEXAAGKDD  435



>ref|XP_002276520.1| PREDICTED: protein disulfide isomerase-like 2-3 [Vitis vinifera]
 emb|CBI28881.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 112/135 (83%), Gaps = 2/135 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE +LS+AEKFK  PYSYVWAAAGKQ DLEK VGVGGYGYPALV L
Sbjct  301  PDILDSKAEGRNKYLEMMLSIAEKFKRSPYSYVWAAAGKQADLEKQVGVGGYGYPALVAL  360

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F+ D I  FV+E G  GG+G  LPL  TP +VKTEPWDGKDGEI+EE
Sbjct  361  NVKKGAYAPLKSAFELDQIIGFVKEAGH-GGKGI-LPLASTPVVVKTEPWDGKDGEIIEE  418

Query  146  DEFSLEELMGDDTVN  102
            DEFSLEELMGDD  +
Sbjct  419  DEFSLEELMGDDATS  433


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 36/70 (51%), Gaps = 15/70 (21%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP*HFGLQGRGKEQIP*DIVICC*EVQNEALQLC  409
            PEVTELTGPDVMEEKC SAA+CF    P               DI+    E +N+ L++ 
Sbjct  274  PEVTELTGPDVMEEKCGSAAICFVAFLP---------------DILDSKAEGRNKYLEMM  318

Query  408  LGCCR*ATRS  379
            L       RS
Sbjct  319  LSIAEKFKRS  328



>tpg|DAA40211.1| TPA: putative thioredoxin superfamily protein [Zea mays]
Length=212

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEK+K  PYS+VW AAGKQ +LE  VGVGGYGYPA+V L
Sbjct  76   PDILDSKAEGRNKYLELLLSVAEKYKKSPYSFVWTAAGKQANLENQVGVGGYGYPAMVAL  135

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+++FQ D I EFV+E G  GG+G NLPL   PT+V +EPWDGKDGE++EE
Sbjct  136  NVKKGAYAPLRNAFQRDEIIEFVKEAGR-GGKG-NLPLNVAPTVVTSEPWDGKDGEVIEE  193

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGD +   DE
Sbjct  194  DEFSLDELMGDSSSVNDE  211



>ref|XP_006829505.1| hypothetical protein AMTR_s00074p00124400 [Amborella trichopoda]
 gb|ERM96921.1| hypothetical protein AMTR_s00074p00124400 [Amborella trichopoda]
Length=429

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKA+GRNK+LE +LSVAE+FK   YSYVWAAAGKQ +LEK VGVGGYGYPALV L
Sbjct  293  PDILDSKADGRNKHLELVLSVAERFKRNAYSYVWAAAGKQAELEKTVGVGGYGYPALVAL  352

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPL+S+F+HD I EF++E G  GG+G NLPL   P + KTEPWDGKDGEI+EE
Sbjct  353  NVKKGVYAPLRSAFEHDQIVEFIKEAGR-GGKG-NLPLESVPIVTKTEPWDGKDGEILEE  410

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D   KDE
Sbjct  411  DEFSLEELMGEDATPKDE  428



>gb|KJB10306.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=428

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVA+KFK  PYSYVWAAAGKQPDLEK VG+GGYGYPALV L
Sbjct  299  PDILDSKAEGRNKYLEMLLSVAKKFKRNPYSYVWAAAGKQPDLEKCVGIGGYGYPALVAL  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+ +HI EFV+E G  GG+G NLPL G   IVKTE WDGKDG+IMEE
Sbjct  359  NVKKGAYAPLRSAFELEHIIEFVKEAGR-GGKG-NLPLNGGLNIVKTEAWDGKDGKIMEE  416

Query  146  DEFSLEELMGDD  111
            DEFSLEELMG+D
Sbjct  417  DEFSLEELMGED  428



>gb|KJB10301.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=427

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVA+KFK  PYSYVWAAAGKQPDLEK VG+GGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYLEMLLSVAKKFKRNPYSYVWAAAGKQPDLEKCVGIGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+ +HI EFV+E G  GG+G NLPL G   IVKTE WDGKDG+IMEE
Sbjct  358  NVKKGAYAPLRSAFELEHIIEFVKEAGR-GGKG-NLPLNGGLNIVKTEAWDGKDGKIMEE  415

Query  146  DEFSLEELMGDD  111
            DEFSLEELMG+D
Sbjct  416  DEFSLEELMGED  427



>ref|XP_010270061.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X2 [Nelumbo 
nucifera]
Length=381

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGR+KYLE LLSVAEKFK  PYSYVWAAAGKQ DLEK +GVGGYGYPALV L
Sbjct  245  PDILDSKAEGRSKYLELLLSVAEKFKRSPYSYVWAAAGKQLDLEKLIGVGGYGYPALVAL  304

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK + Y PL+S+F+   I EFVRE G LGG+G NLP+   P +VKTEPWDGKDGEIMEE
Sbjct  305  NVKKRAYVPLRSAFELGQIIEFVREAG-LGGKG-NLPMENAPVVVKTEPWDGKDGEIMEE  362

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGD +  +++
Sbjct  363  DEFSLEELMGDVSAREND  380



>ref|XP_003578205.1| PREDICTED: protein disulfide isomerase-like 2-3 [Brachypodium 
distachyon]
Length=440

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW  AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTGAGKQADLEKQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQ D I EFV+E G  GG+G NLPL G PT+V++ PWDGKDGE++EE
Sbjct  364  NVKKGAYAPLRSAFQRDEIIEFVKEAGR-GGKG-NLPLDGAPTVVQSGPWDGKDGEVIEE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGD++   DE
Sbjct  422  DEFSLEELMGDNSPPNDE  439



>gb|KDO59567.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=428

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK   YS+VWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNKYLEMLLSVAEKFKRGHYSFVWAAAGKQPDLENRVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VY PLKS+F+ +HI EFV+E G  GG+G NLPL GTP+IVKTEPWDGKDG+I+EE
Sbjct  360  NVKKGVYTPLKSAFELEHIVEFVKEAGR-GGKG-NLPLDGTPSIVKTEPWDGKDGQIIEE  417

Query  146  DEFSLEELMGD  114
            DEFSL+ELM +
Sbjct  418  DEFSLDELMAE  428



>ref|XP_010270060.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   202 bits (514),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGR+KYLE LLSVAEKFK  PYSYVWAAAGKQ DLEK +GVGGYGYPALV L
Sbjct  298  PDILDSKAEGRSKYLELLLSVAEKFKRSPYSYVWAAAGKQLDLEKLIGVGGYGYPALVAL  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK + Y PL+S+F+   I EFVRE G LGG+G NLP+   P +VKTEPWDGKDGEIMEE
Sbjct  358  NVKKRAYVPLRSAFELGQIIEFVREAG-LGGKG-NLPMENAPVVVKTEPWDGKDGEIMEE  415

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMGD +  +++
Sbjct  416  DEFSLEELMGDVSAREND  433



>dbj|BAJ84858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGAGKQADLEKQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+   I EFV+E G  GG+G NLPL G PT+V++EPWDGKDGE++EE
Sbjct  364  NVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLPLEGAPTVVQSEPWDGKDGEVIEE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D +   DE
Sbjct  422  DEFSLEELMADSSAPNDE  439



>ref|XP_002460311.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
 gb|EER96832.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
Length=439

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQ +LE  VGVGGYGYPA+V L
Sbjct  303  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQANLENQVGVGGYGYPAMVAL  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   Y PL+S+FQ D I EFV+E G  GG+G NLPL G PT+V +EPWDGKDGE++EE
Sbjct  363  NVKKGAYTPLRSAFQRDEIIEFVKEAGR-GGKG-NLPLNGAPTVVTSEPWDGKDGEVIEE  420

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGD +   DE
Sbjct  421  DEFSLDELMGDSSSVNDE  438



>ref|XP_006447669.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
 gb|ESR60909.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
Length=428

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK   YS+VWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  300  PDILDSKAEGRNKYLEMLLSVAEKFKRGHYSFVWAAAGKQPDLENRVGVGGYGYPALVAL  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VY PLKS+F+ +HI EFV+E G  GG+G NLPL GTP+IVKTEPWDGKDG+I+EE
Sbjct  360  NVKKGVYTPLKSAFELEHIVEFVKESGR-GGKG-NLPLDGTPSIVKTEPWDGKDGQIIEE  417

Query  146  DEFSLEELMGD  114
            DEFSL+ELM +
Sbjct  418  DEFSLDELMAE  428



>ref|XP_010110229.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
 gb|EXC25526.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
Length=439

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 5/141 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPY---SYVWAAAGKQPDLEKHVGVGGYGYPAL  336
            PDILDSKAEGRNK+++ LL+VAEKFK  PY   +    +AGKQPDLE+ VGVGGYGYPAL
Sbjct  300  PDILDSKAEGRNKHIQQLLTVAEKFKRSPYRQENIPTLSAGKQPDLEQRVGVGGYGYPAL  359

Query  335  VVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEI  156
            V L+VK  VYAPLKS+F+ +HI EFVRE G  GG+G NLPL GTPTIVKTEPWDGKDGEI
Sbjct  360  VALNVKKSVYAPLKSAFELEHIIEFVREAGR-GGKG-NLPLEGTPTIVKTEPWDGKDGEI  417

Query  155  MEEDEFSLEELMGDDTVNKDE  93
            +EEDEFSLEELMG+DT +KDE
Sbjct  418  IEEDEFSLEELMGEDTTSKDE  438



>ref|NP_001105804.1| protein disulfide isomerase8 precursor [Zea mays]
 gb|AAX09966.1| protein disulfide isomerase [Zea mays]
 gb|ACF78413.1| unknown [Zea mays]
 tpg|DAA61729.1| TPA: putative protein disulfide isomerase family protein [Zea 
mays]
Length=439

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQ +LE  VGVGGYGYPA+V L
Sbjct  303  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQANLENQVGVGGYGYPAMVAL  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQ D I EFV+E G  GG+G NLPL   PT+V +EPWDGKDGE++EE
Sbjct  363  NVKKGAYAPLRSAFQRDEIIEFVKEAGR-GGKG-NLPLNDAPTVVASEPWDGKDGEVIEE  420

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGD +   DE
Sbjct  421  DEFSLDELMGDSSSANDE  438



>dbj|BAO79454.1| protein disulfide isomerase family protein 5-1 [Triticum aestivum]
Length=440

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGAGKQADLEKQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+   I EFV+E G  GG+G NLPL G PT+V++EPWDGKDGE++EE
Sbjct  364  NVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLPLEGAPTVVESEPWDGKDGEVIEE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D +   DE
Sbjct  422  DEFSLEELMADSSAPNDE  439



>emb|CBG91899.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGAGKQADLEKQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+   I EFV+E G  GG+G NLPL G PT+V++EPWDGKDGE++EE
Sbjct  364  NVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLPLEGAPTVVESEPWDGKDGEVIEE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D +   DE
Sbjct  422  DEFSLEELMADSSAPNDE  439



>emb|CBG91909.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGAGKQADLEKQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+   I EFV+E G  GG+G NLPL G PT+V++EPWDGKDGE++EE
Sbjct  364  NVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLPLEGAPTVVQSEPWDGKDGEVIEE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D +   DE
Sbjct  422  DEFSLEELMADSSPPNDE  439



>ref|XP_004956980.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Setaria 
italica]
Length=440

