BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045O23

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    289   4e-89   Nicotiana sylvestris
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    288   5e-89   Nicotiana tomentosiformis
gb|ABO31100.1|  ovule receptor-like kinase 28                           285   1e-87   Solanum chacoense
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    285   1e-87   Solanum tuberosum [potatoes]
emb|CDO97777.1|  unnamed protein product                                284   2e-87   Coffea canephora [robusta coffee]
ref|XP_002533323.1|  leucine-rich repeat transmembrane protein ki...    281   3e-87   
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    283   7e-87   
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    281   3e-86   Solanum lycopersicum
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    279   2e-85   Nicotiana tomentosiformis
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         278   4e-85   Jatropha curcas
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   6e-85   Solanum tuberosum [potatoes]
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    277   1e-84   Malus domestica [apple tree]
ref|XP_008465039.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    274   1e-84   
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    276   2e-84   Prunus mume [ume]
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    276   2e-84   
ref|XP_008465038.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    274   4e-84   
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             275   8e-84   Prunus persica
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    275   1e-83   Fragaria vesca subsp. vesca
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    274   1e-83   Nicotiana sylvestris
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    274   1e-83   Nicotiana sylvestris
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                274   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             274   2e-83   Citrus clementina [clementine]
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    273   2e-83   
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    274   2e-83   Citrus sinensis [apfelsine]
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                273   2e-83   Erythranthe guttata [common monkey flower]
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    273   4e-83   Cucumis melo [Oriental melon]
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    273   5e-83   
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    272   8e-83   Populus euphratica
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    272   1e-82   
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    272   1e-82   Cucumis sativus [cucumbers]
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    271   2e-82   Eucalyptus grandis [rose gum]
ref|NP_001241934.1|  protein STRUBBELIG-RECEPTOR FAMILY 6-like          268   2e-82   
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    270   5e-82   Glycine max [soybeans]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    270   5e-82   
ref|XP_008462233.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    269   5e-82   Cucumis melo [Oriental melon]
ref|XP_004141737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    268   5e-82   
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    270   7e-82   Glycine soja [wild soybean]
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    269   7e-82   
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    269   8e-82   Glycine soja [wild soybean]
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    270   8e-82   Cucumis melo [Oriental melon]
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    270   9e-82   
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             269   1e-81   Phaseolus vulgaris [French bean]
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    269   1e-81   Cicer arietinum [garbanzo]
gb|KHG25534.1|  protein strubbelig-receptor family 6                    269   1e-81   Gossypium arboreum [tree cotton]
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    269   2e-81   Sesamum indicum [beniseed]
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    268   2e-81   Phoenix dactylifera
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    269   2e-81   Phoenix dactylifera
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    268   2e-81   Medicago truncatula
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    268   2e-81   Glycine max [soybeans]
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             268   2e-81   Phaseolus vulgaris [French bean]
emb|CBI35784.3|  unnamed protein product                                268   2e-81   Vitis vinifera
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    269   3e-81   
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    268   3e-81   Vitis vinifera
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 268   4e-81   Medicago truncatula
gb|AFW90526.1|  strubbelig-receptor family 6-like protein               266   6e-81   Phaseolus vulgaris [French bean]
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        267   6e-81   Glycine soja [wild soybean]
gb|KDO53740.1|  hypothetical protein CISIN_1g0080551mg                  250   7e-81   Citrus sinensis [apfelsine]
ref|XP_004159012.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    267   8e-81   
gb|KGN45433.1|  hypothetical protein Csa_7G447950                       267   8e-81   
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    266   2e-80   Cicer arietinum [garbanzo]
ref|XP_007024796.1|  Strubbelig-receptor family 6                       266   2e-80   
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             266   3e-80   
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    265   6e-80   Populus euphratica
gb|KHG18134.1|  protein strubbelig-receptor family 6                    265   8e-80   Gossypium arboreum [tree cotton]
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    264   1e-79   Nelumbo nucifera [Indian lotus]
gb|ADB93024.1|  leucine-rich repeat receptor-like protein kinase        250   2e-79   Dendrobium nobile
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    261   5e-79   Gossypium arboreum [tree cotton]
gb|KJB70030.1|  hypothetical protein B456_011G054100                    262   6e-79   Gossypium raimondii
gb|KJB57112.1|  hypothetical protein B456_009G148500                    261   1e-78   Gossypium raimondii
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    261   1e-78   Gossypium arboreum [tree cotton]