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQ DLE  VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWTAAGKQADLENQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQHD I EFV+E G  GG+G NLPL G+PT+V +EPWDGKDGE + E
Sbjct  364  NVKKGAYAPLRSAFQHDEIIEFVKEAGR-GGKG-NLPLNGSPTVVPSEPWDGKDGEEIVE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMG+ +   DE
Sbjct  422  DEFSLDELMGESSPVNDE  439



>emb|CBG91908.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 113/138 (82%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VWA AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRNKYLELLLSVAEKFKKSPYSFVWAGAGKQADLEKQVGVGGYGYPAMVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+   I EFV+E G  GG+G NLPL G PT+V++EPWDGKDGE++EE
Sbjct  364  NVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLPLEGAPTVVESEPWDGKDGEVIEE  421

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEEL+ D +   DE
Sbjct  422  DEFSLEELIADSSAPNDE  439



>ref|XP_010556968.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Tarenaya 
hassleriana]
Length=441

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 110/132 (83%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ LL+VAEKFK  PYS+VW AAGKQ D+E  VGVGGYGYPA+V L
Sbjct  301  PDILDSKAEGRNKYLDMLLTVAEKFKRSPYSFVWVAAGKQTDMETKVGVGGYGYPAMVAL  360

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   Y PLKS+F+ +HI EFV+E G  GG+G NLPL GTP IVKTEPWDGKDGE++EE
Sbjct  361  NAKKGAYTPLKSAFEVEHIMEFVKEAGR-GGKG-NLPLNGTPEIVKTEPWDGKDGEVVEE  418

Query  146  DEFSLEELMGDD  111
            DEFSLEELM DD
Sbjct  419  DEFSLEELMADD  430



>gb|EYU43141.1| hypothetical protein MIMGU_mgv1a006693mg [Erythranthe guttata]
Length=434

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 113/140 (81%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ LLSVAEKF+  P+S++WAAAGKQ DLEKHVGVGGYGYPALV L
Sbjct  296  PDILDSKAEGRNKYLDLLLSVAEKFRKSPFSFLWAAAGKQSDLEKHVGVGGYGYPALVAL  355

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K +V+ PLKS+FQ   I EFV E  + GG+G  LPL G+P IVKTE WDGKDGEI EE
Sbjct  356  NIKKKVFNPLKSAFQRAQIIEFVNEASQ-GGKG-TLPLEGSPEIVKTEAWDGKDGEIFEE  413

Query  146  DEFSLEELMGDD--TVNKDE  93
            DEFSLEELM DD     KDE
Sbjct  414  DEFSLEELMADDDTLATKDE  433



>ref|XP_008668262.1| PREDICTED: uncharacterized protein LOC100381521 isoform X1 [Zea 
mays]
Length=439

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEK+K  PYS+VW AAGKQ +LE  VGVGGYGYPA+V L
Sbjct  303  PDILDSKAEGRNKYLELLLSVAEKYKKSPYSFVWTAAGKQANLENQVGVGGYGYPAMVAL  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+++FQ D I EFV+E G  GG+G NLPL   PT+V +EPWDGKDGE++EE
Sbjct  363  NVKKGAYAPLRNAFQRDEIIEFVKEAGR-GGKG-NLPLNVAPTVVTSEPWDGKDGEVIEE  420

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGD +   DE
Sbjct  421  DEFSLDELMGDSSSVNDE  438



>ref|XP_010475171.1| PREDICTED: protein disulfide-isomerase like 2-2 [Camelina sativa]
Length=448

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKY+E LLSVAEKFK  PYS+VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  308  PDILDSKAEGRNKYVEMLLSVAEKFKRDPYSFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  HIKEFV+E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  368  NAKKGAYAPLKSGFEVKHIKEFVKEAAK-GGKG-NLPIDGTMEIVKTEAWDGKDGELVDA  425

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D     E
Sbjct  426  DEFSLEELMGNDEAASTE  443



>ref|XP_010484503.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Camelina 
sativa]
Length=445

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  305  PDILDSKAEGRNKYLEMLLSVAEKFKRDPYSFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  HIKEFV+E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  365  NAKKGAYAPLKSGFEVKHIKEFVKEAAK-GGKG-NLPIDGTMEIVKTEAWDGKDGELVDA  422

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMG+D     E
Sbjct  423  DEFSLKELMGNDEAASTE  440



>ref|XP_009143922.1| PREDICTED: protein disulfide-isomerase 2-3 [Brassica rapa]
Length=443

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 6/142 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA  QPDLEK V VGGYGYPA+V +
Sbjct  303  PDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFVWVAAVTQPDLEKRVNVGGYGYPAMVAM  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P+ GTP IV+T+ WDGKDGE+MEE
Sbjct  363  NVKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NVPMNGTPEIVETKAWDGKDGEVMEE  420

Query  146  DEFSLEELM-GDDTVN---KDE  93
            DEFSLEELM GDD  N   KDE
Sbjct  421  DEFSLEELMGGDDDANVGTKDE  442



>emb|CDY52544.1| BnaA05g35030D [Brassica napus]
Length=444

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 6/142 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA  QPDLEK V VGGYGYPA+V +
Sbjct  304  PDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFVWVAAVTQPDLEKRVNVGGYGYPAMVAM  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P+ GTP IV+T+ WDGKDGE+MEE
Sbjct  364  NVKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NVPMNGTPEIVETKAWDGKDGEVMEE  421

Query  146  DEFSLEELM-GDDTVN---KDE  93
            DEFSLEELM GDD  N   KDE
Sbjct  422  DEFSLEELMGGDDDANVGTKDE  443



>emb|CDY12149.1| BnaC04g11790D [Brassica napus]
Length=443

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 115/142 (81%), Gaps = 6/142 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AA  QPDLEK V VGGYGYPA+V +
Sbjct  303  PDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFVWVAAVTQPDLEKRVNVGGYGYPAMVAM  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P+ GTP IV+T+ WDGKDGE+MEE
Sbjct  363  NVKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NVPMNGTPEIVETKAWDGKDGEVMEE  420

Query  146  DEFSLEELM-GDDTVN---KDE  93
            DEFSLEELM GDD  N   KDE
Sbjct  421  DEFSLEELMGGDDDANVGTKDE  442



>ref|XP_006418074.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
 gb|ESQ36427.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
Length=434

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 108/132 (82%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  305  PDILDSKAEGRNKYLEMLLSVAEKFKRDPYSFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+KEFV E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  365  NAKKGAYAPLKSGFEVKHLKEFVEE-AKRGGKG-NLPIDGTMEIVKTEAWDGKDGEVVDA  422

Query  146  DEFSLEELMGDD  111
            DEFSLEELM DD
Sbjct  423  DEFSLEELMADD  434



>gb|ACN39830.1| unknown [Picea sitchensis]
Length=445

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILD++AEGRN YLE L+SVAEKFK  PYSYVWAAAGKQP LE+ VGVGGYGYPA + L
Sbjct  308  PDILDTRAEGRNSYLEQLMSVAEKFKRSPYSYVWAAAGKQPALERAVGVGGYGYPAFIAL  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPL+S+F+ +H+ +FV++ G  GG+G NLPL   P + KTEPWDGKDGEI+EE
Sbjct  368  NIKKGVYAPLRSAFELEHLVDFVKDAGR-GGKG-NLPLVSVPVLEKTEPWDGKDGEILEE  425

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMG++  +K E
Sbjct  426  DEFSLDELMGNEDDDKKE  443



>ref|XP_010688926.1| PREDICTED: protein disulfide isomerase-like 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=438

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILD+KAEGRNKYLE LLSVAEKFK  PYS+VWAAAGKQPDLEK+VGVGGYGYPA+V +
Sbjct  299  PDILDTKAEGRNKYLEMLLSVAEKFKRSPYSFVWAAAGKQPDLEKNVGVGGYGYPAMVAI  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLK++F+ DH+ +FV++ G  GG+G NLP+  TP I K E WDGKDGE++EE
Sbjct  359  NVKKGAYAPLKTAFELDHLVDFVKKAGR-GGKG-NLPMNDTPKIEKIEAWDGKDGEVIEE  416

Query  146  DEFSLEELMGDD  111
            DEFSL+ELM D+
Sbjct  417  DEFSLDELMKDE  428



>ref|XP_010509948.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X1 [Camelina 
sativa]
 ref|XP_010509949.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X2 [Camelina 
sativa]
Length=440

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA  QPDLEK V VGGYGYPA+V +
Sbjct  302  PDILDSKAEGRNKYLEMLLSVAEKFKKHPYSFIWVAAVTQPDLEKRVNVGGYGYPAMVAM  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP+ GTP IV T+ WDGKDGE++EE
Sbjct  362  NMKKGVYAPLKSAFELPHLLEFVKDAGA-GGKG-NLPMNGTPEIVTTKAWDGKDGELIEE  419

Query  146  DEFSLEELM-GDDTV-NKDE  93
            DEFSLEELM GDDT+ +KDE
Sbjct  420  DEFSLEELMGGDDTIASKDE  439



>ref|XP_010413931.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 125/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  557  LWKKNvalllfafvafLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDL  378
            + +KN       F++FLPDILDSKAEGRNKYLE LL+VAEKFK  PYS++W AA  QPDL
Sbjct  285  VMEKNCGSAAICFISFLPDILDSKAEGRNKYLEILLAVAEKFKKHPYSFIWVAAVTQPDL  344

Query  377  EKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPT  198
            EK V VGGYGYPA+V +++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP+ GTP 
Sbjct  345  EKRVNVGGYGYPAMVAMNMKKGVYAPLKSAFELPHLLEFVKDAGA-GGKG-NLPMNGTPE  402

Query  197  IVKTEPWDGKDGEIMEEDEFSLEELM-GDDTV-NKDE  93
            IV T+ WDGKDGE++EEDEFSLEELM GDDTV +KDE
Sbjct  403  IVTTKAWDGKDGELIEEDEFSLEELMGGDDTVASKDE  439



>ref|XP_010469533.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LL+VAEKFK  PYS++W AA  QPDLEK V VGGYGYPA+V +
Sbjct  302  PDILDSKAEGRNKYLEILLAVAEKFKKHPYSFIWVAAVTQPDLEKRVNVGGYGYPAMVAM  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP+ GTP IV T+ WDGKDGE++EE
Sbjct  362  NMKKGVYAPLKSAFELPHLLEFVKDAGA-GGKG-NLPMNGTPEIVTTKAWDGKDGELIEE  419

Query  146  DEFSLEELM-GDDTV-NKDE  93
            DEFSLEELM GDDTV +KDE
Sbjct  420  DEFSLEELMGGDDTVASKDE  439



>ref|XP_010522374.1| PREDICTED: protein disulfide-isomerase 2-3-like [Tarenaya hassleriana]
Length=430

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ LL+VA+KFK  PYS+VW AAGKQ DLE  VGVGGYGYPA+V L
Sbjct  301  PDILDSKAEGRNKYLDMLLTVADKFKRSPYSFVWVAAGKQTDLETKVGVGGYGYPAMVAL  360

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS+F+ + I EFV+E G  GG+G NLP+ G P IVKTEPWDGKDGEI+EE
Sbjct  361  NSKKGAYAPLKSAFEVEPIMEFVKEAGR-GGKG-NLPIDGAPEIVKTEPWDGKDGEILEE  418