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   2e-78   
gb|KEH24658.1|  strubbelig-receptor family protein                      260   4e-78   Medicago truncatula
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    259   7e-78   Elaeis guineensis
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    258   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    258   2e-77   
emb|CAN80221.1|  hypothetical protein VITISV_027894                     256   3e-77   Vitis vinifera
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   7e-77   Nicotiana sylvestris
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    257   8e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   3e-76   Nicotiana sylvestris
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   4e-76   Nicotiana sylvestris
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    253   1e-75   Setaria italica
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    253   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    252   3e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          252   5e-75   Amborella trichopoda
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     251   1e-74   Zea mays [maize]
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      249   2e-74   Zea mays [maize]
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    250   2e-74   Zea mays [maize]
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    250   2e-74   
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      249   3e-74   Zea mays [maize]
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    249   6e-74   
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    248   9e-74   
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    248   9e-74   Setaria italica
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          248   9e-74   Sorghum bicolor [broomcorn]
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             248   1e-73   
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    248   1e-73   Oryza brachyantha
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             248   1e-73   Eutrema salsugineum [saltwater cress]
gb|EPS61932.1|  ovule receptor-like kinase 28                           247   2e-73   Genlisea aurea
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    247   2e-73   Nicotiana tomentosiformis
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    248   2e-73   Setaria italica
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      247   2e-73   
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             247   3e-73   Capsella rubella
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          247   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    247   3e-73   
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    246   4e-73   Arabis alpina [alpine rockcress]
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    246   6e-73   Isatis tinctoria [woad]
ref|NP_001064502.1|  Os10g0389800                                       246   7e-73   
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   7e-73   Camelina sativa [gold-of-pleasure]
gb|EEC66871.1|  hypothetical protein OsI_33412                          246   8e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               245   1e-72   
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    246   1e-72   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049184.1|  Os03g0183800                                       245   1e-72   
emb|CDY02495.1|  BnaA08g01020D                                          244   3e-72   
ref|XP_010937238.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   3e-72   
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    244   3e-72   Camelina sativa [gold-of-pleasure]
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    244   3e-72   Zea mays [maize]
ref|XP_010534992.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   4e-72   Tarenaya hassleriana [spider flower]
emb|CDY25686.1|  BnaC03g69890D                                          244   4e-72   Brassica napus [oilseed rape]
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    244   4e-72   Brassica rapa
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   6e-72   Elaeis guineensis
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   7e-72   Brachypodium distachyon [annual false brome]
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       243   7e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    243   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010487232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             242   2e-71   
emb|CDY39110.1|  BnaA01g29460D                                          242   2e-71   Brassica napus [oilseed rape]
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   3e-71   Brassica rapa
emb|CDX97567.1|  BnaA05g25120D                                          241   3e-71   
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    239   4e-71   Triticum urartu
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    241   5e-71   Brassica rapa
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    240   5e-71   Sesamum indicum [beniseed]
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    241   5e-71   Arabis alpina [alpine rockcress]
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          241   5e-71   
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             241   5e-71   
ref|XP_006845116.1|  hypothetical protein AMTR_s00005p00184950          233   6e-71   
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             240   9e-71   Eutrema salsugineum [saltwater cress]
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             239   2e-70   Capsella rubella
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   2e-70   
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    239   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    238   6e-70   
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   6e-70   Setaria italica
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   9e-70   
ref|XP_001780717.1|  predicted protein                                  228   1e-69   
emb|CDX98445.1|  BnaC05g39300D                                          237   1e-69   
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    237   1e-69   Zea mays [maize]
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   1e-69   Zea mays [maize]
emb|CDY33226.1|  BnaC01g36990D                                          237   1e-69   Brassica napus [oilseed rape]