Query  146  DEFSLEELMGD  114
            DEFSLEELMG+
Sbjct  419  DEFSLEELMGE  429



>ref|XP_006294195.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
 gb|EOA27093.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
Length=452

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA  QPDLEK V VGGYGYPA+V +
Sbjct  314  PDILDSKAEGRNKYLEMLLSVAEKFKKHPYSFMWVAAVTQPDLEKRVNVGGYGYPAMVAM  373

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+  H+ EFV++ G  GG+G NLP+ GTP IV T+ WDGKDGE++EE
Sbjct  374  NMKKGVYAPLKSAFELQHLLEFVKDAGA-GGKG-NLPMNGTPEIVTTKAWDGKDGELIEE  431

Query  146  DEFSLEELM-GDDTV-NKDE  93
            DEFSLEELM GDD V +KDE
Sbjct  432  DEFSLEELMGGDDAVSSKDE  451



>ref|XP_002881252.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57511.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA  QPDLEK V VGGYGYPA+V +
Sbjct  302  PDILDSKAEGRNKYLEMLLSVAEKFKKHPYSFMWVAAVTQPDLEKRVNVGGYGYPAMVAM  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P+ GTP IVKT+ WDGKDGE++EE
Sbjct  362  NVKKGVYAPLKSAFELQHLLEFVKDAGT-GGKG-NVPMNGTPEIVKTKAWDGKDGELIEE  419

Query  146  DEFSLEELM-GDDTV-NKDE  93
            DEFSL+ELM GDD V  KDE
Sbjct  420  DEFSLDELMGGDDAVGTKDE  439



>gb|KFK31099.1| hypothetical protein AALP_AA6G068000 [Arabis alpina]
Length=441

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA  QPDLEK V VGGYGYPA+V +
Sbjct  302  PDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFIWVAAITQPDLEKRVNVGGYGYPAMVAM  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+   I EFV++ G  GG+G NLP+ GTP IV T+ WDGKDG+++EE
Sbjct  362  NVKKGVYAPLKSAFELQQILEFVKDAGA-GGKG-NLPMNGTPEIVNTKAWDGKDGQVIEE  419

Query  146  DEFSLEELMG---DDTVNKDE  93
            DEFSLEELMG   D+   KDE
Sbjct  420  DEFSLEELMGGDDDNVSTKDE  440



>ref|XP_006410429.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
 gb|ESQ51882.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
Length=442

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS++W AA  QPDLEK V VGGYGYPA+V +
Sbjct  302  PDILDSKAEGRNKYLEMLLSVAEKFKRHPYSFLWVAAVTQPDLEKRVSVGGYGYPAMVAM  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  V+APLKS+F+  H+ EFV++ G  GG+G NLP+ GTP IV T+ WDGKDGE++EE
Sbjct  362  NVKKGVFAPLKSAFELPHLLEFVKDAGA-GGKG-NLPMNGTPEIVNTKAWDGKDGEVIEE  419

Query  146  DEFSLEELMGDDT  108
            DEFSLEELMG D 
Sbjct  420  DEFSLEELMGGDA  432



>ref|XP_006306333.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
 gb|EOA39231.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
Length=433

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  PYS+VW AAGKQP  EK VGVGGYGYPA+V L
Sbjct  293  PDILDSKAEGRNKYLEMLLSVAEKFKKDPYSFVWVAAGKQPGFEKRVGVGGYGYPAMVAL  352

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+K+FV+E    GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  353  NAKKGAYAPLKSGFEVKHLKDFVKETAR-GGKG-NLPIDGTLEIVKTEAWDGKDGELVDA  410

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D     E
Sbjct  411  DEFSLEELMGNDDAASTE  428



>gb|AAF40463.1|AC004809_21 Strong simialrity to the disulfide isomerase precursor homolog 
T21L14.14 gi|2702281 from A. thaliana on BAC gb|AC003033 [Arabidopsis 
thaliana]
 gb|AAM20664.1| disulfide isomerase-related protein, putative [Arabidopsis thaliana]
Length=443

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVA+KFK  PY +VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  303  PDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+K+FV+E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  363  NAKKGAYAPLKSGFEVKHLKDFVKEAAK-GGKG-NLPIDGTMEIVKTEAWDGKDGEVVDA  420

Query  146  DEFSLEELMGDD  111
            DEFSLE+LMG+D
Sbjct  421  DEFSLEDLMGND  432



>ref|XP_009119218.1| PREDICTED: protein disulfide-isomerase like 2-2 [Brassica rapa]
Length=438

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  P S+VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  309  PDILDSKAEGRNKYLEMLLSVAEKFKKDPISFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  368

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+ EFV+E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  369  NAKKGAYAPLKSGFEVKHLIEFVKE-AQKGGKG-NLPIDGTLEIVKTEAWDGKDGEVVDA  426

Query  146  DEFSLEELMGDD  111
            DEFSLEELM DD
Sbjct  427  DEFSLEELMADD  438



>ref|NP_171990.3| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
 sp|Q9MAU6.2|PDI22_ARATH RecName: Full=Protein disulfide-isomerase like 2-2; Short=AtPDIL2-2; 
AltName: Full=Protein disulfide-isomerase 10; Short=PDI10; 
AltName: Full=Protein disulfide-isomerase like 5-1; Short=AtPDIL5-1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE27773.1| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
Length=447

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVA+KFK  PY +VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  307  PDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+K+FV+E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  367  NAKKGAYAPLKSGFEVKHLKDFVKEAAK-GGKG-NLPIDGTMEIVKTEAWDGKDGEVVDA  424

Query  146  DEFSLEELMGDD  111
            DEFSLE+LMG+D
Sbjct  425  DEFSLEDLMGND  436



>ref|XP_002892256.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68515.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVA+KFK  PY +VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  302  PDILDSKAEGRNKYLEMLLSVADKFKKDPYGFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+K+F++E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  362  NAKKGAYAPLKSGFEVKHLKDFIKEAAK-GGKG-NLPIDGTMEIVKTEAWDGKDGEVVDA  419

Query  146  DEFSLEELMGDD  111
            DEFSLE+LMG+D
Sbjct  420  DEFSLEDLMGND  431



>ref|NP_180851.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
 sp|O48773.1|PDI23_ARATH RecName: Full=Protein disulfide-isomerase 2-3; Short=AtPDIL2-3; 
AltName: Full=Protein disulfide-isomerase 5-2; Short=AtPDIL5-2; 
AltName: Full=Protein disulfide-isomerase 9; Short=PDI9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB91984.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAL06929.1| At2g32920/T21L14.14 [Arabidopsis thaliana]
 gb|AAL61928.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAM91128.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AEC08762.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
Length=440

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK +PYS++W AA  Q DLEK V VGGYGYPA+V +
Sbjct  302  PDILDSKAEGRNKYLEMLLSVAEKFKKQPYSFMWVAAVTQMDLEKRVNVGGYGYPAMVAM  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+  H+ EFV++ G  GG+G N+P+ GTP IVKT+ WDGKDGE++EE
Sbjct  362  NVKKGVYAPLKSAFELQHLLEFVKDAGT-GGKG-NVPMNGTPEIVKTKEWDGKDGELIEE  419

Query  146  DEFSLEELM-GDDTV-NKDE  93
            DEFSL+ELM GDD V +KDE
Sbjct  420  DEFSLDELMGGDDAVGSKDE  439



>emb|CDY18278.1| BnaC05g03010D [Brassica napus]
Length=436

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE LLSVAEKFK  P S+VW AAGKQPDLEK VGVGGYGYPA+V L
Sbjct  307  PDILDSKAEGRNKYLEMLLSVAEKFKKDPISFVWVAAGKQPDLEKRVGVGGYGYPAMVAL  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            + K   YAPLKS F+  H+ EFV+E  + GG+G NLP+ GT  IVKTE WDGKDGE+++ 
Sbjct  367  NAKKGAYAPLKSGFEVKHLIEFVKE-AQKGGKG-NLPIDGTLEIVKTEAWDGKDGEVVDA  424

Query  146  DEFSLEELMGDD  111
            DEFSL ELM DD
Sbjct  425  DEFSLAELMADD  436



>emb|CDX79497.1| BnaC03g18330D [Brassica napus]
Length=443

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (80%), Gaps = 6/142 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ L SVAEK+K  PYS+VW AA  QPDLEK V VGGYGYPA+V +
Sbjct  303  PDILDSKAEGRNKYLKMLQSVAEKYKRHPYSFVWVAAVTQPDLEKKVSVGGYGYPAMVAM  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPLKS+F+  H+ EFV++  E GG+G NLP+ GTP IV T+ WDGKDGE++EE
Sbjct  363  NVKKGVYAPLKSAFELQHLLEFVKD-AEAGGKG-NLPMNGTPEIVDTKAWDGKDGEVIEE  420

Query  146  DEFSLEELM-GDDTVN---KDE  93
            DEFSLEELM GDD  N   KDE
Sbjct  421  DEFSLEELMGGDDDANVGIKDE  442



>gb|KHN38504.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=391

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 16/138 (12%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN+YL+               YVW AAGKQPDLEK+VGVGGYGYPALV L
Sbjct  269  PDILDSKAEGRNRYLQ--------------HYVWVAAGKQPDLEKNVGVGGYGYPALVAL  314

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            ++K  VYAPLKS+F+ D I EFV+E G  GG+G NLP+ GTPTIVKTEPWDGKDGEI+EE
Sbjct  315  NLKKAVYAPLKSAFELDQIIEFVKEAGR-GGKG-NLPIEGTPTIVKTEPWDGKDGEIIEE  372

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELMG+D  +KDE
Sbjct  373  DEFSLEELMGEDASSKDE  390



>gb|KHG30032.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=422

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 104/138 (75%), Gaps = 14/138 (10%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL+ L             YVWAAAGKQPDLE  VGVGGYGYPALV L
Sbjct  298  PDILDSKAEGRNKYLDMLF------------YVWAAAGKQPDLENRVGVGGYGYPALVAL  345

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL S+F+ +HI EFV+E G  GG+G NLPL GTP I KTE WDGKDGEIMEE
Sbjct  346  NVKKGAYAPLISAFELEHIIEFVKEAGR-GGKG-NLPLEGTPEIAKTEAWDGKDGEIMEE  403

Query  146  DEFSLEELMGDDTVNKDE  93
            DE SLEELMGD T +KDE
Sbjct  404  DEISLEELMGDFTASKDE  421



>emb|CDP05711.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   174 bits (442),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 102/138 (74%), Gaps = 20/138 (14%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN                  ++VWAAAGKQ DLEK VGVGGYGYPALV L
Sbjct  320  PDILDSKAEGRN------------------NFVWAAAGKQSDLEKQVGVGGYGYPALVAL  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPLKS+F  D I EFV+E G LGG+G NLPL  TP+I K EPWDGKDGEI+EE
Sbjct  362  NVKKGAYAPLKSAFGRDQIIEFVKEAG-LGGKG-NLPLGVTPSIAKIEPWDGKDGEIIEE  419

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGDDT NKDE
Sbjct  420  DEFSLDELMGDDTANKDE  437


 Score = 49.7 bits (117),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP  505
            PEVTELTGPDVMEEKC SAA+CF    P
Sbjct  293  PEVTELTGPDVMEEKCGSAAICFVAFLP  320



>gb|KDO59568.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = -1

Query  467  YLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSS  288
            YLE LLSVAEKFK   YS+VWAAAGKQPDLE  VGVGGYGYPALV L+VK  VY PLKS+
Sbjct  296  YLEMLLSVAEKFKRGHYSFVWAAAGKQPDLENRVGVGGYGYPALVALNVKKGVYTPLKSA  355

Query  287  FQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGD  114
            F+ +HI EFV+E G  GG+G NLPL GTP+IVKTEPWDGKDG+I+EEDEFSL+ELM +
Sbjct  356  FELEHIVEFVKEAGR-GGKG-NLPLDGTPSIVKTEPWDGKDGQIIEEDEFSLDELMAE  411



>gb|KHG02314.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=414

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 101/132 (77%), Gaps = 16/132 (12%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYLE               YVWAAAGKQPDLEK VGVGGYGYPALV L
Sbjct  299  PDILDSKAEGRNKYLEI--------------YVWAAAGKQPDLEKCVGVGGYGYPALVAL  344

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+ +HI EFV+E G  GG+G NLPL G   IVKTE WDGKDG+I+EE
Sbjct  345  NVKKGAYAPLRSAFELEHIIEFVKEAGR-GGKG-NLPLNGGLNIVKTEAWDGKDGKIIEE  402

Query  146  DEFSLEELMGDD  111
            DEFSLEELMG+D
Sbjct  403  DEFSLEELMGED  414



>gb|EEE54954.1| hypothetical protein OsJ_02527 [Oryza sativa Japonica Group]
Length=291

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 101/138 (73%), Gaps = 20/138 (14%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN                  ++VW AAGKQ DLEK VGVGGYGYPA+V L
Sbjct  173  PDILDSKAEGRN------------------NFVWTAAGKQADLEKQVGVGGYGYPAMVAL  214

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+FQ D I EFV+E G  GG+G NLPL GTPTIV++EPWDGKDGE++EE
Sbjct  215  NVKKGAYAPLRSAFQLDEITEFVKEAGR-GGKG-NLPLDGTPTIVQSEPWDGKDGEVIEE  272

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D++   DE
Sbjct  273  DEFSLEELMADNSPVNDE  290



>ref|XP_001780684.1| predicted protein [Physcomitrella patens]
 gb|EDQ54468.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 10/138 (7%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRNKYL TL +VAEK+K   Y        +QPDLEK VGVGG+GYPA+V L
Sbjct  299  PDILDSKAEGRNKYLATLRNVAEKYKRNAY--------RQPDLEKAVGVGGFGYPAMVAL  350

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  VYAPL+ +F+ + + +FV E G+ GGRG  +PL   P ++ TEPWDGKDG ++EE
Sbjct  351  NVKKAVYAPLRGAFEQEPVMKFVAEAGK-GGRGI-VPLQSVPPVLTTEPWDGKDGHLIEE  408

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSL+ELMGDD    DE
Sbjct  409  DEFSLDELMGDDETKNDE  426



>gb|EMT02125.1| Protein disulfide-isomerase A6 [Aegilops tauschii]
Length=422

 Score =   161 bits (407),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 98/138 (71%), Gaps = 20/138 (14%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKAEGRN                  ++VWA AGKQ DLEK VGVGGYGYPA+V L
Sbjct  304  PDILDSKAEGRN------------------NFVWAGAGKQADLEKQVGVGGYGYPAMVAL  345

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK   YAPL+S+F+   I EFV+E G  GG+G NLPL G PT+V++EPWDGKDGE++EE
Sbjct  346  NVKKGAYAPLRSAFELAEITEFVKEAGR-GGKG-NLPLEGAPTVVQSEPWDGKDGEVIEE  403

Query  146  DEFSLEELMGDDTVNKDE  93
            DEFSLEELM D +   DE
Sbjct  404  DEFSLEELMADSSAPNDE  421


 Score = 42.7 bits (99),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = -3

Query  588  PEVTELTGPDVMEEKCSSAALCFCGISP  505
            PEV+ELT  DVMEEKC+SAA+CF    P
Sbjct  277  PEVSELTSADVMEEKCASAAICFVSFLP  304



>ref|XP_002976616.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
 gb|EFJ22285.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
Length=442

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKA+GRN+YL+ L ++A KF   PY Y+WA AGKQP LEK V VGGYGYPALV L
Sbjct  304  PDILDSKADGRNQYLDILKNLATKFGKDPYGYLWAEAGKQPSLEKAVQVGGYGYPALVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  V+ PL+S+F+   + +FV++ G+ GG+G NLPL     IVKT+PWDGKDGE + E
Sbjct  364  NVKKAVFLPLRSAFEPSSVLDFVKDAGQ-GGKG-NLPLGTGYEIVKTDPWDGKDGEAIPE  421

Query  146  DEFSLEELMGDD  111
            +EFSLEELM  D
Sbjct  422  EEFSLEELMAAD  433



>ref|XP_002973288.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
 gb|EFJ25662.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
Length=442

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 2/132 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILDSKA+GRN+YL+ L ++A KF   PY Y+WA AGKQP LEK V VGGYGYPALV L
Sbjct  304  PDILDSKADGRNQYLDILKNLATKFGKDPYGYLWAEAGKQPSLEKAVQVGGYGYPALVAL  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDGEIMEE  147
            +VK  V+ PL+S+F+   + +FV++ G+ GG+G NLPL     IVKT+PWDGKDGE + E
Sbjct  364  NVKKAVFLPLRSAFEPSSVLDFVKDAGQ-GGKG-NLPLGTGYEIVKTDPWDGKDGEAIPE  421

Query  146  DEFSLEELMGDD  111
            +EFSLEELM  D
Sbjct  422  EEFSLEELMAAD  433



>gb|EMS60415.1| hypothetical protein TRIUR3_13550 [Triticum urartu]
Length=119

 Score =   148 bits (374),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = -1

Query  416  SYVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELG  237
            S+VWA AGKQ DLEK VGVGGYGYPA+V L+VK   YAPL+S+F+   I EFV+E G  G
Sbjct  13   SFVWAGAGKQADLEKQVGVGGYGYPAMVALNVKKGAYAPLRSAFELAEITEFVKEAGR-G  71

Query  236  GRGRNLPLTGTPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  93
            G+G NLPL G PT+V++EPWDGKDGE++EEDEFSLEELM D +   DE
Sbjct  72   GKG-NLPLEGAPTVVESEPWDGKDGEVIEEDEFSLEELMADSSAPNDE  118



>dbj|BAJ90795.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 87/130 (67%), Gaps = 4/130 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD +A  RN+YL TL S+ +KFK K + ++WA AGKQP+LE  + +GG+GYPAL VL
Sbjct  297  PHILDCQASCRNEYLNTLRSLGDKFKQKLWGWLWAEAGKQPELESTLEIGGFGYPALAVL  356

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            +VK   Y+ L+ SF  D IKEF+R++    GRG   P+ G   P I  TEPWDGKDGE+ 
Sbjct  357  NVKKMKYSILRGSFSEDGIKEFLRDLSY--GRGTTAPVKGAALPEIQATEPWDGKDGELP  414

Query  152  EEDEFSLEEL  123
              D+  L ++
Sbjct  415  TADDIDLSDV  424



>dbj|BAE88097.1| unnamed protein product [Macaca fascicularis]
Length=220

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  83   PHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  142

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  143  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTIVEREPWDGRDGELP  200

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  201  VEDDIDLSDVELDD-LGKDE  219



>gb|EAX00949.1| protein disulfide isomerase family A, member 6, isoform CRA_a 
[Homo sapiens]
Length=259

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  122  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  181

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  182  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  239

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  240  VEDDIDLSDVELDD-LGKDE  258



>ref|XP_004642404.1| PREDICTED: protein disulfide-isomerase A6 [Octodon degus]
Length=515

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG QP+LE  +G+GG+GYPA+  +
Sbjct  378  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQPELESALGIGGFGYPAMAAI  437

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P IV  EPWDGKDGE+ 
Sbjct  438  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAIVTREPWDGKDGELP  495

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  496  VEDDIDLSDVELDD-LEKDE  514



>ref|XP_419952.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Gallus gallus]
Length=447

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  309  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  368

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  369  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHAVEPWDGKDGELP  426

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD  +KDE
Sbjct  427  VEDDIDLSDVDLDDIWDKDE  446



>ref|XP_011397768.1| Protein disulfide-isomerase like 2-2 [Auxenochlorella protothecoides]
 gb|KFM24880.1| Protein disulfide-isomerase like 2-2 [Auxenochlorella protothecoides]
Length=1090

 Score =   130 bits (328),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = -1

Query  506   PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
             PDILDS A GRN  +E L ++AEKFK +P+S++WAA G QP LE + G+GGYGYPALV +
Sbjct  958   PDILDSGAAGRNDAIEALKTLAEKFKDRPFSFLWAAGGSQPALEANFGIGGYGYPALVAV  1017

Query  326   SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT-PTIVKTEPWDGKDGEIME  150
             +     ++ L+S+F+  ++ EF+  +    G+ R  P+TG    +  T+PWDGK+G +  
Sbjct  1018  NPAKGKFSSLRSAFEAANVLEFINSVRT--GQERVEPVTGALAALTTTDPWDGKEGVLEV  1075

Query  149   EDEFSLEELMGDD  111
             E+EFSLE+LMG +
Sbjct  1076  EEEFSLEDLMGKE  1088



>ref|XP_010706217.1| PREDICTED: protein disulfide-isomerase A6 [Meleagris gallopavo]
Length=447

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 4/140 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  309  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  368

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  369  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHAVEPWDGKDGELP  426

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD  +KDE
Sbjct  427  VEDDIDLSDVDLDDIWDKDE  446



>ref|NP_001253564.1| protein disulfide-isomerase A6 precursor [Macaca mulatta]
 ref|XP_005576620.1| PREDICTED: protein disulfide-isomerase A6 [Macaca fascicularis]
 ref|XP_007969684.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007969685.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Chlorocebus 
sabaeus]
Length=440

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|NP_001080305.1| protein disulfide isomerase family A, member 6 precursor [Xenopus 
laevis]
 gb|AAH46867.1| Pdip5-prov protein [Xenopus laevis]
Length=442

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE +L +A+K+K K + ++WA AG Q DLE  +G+GG+GYPA+  +
Sbjct  305  PHILDTGAAGRNSYLEVMLKMADKYKKKMWGWLWAEAGTQMDLETSLGIGGFGYPAMAAI  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  365  NARKMKFALLKGSFSEQGINEFLRELSY--GRGSTSPVGGGAIPKINTVEPWDGKDGELP  422

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  423  AEDDIDLSDVELDD-IGKDE  441



>ref|NP_001233576.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
 ref|XP_003827017.1| PREDICTED: protein disulfide-isomerase A6 [Pan paniscus]
 ref|XP_004028892.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Gorilla 
gorilla gorilla]
 dbj|BAK63728.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
Length=440

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_010627358.1| PREDICTED: protein disulfide-isomerase A6, partial [Fukomys damarensis]
Length=405

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  A  QP+LE  +G+GG+GYPA+  +
Sbjct  268  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAAAQPELENALGIGGFGYPAMAAI  327

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  328  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGTFPTIATREPWDGKDGELP  385

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  386  VEDDIDLSDVELDD-LEKDE  404