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          237   2e-69   Sorghum bicolor [broomcorn]
ref|XP_001776313.1|  predicted protein                                  228   4e-69   
ref|NP_001173462.1|  Os03g0397700                                       222   5e-69   
gb|ACN58180.1|  leucine-rich repeat protein                             223   7e-69   Dasypyrum villosum
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  234   9e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18116.1|  serine/threonine protein kinase like protein           226   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  234   9e-69   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ53156.1|  leucine-rich repeat protein                             223   1e-68   Triticum aestivum [Canadian hard winter wheat]
dbj|BAG99361.1|  unnamed protein product                                234   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  234   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                234   2e-68   Brassica rapa subsp. oleifera [biennial turnip rape]
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    234   2e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82450.1|  hypothetical protein OsI_26884                          234   2e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   2e-68   
ref|NP_001060286.1|  Os07g0618400                                       234   2e-68   
emb|CDY36601.1|  BnaC06g06540D                                          233   4e-68   Brassica napus [oilseed rape]
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             233   6e-68   
ref|XP_002965192.1|  hypothetical protein SELMODRAFT_83158              224   6e-68   
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   8e-68   Citrus sinensis [apfelsine]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   232   9e-68   Citrus sinensis [apfelsine]
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             232   9e-68   Citrus clementina [clementine]
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   9e-68   Citrus sinensis [apfelsine]
dbj|BAJ87185.1|  predicted protein                                      230   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY24077.1|  BnaA06g00750D                                          232   1e-67   Brassica napus [oilseed rape]
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   2e-67   Tarenaya hassleriana [spider flower]
gb|KJB67279.1|  hypothetical protein B456_010G183400                    230   2e-67   Gossypium raimondii
emb|CDP04441.1|  unnamed protein product                                231   2e-67   Coffea canephora [robusta coffee]
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    231   3e-67   
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   3e-67   
gb|KJB67276.1|  hypothetical protein B456_010G183400                    231   3e-67   Gossypium raimondii
ref|XP_007026174.1|  STRUBBELIG-receptor family 8 isoform 2             229   4e-67   
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    230   5e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    230   7e-67   Pyrus x bretschneideri [bai li]
ref|XP_002518426.1|  Serine/threonine-protein kinase PBS1, putative     228   8e-67   
ref|NP_001119030.1|  STRUBBELIG-receptor family 8 protein               226   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    229   1e-66   Brassica rapa
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             229   2e-66   
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    229   2e-66   
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    229   2e-66   Malus domestica [apple tree]
ref|XP_008458999.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   2e-66   Cucumis melo [Oriental melon]
ref|XP_002979973.1|  hypothetical protein SELMODRAFT_112070             220   2e-66   
ref|XP_010052885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   2e-66   Eucalyptus grandis [rose gum]
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             228   2e-66   
gb|ACN34179.1|  unknown                                                 213   2e-66   Zea mays [maize]
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   3e-66   
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         228   3e-66   Jatropha curcas
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   3e-66   Eucalyptus grandis [rose gum]
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   3e-66   
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    228   4e-66   Prunus mume [ume]
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   4e-66   Brachypodium distachyon [annual false brome]
gb|EEC72655.1|  hypothetical protein OsI_06182                          228   4e-66   Oryza sativa Indica Group [Indian rice]
ref|NP_001046150.1|  Os02g0190500                                       228   4e-66   
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   4e-66   
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               228   4e-66   
dbj|BAD37979.1|  putative leucine-rich repeat transmembrane prote...    224   5e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             227   6e-66   Capsella rubella
ref|XP_011086205.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   6e-66   Sesamum indicum [beniseed]
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   6e-66   Elaeis guineensis
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   7e-66   
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   7e-66   Phoenix dactylifera
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             225   8e-66   
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    227   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   9e-66   Populus euphratica
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   9e-66   Eucalyptus grandis [rose gum]
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              226   9e-66   
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   9e-66   Setaria italica
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             227   9e-66   Phaseolus vulgaris [French bean]
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    226   1e-65   Arabis alpina [alpine rockcress]
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Solanum lycopersicum
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Cucumis melo [Oriental melon]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Cucumis sativus [cucumbers]
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    227   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Populus euphratica
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Solanum tuberosum [potatoes]
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   1e-65   Zea mays [maize]
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   2e-65   Solanum lycopersicum
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   2e-65   Vitis vinifera
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  226   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   2e-65   Fragaria vesca subsp. vesca
ref|XP_001783845.1|  predicted protein                                  226   2e-65   
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   2e-65   Populus euphratica
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   2e-65   Glycine max [soybeans]
ref|XP_006435523.1|  hypothetical protein CICLE_v10010883mg             216   2e-65   
ref|XP_008799298.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   2e-65   Phoenix dactylifera
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          226   2e-65   Sorghum bicolor [broomcorn]
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   2e-65   Nicotiana sylvestris
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    226   3e-65   Nicotiana tomentosiformis
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             225   3e-65   Eutrema salsugineum [saltwater cress]
dbj|BAK07184.1|  predicted protein                                      225   3e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE66066.1|  hypothetical protein OsJ_22073                          225   3e-65   Oryza sativa Japonica Group [Japonica rice]
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    229   4e-65   
ref|XP_002869840.1|  kinase                                             224   5e-65   Arabidopsis lyrata subsp. lyrata
gb|EEC81030.1|  hypothetical protein OsI_23812                          225   5e-65   Oryza sativa Indica Group [Indian rice]
gb|KEH36931.1|  strubbelig-receptor family protein                      225   6e-65   Medicago truncatula
gb|KJB69228.1|  hypothetical protein B456_011G011800                    224   7e-65   Gossypium raimondii
gb|KHG11352.1|  protein strubbelig-receptor family 8                    224   7e-65   Gossypium arboreum [tree cotton]
ref|XP_006657163.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   7e-65   
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    224   9e-65   Brachypodium distachyon [annual false brome]
gb|EMT22844.1|  hypothetical protein F775_52608                         222   9e-65   
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                224   9e-65   Erythranthe guttata [common monkey flower]
emb|CDX82908.1|  BnaC01g13580D                                          224   1e-64   
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   1e-64   
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    224   1e-64   Brassica rapa
emb|CDX79126.1|  BnaA01g11930D                                          224   1e-64   
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   1e-64   Phoenix dactylifera
emb|CDX76385.1|  BnaA08g10150D                                          223   2e-64   
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    223   2e-64   Brassica rapa
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY27444.1|  BnaC03g64840D                                          223   2e-64   Brassica napus [oilseed rape]
gb|EMS51823.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    222   2e-64   Triticum urartu
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    223   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   3e-64   Oryza brachyantha
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   4e-64   Glycine max [soybeans]
gb|EAY90345.1|  hypothetical protein OsI_11922                          223   4e-64   Oryza sativa Indica Group [Indian rice]
emb|CAN77920.1|  hypothetical protein VITISV_027646                     223   7e-64   Vitis vinifera
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    221   1e-63   
dbj|BAJ88293.1|  predicted protein                                      214   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69681.1|  hypothetical protein M569_05081                         218   1e-62   Genlisea aurea
ref|XP_006850999.1|  hypothetical protein AMTR_s00025p00216900          217   2e-62   
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   3e-62   Setaria italica
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   5e-62   Citrus sinensis [apfelsine]
gb|EMS53763.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    215   1e-61   
gb|EMT21016.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8                    215   1e-61   
dbj|BAK02781.1|  predicted protein                                      215   2e-61   
ref|XP_001778654.1|  predicted protein                                  204   3e-61   
ref|XP_008659800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   1e-60   
ref|XP_006377174.1|  hypothetical protein POPTR_0011s01540g             211   1e-60   
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      212   2e-60   
gb|AFW76249.1|  putative STRUBBELIG family receptor protein kinase      209   3e-60   
gb|AFW76250.1|  putative STRUBBELIG family receptor protein kinase      209   3e-60   
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    212   3e-60   
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      212   3e-60   
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             211   6e-60   
ref|XP_002513297.1|  strubbelig receptor, putative                      211   7e-60   
ref|XP_001763842.1|  predicted protein                                  210   1e-59   
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   1e-59   
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   1e-59   
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          209   2e-59   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   4e-59   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   4e-59   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   5e-59   
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     208   7e-59   
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   7e-59   
ref|XP_006357471.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    193   1e-58   
ref|XP_009398616.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   2e-58   
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         206   4e-58   
ref|XP_009398615.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   1e-57   
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   2e-57   
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   2e-57   