>ref|NP_001126483.1| protein disulfide-isomerase A6 precursor [Pongo abelii]
 sp|Q5R6T1.1|PDIA6_PONAB RecName: Full=Protein disulfide-isomerase A6; Flags: Precursor 
[Pongo abelii]
 emb|CAH92529.1| hypothetical protein [Pongo abelii]
Length=440

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|NP_005733.1| protein disulfide-isomerase A6 isoform d precursor [Homo sapiens]
 sp|Q15084.1|PDIA6_HUMAN RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Endoplasmic 
reticulum protein 5; Short=ER protein 5; Short=ERp5; 
AltName: Full=Protein disulfide isomerase P5; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor 
[Homo sapiens]
 dbj|BAA08450.1| human P5 [Homo sapiens]
 gb|AAH01312.1| Protein disulfide isomerase family A, member 6 [Homo sapiens]
 gb|AAY24070.1| unknown [Homo sapiens]
 gb|EAX00950.1| protein disulfide isomerase family A, member 6, isoform CRA_b 
[Homo sapiens]
 gb|ABM82112.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 gb|ABM85295.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 dbj|BAF82117.1| unnamed protein product [Homo sapiens]
 gb|AIC50514.1| PDIA6, partial [synthetic construct]
Length=440

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_004028893.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Gorilla 
gorilla gorilla]
Length=437

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  300  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  360  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  417

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  418  VEDDIDLSDVELDD-LGKDE  436



>gb|AAB50217.1| protein disulfide isomerase-related protein 5 [Homo sapiens]
Length=421

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  284  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  343

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  344  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  401

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  402  VEDDIDLSDVELDD-LGKDE  420



>ref|NP_001269636.1| protein disulfide-isomerase A6 isoform e precursor [Homo sapiens]
 dbj|BAH11740.1| unnamed protein product [Homo sapiens]
Length=437

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  300  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  360  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  417

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  418  VEDDIDLSDVELDD-LGKDE  436



>ref|NP_001269635.1| protein disulfide-isomerase A6 isoform c [Homo sapiens]
Length=445

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LGKDE  444



>ref|XP_009181940.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Papio anubis]
Length=437

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  300  PHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI++ EPWDG+DGE+ 
Sbjct  360  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIIEREPWDGRDGELP  417

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  418  VEDDIDLSDVELDD-LGKDE  436



>dbj|BAH12614.1| unnamed protein product [Homo sapiens]
Length=445

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LGKDE  444



>ref|XP_003272792.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Nomascus leucogenys]
Length=441

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  304  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  364  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  421

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  422  VEDDIDLSDVELDD-LGKDE  440



>ref|XP_007529904.1| PREDICTED: protein disulfide-isomerase A6 [Erinaceus europaeus]
Length=440

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 4/137 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSDLENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGTFPTISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVN  102
             ED+  L ++  DD  N
Sbjct  421  VEDDIDLSDVELDDFEN  437



>ref|XP_010377997.1| PREDICTED: protein disulfide-isomerase A6 [Rhinopithecus roxellana]
Length=512

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  375  PHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  434

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  435  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTIVEREPWDGRDGELP  492

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  493  VEDDIDLSDVELDD-LGKDE  511



>gb|EHH21891.1| hypothetical protein EGK_05054 [Macaca mulatta]
 gb|EHH55361.1| hypothetical protein EGM_04558 [Macaca fascicularis]
Length=508

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  371  PHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  430

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  431  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  488

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  489  VEDDIDLSDVELDD-LGKDE  507



>dbj|BAG54757.1| unnamed protein product [Homo sapiens]
Length=488

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  351  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  410

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  411  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  468

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  469  VEDDIDLSDVELDD-LGKDE  487



>ref|XP_003908325.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Papio anubis]
Length=440

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI++ EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIIEREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_005044328.1| PREDICTED: protein disulfide-isomerase A6 [Ficedula albicollis]
Length=442

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG QPDLE  +G+GG+GYPA+  +
Sbjct  305  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQPDLESSLGIGGFGYPAMAAV  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  365  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  422

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD   KDE
Sbjct  423  VEDDIDLSDVDLDD-FGKDE  441



>ref|NP_001269634.1| protein disulfide-isomerase A6 isoform b [Homo sapiens]
Length=488

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  351  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  410

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  411  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  468

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  469  VEDDIDLSDVELDD-LGKDE  487



>ref|XP_004274932.1| PREDICTED: protein disulfide-isomerase A6 [Orcinus orca]
 ref|XP_004310311.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Tursiops 
truncatus]
Length=440

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG QP+LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEAGAQPELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGVFPAISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_001948267.2| PREDICTED: protein disulfide-isomerase A6 [Acyrthosiphon pisum]
Length=434

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 4/119 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD +A  RN+YL TL S+ +KFK K + ++WA AGKQP+LE  + +GG+GYPAL VL
Sbjct  297  PHILDCQASCRNEYLNTLRSLGDKFKQKLWGWLWAEAGKQPELESTLEIGGFGYPALAVL  356

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEI  156
            +VK   Y+ L+ SF  D IKEF+R++    GRG   P+ G   P I  TEPWDGKDGE+
Sbjct  357  NVKKMKYSILRGSFSEDGIKEFLRDLSY--GRGTTAPVKGAALPEIQATEPWDGKDGEL  413



>gb|KFO31202.1| Protein disulfide-isomerase A6 [Fukomys damarensis]
Length=457

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  A  QP+LE  +G+GG+GYPA+  +
Sbjct  320  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAAAQPELENALGIGGFGYPAMAAI  379

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  380  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGTFPTIATREPWDGKDGELP  437

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  438  VEDDIDLSDVELDD-LEKDE  456



>dbj|BAC86977.1| unnamed protein product [Homo sapiens]
Length=492

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  355  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  414

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  415  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  472

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  473  VEDDIDLSDVELDD-LGKDE  491



>ref|XP_004310310.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Tursiops 
truncatus]
Length=448

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG QP+LE  +G+GG+GYPA+  +
Sbjct  311  PHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEAGAQPELENALGIGGFGYPAMAAI  370

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  371  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGVFPAISTREPWDGKDGELP  428

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  429  VEDDIDLSDVELDD-LEKDE  447



>ref|NP_001269633.1| protein disulfide-isomerase A6 isoform a [Homo sapiens]
Length=492

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  355  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  414

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTIV+ EPWDG+DGE+ 
Sbjct  415  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTIVEREPWDGRDGELP  472

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  473  VEDDIDLSDVELDD-LGKDE  491



>ref|XP_007933283.1| PREDICTED: protein disulfide-isomerase A6 [Orycteropus afer afer]
Length=440

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +AEK+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLAEKYKKKMWGWLWAEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPKITTIEPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_001744606.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90555.1| predicted protein [Monosiga brevicollis MX1]
Length=437

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            PDILD+KAEGRN  +E    +AEK+K +P+ +VWAAAG QP LE  + VGG+GYPALV +
Sbjct  299  PDILDTKAEGRNALIELQKDMAEKYKRRPFGWVWAAAGTQPALEAALDVGGFGYPALVAV  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGTPTIVKTEPWDGKDG-EIME  150
            + K + +A ++ ++  D I +FV  +  L GR     L G PT+ K EPWDG DG E   
Sbjct  359  NAKKERFATMRGAYTEDSISDFVGRL--LTGRQATANLPGMPTVEKVEPWDGSDGPEEAF  416

Query  149  EDEFSLEEL  123
            E+EF L +L
Sbjct  417  EEEFDLSDL  425



>ref|XP_004870016.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=440

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  A  QP+LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAAAQPELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPSIATREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>gb|EHB04452.1| Protein disulfide-isomerase A6, partial [Heterocephalus glaber]
Length=434

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  A  QP+LE  +G+GG+GYPA+  +
Sbjct  297  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAAAQPELENALGIGGFGYPAMAAI  356

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+I   EPWDGKDGE+ 
Sbjct  357  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPSIATREPWDGKDGELP  414

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  415  VEDDIDLSDVELDD-LEKDE  433



>ref|XP_002758076.1| PREDICTED: protein disulfide-isomerase A6 [Callithrix jacchus]
Length=440

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+IV+ EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPSIVEKEPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_010280693.1| PREDICTED: protein disulfide-isomerase A6 [Phaethon lepturus]
Length=464

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  327  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  386

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  387  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  444

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD  NKDE
Sbjct  445  VEDDIDLSDVDLDDW-NKDE  463



>gb|AAI48887.1| PDIA6 protein [Bos taurus]
Length=453

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  316  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  375

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  376  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  433

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  434  VEDDIDLSDVELDD-LEKDE  452



>gb|KFQ65954.1| Protein disulfide-isomerase A6, partial [Phaethon lepturus]
Length=440

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD  NKDE
Sbjct  421  VEDDIDLSDVDLDDW-NKDE  439



>ref|XP_006257985.1| PREDICTED: protein disulfide-isomerase A6 [Alligator mississippiensis]
Length=461

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 84/134 (63%), Gaps = 4/134 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  324  PHILDTGASGRNSYLEVMLKMAEKYKKKIWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  383

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  384  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKINTVEPWDGKDGELP  441

Query  152  EEDEFSLEELMGDD  111
             ED+  L ++  DD
Sbjct  442  VEDDIDLSDVDLDD  455



>ref|NP_001086643.1| protein disulfide isomerase family A, member 6 precursor [Xenopus 
laevis]
 gb|AAH77228.1| MGC79068 protein [Xenopus laevis]
Length=442

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  305  PHILDTGAAGRNSYLEVMLKMAEKYKKKMWGWLWTEAGAQMDLETSLGIGGFGYPAMAAI  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  365  NARKIKFALLKGSFSEQGINEFLRELSY--GRGSTSPVGGGAIPKINTVEPWDGKDGELP  422

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  423  AEDDIDLSDVELDD-IGKDE  441



>ref|XP_002117070.1| hypothetical protein TRIADDRAFT_50999 [Trichoplax adhaerens]
 gb|EDV20376.1| hypothetical protein TRIADDRAFT_50999 [Trichoplax adhaerens]
Length=434

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 6/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P+ILD+ A GRNK+LE +  + +KFK K + ++W AAG Q  LE  VGVGGYGYPA++ L
Sbjct  294  PNILDTGASGRNKFLELIHGLGDKFKRKQWGWLWCAAGTQSKLESAVGVGGYGYPAMIAL  353

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLT--GTPTIVKTEPWDGKDGEIM  153
            + +  ++A LK +F    + EF++E+    GRG    L   G P I+  + WDGKDG++ 
Sbjct  354  NPRKSLFAELKLAFSEQTVNEFLKELSY--GRGSTAALRGEGLPEILTIDSWDGKDGQLP  411

Query  152  EEDEFSLEELMGDDTVNKDE  93
            EE+EF L EL    TVN D+
Sbjct  412  EEEEFDLSEL--GITVNADD  429



>ref|XP_006021844.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Alligator sinensis]
Length=445

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 84/134 (63%), Gaps = 4/134 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGASGRNSYLEVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKINTVEPWDGKDGELP  425

Query  152  EEDEFSLEELMGDD  111
             ED+  L ++  DD
Sbjct  426  VEDDIDLSDVDLDD  439



>ref|XP_004887060.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=477

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  A  QP+LE  +G+GG+GYPA+  +
Sbjct  340  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAAAQPELENALGIGGFGYPAMAAI  399

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+I   EPWDGKDGE+ 
Sbjct  400  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPSIATREPWDGKDGELP  457

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  458  VEDDIDLSDVELDD-LEKDE  476



>ref|XP_004005735.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Ovis aries]
Length=432

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  295  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  354

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  355  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  412

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  413  VEDDIDLSDVELDD-LEKDE  431



>ref|XP_004696438.1| PREDICTED: protein disulfide-isomerase A6 [Echinops telfairi]
Length=468

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ LL +AEK+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  331  PHILDTGASGRNSYLDVLLKLAEKYKKKMWGWLWAEAGAQGELENALGIGGFGYPAMAAI  390

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I  TEPWDGKDGE+ 
Sbjct  391  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGVFPKISTTEPWDGKDGELP  448

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + +DE
Sbjct  449  VEDDVDLSDVELDD-LGRDE  467



>ref|XP_004005734.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Ovis aries]
Length=440

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|NP_001193274.1| protein disulfide-isomerase A6 precursor [Bos taurus]
 ref|XP_005892611.1| PREDICTED: protein disulfide-isomerase A6 [Bos mutus]
Length=440

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_005327417.1| PREDICTED: protein disulfide-isomerase A6 [Ictidomys tridecemlineatus]
Length=259

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  122  PHILDTGASGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  181

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDG+DGE+ 
Sbjct  182  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAITVREPWDGRDGELP  239

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  240  VEDDIDLSDVELDD-LEKDE  258



>ref|XP_005687063.1| PREDICTED: protein disulfide-isomerase A6 [Capra hircus]
Length=440

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>gb|ELR58675.1| Protein disulfide-isomerase A6, partial [Bos mutus]
Length=444

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  424

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  425  VEDDIDLSDVELDD-LEKDE  443



>gb|ELK29163.1| Protein disulfide-isomerase A6 [Myotis davidii]
Length=525

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  388  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  447

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  448  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTISTREPWDGKDGELP  505

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  506  VEDDIDLSDVELDD-LEKDE  524



>ref|XP_005366580.1| PREDICTED: protein disulfide-isomerase A6 [Microtus ochrogaster]
Length=445

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPTITAREPWDGKDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>ref|XP_006976688.1| PREDICTED: protein disulfide-isomerase A6 [Peromyscus maniculatus 
bairdii]
Length=602

 Score =   125 bits (314),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  465  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYDLENALGIGGFGYPAMAAI  524

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  525  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPAITPREPWDGKDGELP  582

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  583  VEDDIDLSDVELDD-LEKDE  601



>ref|XP_004459385.1| PREDICTED: protein disulfide-isomerase A6 [Dasypus novemcinctus]
Length=440

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGAAFPKISTVEPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             EDE  L ++  DD + KDE
Sbjct  421  VEDEIDLSDVELDD-LGKDE  439



>ref|XP_532876.2| PREDICTED: protein disulfide-isomerase A6 [Canis lupus familiaris]
Length=440

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + +DE
Sbjct  421  VEDDIDLSDVELDD-LERDE  439



>gb|AAH06865.2| Protein disulfide isomerase associated 6 [Mus musculus]
 dbj|BAE40104.1| unnamed protein product [Mus musculus]
 dbj|BAE40225.1| unnamed protein product [Mus musculus]
Length=445

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGSFPTITPREPWDGKDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>ref|NP_082235.1| protein disulfide-isomerase A6 precursor [Mus musculus]
 dbj|BAC36392.1| unnamed protein product [Mus musculus]
 dbj|BAE38431.1| unnamed protein product [Mus musculus]
 dbj|BAE38578.1| unnamed protein product [Mus musculus]
 dbj|BAE31623.1| unnamed protein product [Mus musculus]
Length=445

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGSFPTITPREPWDGKDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>ref|XP_010850414.1| PREDICTED: protein disulfide-isomerase A6 [Bison bison bison]
Length=540

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  403  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  462

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  463  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTISTREPWDGKDGELP  520

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  521  VEDDIDLSDVELDD-LEKDE  539



>ref|XP_006140909.1| PREDICTED: protein disulfide-isomerase A6 [Tupaia chinensis]
Length=535

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  398  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSDLESALGIGGFGYPAMAAI  457

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I + EPWDG+DGE+ 
Sbjct  458  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAIFEREPWDGRDGELP  515

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  516  VEDDIDLSDVELDD-LGKDE  534



>dbj|BAE39477.1| unnamed protein product [Mus musculus]
Length=445

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGSFPTITPREPWDGKDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>sp|Q922R8.3|PDIA6_MOUSE RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor [Mus 
musculus]
Length=440

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPTITPREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_011062424.1| PREDICTED: protein disulfide-isomerase A6 [Acromyrmex echinatior]
 gb|EGI60656.1| Protein disulfide-isomerase A6 [Acromyrmex echinatior]
Length=439

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 91/140 (65%), Gaps = 7/140 (5%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD +++ RN YL+TL ++ EK+K K + +VWA AG QP +E  + +GG+GYPAL  +
Sbjct  304  PHILDCQSDCRNGYLKTLSTLGEKYKKKMWGWVWAEAGAQPHIEDALEIGGFGYPALAAV  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            ++K   Y+ LK SF +D I EF+R++    GRG   PL G   P I++T PWDGKD E  
Sbjct  364  NIKKMKYSLLKGSFSYDGINEFLRDLSY--GRGGTAPLKGAQLPVIIETTPWDGKDAEPP  421

Query  152  EEDEFSLEELMGDDTVNKDE  93
            +E+E  L ++  DD   KDE
Sbjct  422  QEEEIDLSDVNLDD---KDE  438



>ref|XP_008848336.1| PREDICTED: protein disulfide-isomerase A6 [Nannospalax galili]
Length=440

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWAEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I+  EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGTFPPIIAREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_003787439.1| PREDICTED: protein disulfide-isomerase A6 [Otolemur garnettii]
Length=440

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQTELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+I + EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPSISEREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_006765261.1| PREDICTED: protein disulfide-isomerase A6 [Myotis davidii]
Length=539

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  402  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  461

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  462  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  519

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  520  VEDDIDLSDVELDD-LEKDE  538



>ref|XP_003411934.1| PREDICTED: protein disulfide-isomerase A6 [Loxodonta africana]
Length=440

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWAEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPKISTVEPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>tpg|DAA24511.1| TPA: protein disulfide isomerase family A, member 6 [Bos taurus]
Length=590

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  453  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  512

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  513  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTISTREPWDGKDGELP  570

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  571  VEDDIDLSDVELDD-LEKDE  589



>ref|XP_004373116.1| PREDICTED: protein disulfide-isomerase A6 [Trichechus manatus 
latirostris]
Length=440

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWAEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPKISTIEPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_003462749.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Cavia porcellus]
Length=440

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQTELESALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAITTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_006073828.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Bubalus bubalis]
Length=590

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  453  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  512

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  513  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPTISTREPWDGKDGELP  570

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  571  VEDDIDLSDVELDD-LEKDE  589



>ref|XP_005000363.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Cavia porcellus]
Length=441

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  304  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQTELESALGIGGFGYPAMAAI  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  364  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAITTREPWDGKDGELP  421

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  422  VEDDIDLSDVELDD-LGKDE  440



>ref|XP_010336276.1| PREDICTED: protein disulfide-isomerase A6 [Saimiri boliviensis 
boliviensis]
Length=638

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  501  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELESALGIGGFGYPAMAAI  560

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+IV+ EPWDG+DGE+ 
Sbjct  561  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPSIVEREPWDGRDGELP  618

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  619  VEDDIDLSDVELDD-LGKDE  637



>gb|KFP75924.1| Protein disulfide-isomerase A6, partial [Acanthisitta chloris]
Length=440

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 84/134 (63%), Gaps = 4/134 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSLEELMGDD  111
             ED+  L ++  DD
Sbjct  421  VEDDIDLSDVDLDD  434



>ref|XP_008160636.1| PREDICTED: protein disulfide-isomerase A6 [Eptesicus fuscus]
Length=438

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  301  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  360

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  361  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAISTREPWDGKDGELP  418

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  419  VEDDIDLSDVELDD-LEKDE  437



>ref|XP_007127699.1| PREDICTED: protein disulfide-isomerase A6 [Physeter catodon]
Length=440

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_007456979.1| PREDICTED: protein disulfide-isomerase A6 [Lipotes vexillifer]
Length=440

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKIWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGVFPAISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_006903376.1| PREDICTED: protein disulfide-isomerase A6-like [Elephantulus 
edwardii]
Length=508

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ LL +A+K+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  371  PHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWAEAGAQNELESALGIGGFGYPAMAAI  430

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  431  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPKISSIEPWDGKDGELP  488

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  489  VEDDIDLSDVELDD-LGKDE  507



>ref|XP_006869520.1| PREDICTED: protein disulfide-isomerase A6 [Chrysochloris asiatica]
Length=437

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 6/141 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +AEK+K K + ++WA AG Q +LE  +G+GG+GYPA+  +
Sbjct  299  PHILDTGAAGRNSYLEVLLKLAEKYKKKMWGWLWAEAGTQSELENALGIGGFGYPAMAAI  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEI-  156
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  359  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPKISTIEPWDGKDGELP  416

Query  155  MEEDEFSLEELMGDDTVNKDE  93
            +E+D   L ++  DD + KDE
Sbjct  417  VEDDYIDLSDVELDD-LGKDE  436



>ref|XP_008570350.1| PREDICTED: protein disulfide-isomerase A6 [Galeopterus variegatus]
Length=460

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  323  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQNELENALGIGGFGYPAMAAI  382

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDG+DGE+ 
Sbjct  383  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGTFPTIYIREPWDGRDGELP  440

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  441  MEDDIDLSDVELDD-LGKDE  459



>ref|XP_009068583.1| PREDICTED: protein disulfide-isomerase A6 [Acanthisitta chloris]
Length=444

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 84/134 (63%), Gaps = 4/134 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSLEELMGDD  111
             ED+  L ++  DD
Sbjct  425  VEDDIDLSDVDLDD  438



>ref|XP_003984581.1| PREDICTED: protein disulfide-isomerase A6 [Felis catus]
Length=443

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  306  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  365

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  366  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  423

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  424  VEDDIDLSDVELDD-LEKDE  442



>ref|XP_004436529.1| PREDICTED: protein disulfide-isomerase A6 [Ceratotherium simum 
simum]
Length=432

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  295  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  354

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  355  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  412

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  413  VEDDIDLSDVELDD-LEKDE  431



>ref|XP_010962323.1| PREDICTED: protein disulfide-isomerase A6 [Camelus bactrianus]
 ref|XP_010981000.1| PREDICTED: protein disulfide-isomerase A6 [Camelus dromedarius]
Length=440

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELESALGIGGFGYPAMAAV  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_006197174.1| PREDICTED: protein disulfide-isomerase A6 [Vicugna pacos]
Length=440

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELESALGIGGFGYPAMAAV  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_005967905.1| PREDICTED: protein disulfide-isomerase A6 [Pantholops hodgsonii]
Length=440

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            +     +A LK SF    I EF+RE+    GRG   P+ G   PTI   EPWDGKDGE+ 
Sbjct  363  NALKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPTISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>gb|EPQ08422.1| Protein disulfide-isomerase A6 [Myotis brandtii]
Length=460

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  323  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  382

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  383  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAISTREPWDGKDGELP  440

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  441  VEDDIDLSDVELDD-LEKDE  459