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    203   3e-57   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   6e-57   
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    202   8e-57   
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   9e-57   
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   1e-56   
ref|XP_006841742.1|  hypothetical protein AMTR_s00003p00260350          201   2e-56   
emb|CDX87418.1|  BnaA07g34550D                                          201   2e-56   
ref|XP_002889223.1|  ATP binding protein                                200   4e-56   
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             200   4e-56   
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    200   4e-56   
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    200   5e-56   
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       200   6e-56   
emb|CDO97730.1|  unnamed protein product                                200   6e-56   
emb|CDX88495.1|  BnaC06g39390D                                          199   7e-56   
emb|CAN60971.1|  hypothetical protein VITISV_032050                     197   7e-56   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             199   8e-56   
ref|XP_008380426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   8e-56   
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    199   9e-56   
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    199   9e-56   
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          199   9e-56   
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   1e-55   
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    199   2e-55   
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             199   2e-55   
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   2e-55   
ref|XP_009344018.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   2e-55   
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    198   2e-55   
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    198   2e-55   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    198   2e-55   
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   4e-55   
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 198   5e-55   
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   6e-55   
ref|XP_010655241.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   7e-55   
ref|XP_009346025.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   8e-55   
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   1e-54   
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   1e-54   
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    196   1e-54   
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    196   1e-54   
emb|CBI18374.3|  unnamed protein product                                196   2e-54   
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   2e-54   
gb|EEE67594.1|  hypothetical protein OsJ_25142                          195   3e-54   
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   4e-54   
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      196   4e-54   
ref|XP_007135872.1|  hypothetical protein PHAVU_010G165200g             194   5e-54   
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             194   7e-54   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   8e-54   
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    196   8e-54   
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   1e-53   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   1e-53   
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               194   1e-53   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    193   2e-53   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   3e-53   
ref|XP_010537759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   6e-53   
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   2e-52   
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          190   3e-52   
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    189   6e-52   
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   8e-52   
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             189   9e-52   
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   2e-51   
ref|XP_009775785.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   2e-51   
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   3e-51   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   3e-51   
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   3e-51   
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   4e-51   
dbj|BAD45956.1|  putative leucine-rich repeat transmembrane prote...    179   1e-50   
ref|XP_010268782.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    185   2e-50   
emb|CDP19685.1|  unnamed protein product                                184   2e-50   
ref|XP_010316717.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   3e-50   
emb|CDP14731.1|  unnamed protein product                                184   3e-50   
ref|XP_010268781.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    184   3e-50   
emb|CBI38492.3|  unnamed protein product                                174   3e-50   
gb|KJB67278.1|  hypothetical protein B456_010G183400                    183   5e-50   
ref|XP_010278329.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   8e-50   
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     182   1e-49   
ref|XP_010316713.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   1e-49   
gb|KJB66324.1|  hypothetical protein B456_010G135500                    178   1e-49   
ref|XP_010316715.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   1e-49   
ref|XP_010316716.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   1e-49   
gb|AAQ54536.1|  protein kinase                                          171   2e-49   
gb|ACN31809.1|  unknown                                                 172   2e-49   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   2e-49   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   2e-49   
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   3e-49   
ref|XP_006357454.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   4e-49   
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   4e-49   
gb|KJB56462.1|  hypothetical protein B456_009G120500                    181   5e-49   
ref|XP_009789818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   6e-49   
ref|XP_009789819.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   6e-49   
ref|XP_009789815.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   6e-49   