>ref|XP_005085000.1| PREDICTED: protein disulfide-isomerase A6 [Mesocricetus auratus]
Length=445

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDG+DGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGSFPAITAREPWDGRDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>ref|XP_005867329.1| PREDICTED: protein disulfide-isomerase A6 [Myotis brandtii]
Length=471

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  334  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  393

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  394  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAISTREPWDGKDGELP  451

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  452  VEDDIDLSDVELDD-LEKDE  470



>ref|XP_004609467.1| PREDICTED: protein disulfide-isomerase A6 [Sorex araneus]
Length=466

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ LL +A+K+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  329  PHILDTGAVGRNSYLDVLLKLADKYKKKMWGWLWTEAGAQTDLENALGIGGFGYPAMAAI  388

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P+I   EPWDGKDGE+ 
Sbjct  389  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPSISTREPWDGKDGELP  446

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  447  VEDDIDLSDVELDD-LGKDE  465



>ref|XP_007607763.1| PREDICTED: protein disulfide-isomerase A6 [Cricetulus griseus]
Length=445

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGAAGRNSYLEILLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDG+DGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGSFPAITAREPWDGRDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>ref|XP_006102414.1| PREDICTED: protein disulfide-isomerase A6 [Myotis lucifugus]
Length=503

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  366  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  425

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  426  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAISTREPWDGKDGELP  483

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  484  VEDDIDLSDVELDD-LEKDE  502



>ref|XP_006191925.1| PREDICTED: protein disulfide-isomerase A6, partial [Camelus ferus]
Length=436

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  299  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELESALGIGGFGYPAMAAV  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  359  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  416

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  417  VEDDIDLSDVELDD-LEKDE  435



>ref|XP_001502324.3| PREDICTED: protein disulfide-isomerase A6 [Equus caballus]
Length=448

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  311  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI  370

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  371  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  428

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  429  VEDDIDLSDVELDD-LEKDE  447



>ref|NP_001182048.1| protein disulfide-isomerase A6 precursor [Sus scrofa]
 dbj|BAJ11758.1| protein disulfide isomerase P5 [Sus scrofa]
Length=440

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQTELEHALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_001602967.1| PREDICTED: probable protein disulfide-isomerase A6 [Nasonia vitripennis]
Length=437

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 7/140 (5%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD +++ RN YL+ L ++ EKFK K + +VWA AG QP +E+ + +GG+GYPAL  +
Sbjct  302  PHILDCQSDCRNDYLKILTTLGEKFKKKMWGWVWAEAGAQPHIEEALEIGGFGYPALAAV  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            ++K   Y+ LK SF  D I EF+R++    GRG   PL GT  P I +TEPWDGKD E  
Sbjct  362  NIKKMKYSLLKGSFSQDGINEFLRDLSY--GRGGTAPLKGTELPKIYETEPWDGKDAEPP  419

Query  152  EEDEFSLEELMGDDTVNKDE  93
            +E++  L ++   D   KDE
Sbjct  420  QEEDIDLSDV---DLDEKDE  436



>ref|XP_009940378.1| PREDICTED: protein disulfide-isomerase A6 [Opisthocomus hoazin]
Length=447

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++WA AG Q DLE  +G+GG+GYPA+  +
Sbjct  310  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWAEAGAQSDLESSLGIGGFGYPAMAAV  369

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  370  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  427

Query  152  EEDEFSL  132
             ED+  L
Sbjct  428  VEDDIDL  434



>ref|NP_001004442.1| protein disulfide-isomerase A6 precursor [Rattus norvegicus]
 gb|AAH82063.1| Protein disulfide isomerase family A, member 6 [Rattus norvegicus]
 gb|EDM03147.1| rCG62282, isoform CRA_a [Rattus norvegicus]
Length=445

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  308  PHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  367

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  368  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPNITPREPWDGKDGELP  425

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  426  VEDDIDLSDVELDD-LEKDE  444



>gb|AGX25157.1| disulfide-isomerase, partial [Leptinotarsa decemlineata]
Length=174

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 7/140 (5%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD ++E RN Y+E L ++ EKFK K + +VW+ AG Q +LE  V +GG+GYPA+ V+
Sbjct  39   PHILDCQSECRNGYIELLTTLGEKFKKKMWGWVWSEAGSQQELENAVDIGGFGYPAMAVI  98

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            S K   Y+ L+ SF  D I EF+R++    G+G   P+ GT  P I   EPWDGKDG + 
Sbjct  99   SPKKLKYSILRGSFSKDGIYEFLRDLSY--GKGNTAPIKGTSLPKINTIEPWDGKDGVLP  156

Query  152  EEDEFSLEELMGDDTVNKDE  93
            EE++  L ++   D   KDE
Sbjct  157  EEEDIDLSDV---DLDEKDE  173



>gb|KFR16570.1| Protein disulfide-isomerase A6, partial [Opisthocomus hoazin]
Length=434

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++WA AG Q DLE  +G+GG+GYPA+  +
Sbjct  297  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWAEAGAQSDLESSLGIGGFGYPAMAAV  356

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  357  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  414

Query  152  EEDEFSL  132
             ED+  L
Sbjct  415  VEDDIDL  421



>emb|CAA55891.1| CaBP1 [Rattus norvegicus]
Length=431

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  294  PHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  353

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  354  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPNITPREPWDGKDGELP  411

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  412  VEDDIDLSDVELDD-LEKDE  430



>ref|XP_005238268.1| PREDICTED: protein disulfide-isomerase A6 [Falco peregrinus]
Length=444

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++WA AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWAEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>sp|Q63081.2|PDIA6_RAT RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Calcium-binding 
protein 1; Short=CaBP1; AltName: Full=Protein 
disulfide isomerase P5; AltName: Full=Thioredoxin domain-containing 
protein 7; Flags: Precursor [Rattus norvegicus]
Length=440

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPNITPREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LEKDE  439



>ref|XP_007080745.1| PREDICTED: protein disulfide-isomerase A6 [Panthera tigris altaica]
Length=259

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+G PA+  +
Sbjct  122  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGSPAMAAI  181

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  182  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  239

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  240  VEDDIDLSDVELDD-LEKDE  258



>gb|EPY75602.1| protein disulfide-isomerase A6 [Camelus ferus]
Length=551

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  414  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELESALGIGGFGYPAMAAV  473

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  474  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  531

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  532  VEDDIDLSDVELDD-LEKDE  550



>ref|XP_002921563.2| PREDICTED: protein disulfide-isomerase A6 [Ailuropoda melanoleuca]
Length=534

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  397  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  456

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  457  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAISVREPWDGKDGELP  514

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  515  VEDDIDLSDVELDD-LEKDE  533



>ref|XP_005404513.1| PREDICTED: protein disulfide-isomerase A6, partial [Chinchilla 
lanigera]
Length=610

 Score =   123 bits (308),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 89/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  473  PHILDTGAAGRNAYLEVLLKLADKYKKKMWGWLWTEAGAQSELESALGIGGFGYPAMAAI  532

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I+  EPWDG+DGE+ 
Sbjct  533  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGIFPAIISREPWDGQDGELP  590

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  591  VEDDIDLSDVELDD-LEKDE  609



>gb|EGW08481.1| Protein disulfide-isomerase A6 [Cricetulus griseus]
Length=259

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+G PA+  +
Sbjct  122  PHILDTGAAGRNSYLEILLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGSPAMAAI  181

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDG+DGE+ 
Sbjct  182  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGSFPAITAREPWDGRDGELP  239

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  240  VEDDIDLSDVELDD-LEKDE  258



>ref|XP_004665748.1| PREDICTED: protein disulfide-isomerase A6 [Jaculus jaculus]
Length=440

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLEVLLRLADKYKKKMWGWLWTEAGAQFELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDG+DGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGAFPAISTREPWDGRDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + KDE
Sbjct  421  VEDDIDLSDVELDD-LGKDE  439



>ref|XP_010018621.1| PREDICTED: protein disulfide-isomerase A6 [Nestor notabilis]
Length=444

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>gb|KFU90776.1| Protein disulfide-isomerase A6, partial [Chaetura pelagica]
Length=440

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P++G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVSGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>gb|KFQ44656.1| Protein disulfide-isomerase A6, partial [Nestor notabilis]
Length=440

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>ref|XP_009997534.1| PREDICTED: protein disulfide-isomerase A6 [Chaetura pelagica]
Length=464

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  327  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  386

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P++G   P I   EPWDGKDGE+ 
Sbjct  387  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVSGGAFPKIHSVEPWDGKDGELP  444

Query  152  EEDEFSLE  129
             ED+  L 
Sbjct  445  VEDDIDLS  452



>ref|XP_004746019.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
 ref|XP_004790281.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
Length=454

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  317  PHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  376

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  377  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPPISAREPWDGKDGELP  434

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + +DE
Sbjct  435  VEDDIDLSDVELDD-LERDE  453



>ref|XP_010073176.1| PREDICTED: protein disulfide-isomerase A6, partial [Pterocles 
gutturalis]
Length=444

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKINSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>gb|KFU96864.1| Protein disulfide-isomerase A6, partial [Pterocles gutturalis]
Length=439

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  302  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  361

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  362  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKINSVEPWDGKDGELP  419

Query  152  EEDEFSL  132
             ED+  L
Sbjct  420  VEDDIDL  426



>ref|XP_006745860.1| PREDICTED: protein disulfide-isomerase A6 [Leptonychotes weddellii]
Length=432

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  295  PHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  354

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  355  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISAREPWDGKDGELP  412

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + +DE
Sbjct  413  VEDDIDLSDVELDD-LERDE  431



>gb|KFV66878.1| Protein disulfide-isomerase A6, partial [Picoides pubescens]
Length=440

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>ref|XP_004401842.1| PREDICTED: protein disulfide-isomerase A6 [Odobenus rosmarus 
divergens]
Length=440

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISAREPWDGKDGELP  420

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + +DE
Sbjct  421  VEDDIDLSDVELDD-LERDE  439



>ref|XP_005146160.1| PREDICTED: protein disulfide-isomerase A6 [Melopsittacus undulatus]
Length=488

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  351  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  410

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  411  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKIHSVEPWDGKDGELP  468

Query  152  EEDEFSL  132
             ED+  L
Sbjct  469  VEDDIDL  475



>ref|XP_009898142.1| PREDICTED: protein disulfide-isomerase A6, partial [Picoides 
pubescens]
Length=444

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVAGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_006818500.1| PREDICTED: protein disulfide-isomerase A6-like, partial [Saccoglossus 
kowalevskii]
Length=188

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 4/118 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRNKYL  LL +A+K+K K + +VWA AG Q D+E+ +G+GG+GYPA+  L
Sbjct  73   PHILDTGAVGRNKYLNLLLDMADKYKKKQWGWVWAEAGSQFDVEESLGIGGFGYPAMAAL  132

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGE  159
            + +   YA L+ SF  D + EF+RE+    GRG   P+ G   P + K E WDGKDG+
Sbjct  133  NSRKMKYALLRGSFSEDGLNEFLRELSY--GRGSTAPVKGAKLPKVAKIEAWDGKDGQ  188



>ref|XP_005432317.1| PREDICTED: protein disulfide-isomerase A6 [Falco cherrug]
Length=444

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++WA AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGALGRNSYLDVMLKMAEKYKKKMWGWLWAEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>gb|ELK13980.1| Protein disulfide-isomerase A6 [Pteropus alecto]
Length=469

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  +
Sbjct  332  PHILDTGAAGRNSYLDVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAI  391

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  392  NARKMKFALLKGSFSEQGINEFLRELS--FGRGSTAPVGGGAFPAISTREPWDGKDGELP  449

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD + +DE
Sbjct  450  VEDDIDLSDVELDD-LERDE  468



>ref|XP_009330780.1| PREDICTED: protein disulfide-isomerase A6 [Pygoscelis adeliae]
Length=443

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  306  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  365

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  366  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  423

Query  152  EEDEFSL  132
             ED+  L
Sbjct  424  VEDDIDL  430



>ref|XP_009585693.1| PREDICTED: protein disulfide-isomerase A6 [Fulmarus glacialis]
Length=444

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_010304195.1| PREDICTED: protein disulfide-isomerase A6 [Balearica regulorum 
gibbericeps]
Length=444

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>gb|KFW86281.1| Protein disulfide-isomerase A6, partial [Phalacrocorax carbo]
Length=369

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  232  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  291

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  292  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHTVEPWDGKDGELP  349

Query  152  EEDEFSL  132
             ED+  L
Sbjct  350  VEDDIDL  356



>gb|KFW73081.1| Protein disulfide-isomerase A6, partial [Pygoscelis adeliae]
Length=440

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>ref|XP_009489926.1| PREDICTED: protein disulfide-isomerase A6 [Pelecanus crispus]
Length=444

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_009513284.1| PREDICTED: protein disulfide-isomerase A6, partial [Phalacrocorax 
carbo]
Length=390

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  253  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  312

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  313  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHTVEPWDGKDGELP  370

Query  152  EEDEFSL  132
             ED+  L
Sbjct  371  VEDDIDL  377



>ref|XP_003757912.1| PREDICTED: protein disulfide-isomerase A6 [Sarcophilus harrisii]
Length=437

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 94/160 (59%), Gaps = 5/160 (3%)
 Frame = -1

Query  566  DRMLWKKNvalllfafvafLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQ  387
            D  + KK         VA LP ILD+ A GRN YLE LL +AEK+K K + ++W  AG Q
Sbjct  280  DEAVAKKTCEDHQLCVVAVLPHILDTGAAGRNSYLEVLLKLAEKYKKKLWGWLWTEAGAQ  339

Query  386  PDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG  207
             +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+RE+    GRG   P+ G
Sbjct  340  HELETALGIGGFGYPAMAAVNTRKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGG  397

Query  206  --TPTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  93
               P I    PWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  GIFPKINTVAPWDGKDGELPIEDDIDLSDVELDD-LGKDE  436



>gb|ERE68284.1| protein disulfide-isomerase A6-like protein [Cricetulus griseus]
Length=139

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 83/133 (62%), Gaps = 5/133 (4%)
 Frame = -1

Query  485  AEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVLSVKNQVY  306
            A GRN YLE LL +A+K+K K + ++W  AG Q +LE  +G+GG+GYPA+  ++ +   +
Sbjct  9    AAGRNSYLEILLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYPAMAAINARKMKF  68

Query  305  APLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIMEEDEFSL  132
            A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDG+DGE+  ED+  L
Sbjct  69   ALLKGSFSEQGINEFLRELSF--GRGSTAPVGGGSFPAITAREPWDGRDGELPVEDDIDL  126

Query  131  EELMGDDTVNKDE  93
             ++  DD + KDE
Sbjct  127  SDVELDD-LEKDE  138



>gb|KGL97075.1| Protein disulfide-isomerase A6, partial [Charadrius vociferus]
Length=440

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>gb|KFO12540.1| Protein disulfide-isomerase A6, partial [Balearica regulorum 
gibbericeps]
Length=440

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>gb|KFQ57711.1| Protein disulfide-isomerase A6, partial [Pelecanus crispus]
Length=440

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>gb|KFV98779.1| Protein disulfide-isomerase A6, partial [Fulmarus glacialis]
Length=440

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  303  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAI  362

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  363  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  420

Query  152  EEDEFSL  132
             ED+  L
Sbjct  421  VEDDIDL  427



>emb|CAJ82905.1| protein disulfide isomerase family A, member 6 [Xenopus (Silurana) 
tropicalis]
Length=441

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ ++ +A+K+K K + ++WA AG Q DLE  +G+GG+GYPA+  +
Sbjct  304  PHILDTGASGRNSYLDVMMKMADKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAI  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I    PWDGKDGE+ 
Sbjct  364  NARKMKFALLKGSFSEQGINEFLRELSF--GRGSTSPVGGGAIPKINTVVPWDGKDGELP  421

Query  152  EEDEFSLEELMGDDTVNKDE  93
             ED+  L ++  DD   KDE
Sbjct  422  AEDDIDLSDVELDD-FEKDE  440



>ref|XP_009273886.1| PREDICTED: protein disulfide-isomerase A6 [Aptenodytes forsteri]
Length=444

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGSFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_009806227.1| PREDICTED: protein disulfide-isomerase A6 [Gavia stellata]
Length=444

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_011160406.1| PREDICTED: protein disulfide-isomerase A6 [Solenopsis invicta]
 gb|EFZ17811.1| hypothetical protein SINV_06451 [Solenopsis invicta]
Length=439

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 91/140 (65%), Gaps = 7/140 (5%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD +++ RN YL+TL ++ EK+K K + +VWA AG QP +E  + +GG+GYPAL  +
Sbjct  304  PHILDCQSDCRNGYLKTLSNLGEKYKKKMWGWVWAEAGAQPHIEDALEIGGFGYPALAAV  363

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            ++K   Y+ LK SF +D I EF+R++    GRG   PL G   P I++T PWDGKD E  
Sbjct  364  NIKKMKYSLLKGSFSYDGINEFLRDLSY--GRGGTAPLKGAQLPVIIETTPWDGKDAEPP  421

Query  152  EEDEFSLEELMGDDTVNKDE  93
            +E++  L ++  D+   KDE
Sbjct  422  QEEDIDLSDVNLDE---KDE  438



>gb|KFV71961.1| Protein disulfide-isomerase A6, partial [Struthio camelus australis]
Length=437

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  300  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  359

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  360  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKINAVEPWDGKDGELP  417

Query  152  EEDEFSL  132
             ED+  L
Sbjct  418  VEDDIDL  424



>ref|XP_007476199.1| PREDICTED: protein disulfide-isomerase A6 [Monodelphis domestica]
Length=437

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 94/160 (59%), Gaps = 5/160 (3%)
 Frame = -1

Query  566  DRMLWKKNvalllfafvafLPDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQ  387
            D  + KK         VA LP ILD+ A GRN YLE LL +AEK+K K + ++W  AG Q
Sbjct  280  DEAVAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLAEKYKKKLWGWLWTEAGAQ  339

Query  386  PDLEKHVGVGGYGYPALVVLSVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG  207
             +LE  +G+GG+GYPA+  ++ +   +A LK SF    I EF+R++    GRG   P+ G
Sbjct  340  YELENALGIGGFGYPAMAAINTRKMKFALLKGSFSEQGINEFLRDLSV--GRGSTAPVGG  397

Query  206  T--PTIVKTEPWDGKDGEIMEEDEFSLEELMGDDTVNKDE  93
               P I    PWDGKDGE+  ED+  L ++  DD + KDE
Sbjct  398  GVFPKISTVAPWDGKDGELPIEDDIDLSDVELDD-LGKDE  436



>ref|XP_006817847.1| PREDICTED: protein disulfide-isomerase A6-like, partial [Saccoglossus 
kowalevskii]
Length=301

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 79/119 (66%), Gaps = 4/119 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRNKYL  LL +A+K+K K + +VWA AG Q D+E+ +G+GG+GYPA+  L
Sbjct  162  PHILDTGAVGRNKYLNLLLDMADKYKKKQWGWVWAEAGSQFDVEESLGIGGFGYPAMAAL  221

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEI  156
            + +   YA L+ SF  D + EF+RE+    GRG   P+ G   P + K E WDGKDG++
Sbjct  222  NSRKMKYALLRGSFSEDGLNEFLRELSY--GRGSTAPVKGAKLPKVAKIEAWDGKDGQM  278



>ref|XP_009638086.1| PREDICTED: protein disulfide-isomerase A6 [Egretta garzetta]
Length=444

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_002002212.1| GI13846 [Drosophila mojavensis]
 gb|EDW11654.1| GI13846 [Drosophila mojavensis]
Length=435

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD  A  RNK+L+TL ++ EKFK K + + WA  G+Q  LE+ + VGG+GYPA+ V+
Sbjct  298  PHILDCDANCRNKFLDTLRTLGEKFKQKLWGWAWAEGGQQLALEEALEVGGFGYPAMAVV  357

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + K   ++ LK SF  D I EF+R+I    GRG+  P+ G   P IV  +PWDGK+GE+ 
Sbjct  358  NFKKMKFSVLKGSFSKDGINEFLRDISY--GRGQTSPVRGAKKPKIVSVDPWDGKNGELP  415

Query  152  EEDEFSLEELMGDDTVNKDE  93
             E++  L ++  DD V KDE
Sbjct  416  TEEDIDLSDINLDDEV-KDE  434



>ref|XP_010391624.1| PREDICTED: protein disulfide-isomerase A6 [Corvus cornix cornix]
Length=442

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  305  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  365  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  422

Query  152  EEDEFSL  132
             ED+  L
Sbjct  423  VEDDIDL  429



>ref|XP_009981655.1| PREDICTED: protein disulfide-isomerase A6, partial [Tauraco erythrolophus]
Length=443

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  306  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  365

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  366  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  423

Query  152  EEDEFSL  132
             ED+  L
Sbjct  424  VEDDIDL  430



>ref|XP_009874965.1| PREDICTED: protein disulfide-isomerase A6 [Apaloderma vittatum]
Length=444

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  307  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  366

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  367  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  424

Query  152  EEDEFSL  132
             ED+  L
Sbjct  425  VEDDIDL  431



>ref|XP_008639999.1| PREDICTED: protein disulfide-isomerase A6 [Corvus brachyrhynchos]
Length=442

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  305  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  364

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTG--TPTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  365  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  422

Query  152  EEDEFSL  132
             ED+  L
Sbjct  423  VEDDIDL  429



>ref|XP_010564977.1| PREDICTED: protein disulfide-isomerase A6, partial [Haliaeetus 
leucocephalus]
Length=436

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -1

Query  506  PDILDSKAEGRNKYLETLLSVAEKFKTKPYSYVWAAAGKQPDLEKHVGVGGYGYPALVVL  327
            P ILD+ A GRN YL+ +L +AEK+K K + ++W  AG Q DLE  +G+GG+GYPA+  +
Sbjct  299  PHILDTGASGRNSYLDVMLKMAEKYKKKMWGWLWTEAGAQSDLESSLGIGGFGYPAMAAV  358

Query  326  SVKNQVYAPLKSSFQHDHIKEFVREIGELGGRGRNLPLTGT--PTIVKTEPWDGKDGEIM  153
            + +   +A LK SF    I EF+RE+    GRG   P+ G   P I   EPWDGKDGE+ 
Sbjct  359  NARKMKFALLKGSFSEQGINEFLRELSV--GRGSTAPVGGGAFPKIHSVEPWDGKDGELP  416

Query  152  EEDEFSL  132
             ED+  L
Sbjct  417  VEDDIDL  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925