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    180   7e-49   
gb|KJB66323.1|  hypothetical protein B456_010G135500                    179   7e-49   
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      179   1e-48   
gb|ACM89529.1|  leucine-rich repeat transmembrane protein kinase        172   1e-48   
ref|XP_009625937.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   1e-48   
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   2e-48   
gb|EEE70214.1|  hypothetical protein OsJ_30326                          179   2e-48   
ref|NP_001063921.1|  Os09g0559900                                       179   2e-48   
gb|KHG16784.1|  protein strubbelig-receptor family 5                    177   3e-48   
ref|XP_002460659.1|  hypothetical protein SORBIDRAFT_02g032710          177   6e-48   
ref|NP_001141597.1|  uncharacterized protein LOC100273714               172   7e-48   
gb|KJB69230.1|  hypothetical protein B456_011G011800                    177   7e-48   
gb|EEC85048.1|  hypothetical protein OsI_32379                          177   7e-48   
ref|XP_010696576.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   1e-47   
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    176   2e-47   
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   2e-47   
ref|XP_006447319.1|  hypothetical protein CICLE_v10014768mg             175   2e-47   
ref|XP_009593450.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   4e-47   
ref|XP_009593738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   4e-47   
ref|XP_009593677.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   4e-47   
gb|ABI81608.1|  strubbelig receptor family 1 protein isoform a          175   5e-47   
ref|XP_002517969.1|  lrr receptor-linked protein kinase, putative       174   7e-47   
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   7e-47   
ref|XP_006491630.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   1e-46   
ref|NP_001167726.1|  uncharacterized protein LOC100381414               170   1e-46   
ref|XP_008341914.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-46   
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-46   
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    173   2e-46   
ref|XP_004958051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-46   
ref|XP_004958054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   2e-46   
gb|EPS68087.1|  hypothetical protein M569_06686                         172   3e-46   
gb|KHG09080.1|  protein strubbelig-receptor family 5                    172   3e-46   
ref|XP_010323714.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   3e-46   
gb|KHG30272.1|  protein strubbelig-receptor family 3                    170   3e-46   
ref|XP_010313855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   3e-46   
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             172   4e-46   
ref|XP_008341912.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   4e-46   
ref|XP_009767606.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    172   5e-46   
ref|XP_003539524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   6e-46   
ref|XP_007159275.1|  hypothetical protein PHAVU_002G224200g             171   7e-46   
ref|XP_011085359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   7e-46   
gb|KHN04276.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    172   8e-46   
ref|XP_004251794.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   8e-46   
gb|AAL07025.1|  putative LRR receptor protein kinase                    172   8e-46   
ref|NP_565489.2|  strubbelig-receptor family 1 protein                  172   9e-46   
ref|XP_011096273.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 1    171   9e-46   
dbj|BAF00067.1|  SRF3                                                   166   1e-45   
ref|NP_001275442.1|  LRR receptor-like kinase precursor                 172   1e-45   
gb|ACN66753.1|  SRF3                                                    159   1e-45   
ref|XP_008668240.1|  PREDICTED: uncharacterized protein LOC100381...    171   2e-45   
gb|KDP20913.1|  hypothetical protein JCGZ_21384                         171   2e-45   
ref|XP_008668239.1|  PREDICTED: uncharacterized protein LOC100381...    170   2e-45   
gb|KHN36613.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    171   2e-45   
ref|XP_006350044.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   2e-45   
ref|XP_006594861.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   2e-45   
ref|XP_002988579.1|  hypothetical protein SELMODRAFT_21917              165   2e-45   
gb|EMS56044.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    170   3e-45   
ref|XP_009350761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   3e-45   
ref|XP_009350757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   3e-45   
ref|XP_002979273.1|  hypothetical protein SELMODRAFT_110362             166   4e-45   
gb|EPS62270.1|  hypothetical protein M569_12522                         158   4e-45   
ref|XP_006371595.1|  hypothetical protein POPTR_0019s13490g             170   5e-45   
ref|XP_009350736.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    170   5e-45   
ref|XP_003541551.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   5e-45   
ref|XP_006371594.1|  leucine-rich repeat transmembrane protein ki...    170   6e-45   
ref|XP_006376519.1|  hypothetical protein POPTR_0013s14080g             168   7e-45   
ref|XP_004155578.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   7e-45   
ref|XP_002521411.1|  lrr receptor-linked protein kinase, putative       169   7e-45   
emb|CDX79278.1|  BnaC06g20250D                                          165   7e-45   
ref|XP_010645355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   8e-45   
gb|EYU27953.1|  hypothetical protein MIMGU_mgv1a002415mg                168   8e-45   
ref|XP_007149883.1|  hypothetical protein PHAVU_005G106800g             169   9e-45   
ref|XP_004487313.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-44   
ref|XP_011039760.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   1e-44   
gb|KDP24176.1|  hypothetical protein JCGZ_25833                         168   1e-44   
ref|XP_010069855.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   1e-44   
gb|KCW89495.1|  hypothetical protein EUGRSUZ_A01788                     169   1e-44   
ref|XP_008224986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    169   1e-44   
dbj|BAK05038.1|  predicted protein                                      168   1e-44   
ref|XP_006407265.1|  hypothetical protein EUTSA_v10020193mg             168   1e-44   
gb|KJB31725.1|  hypothetical protein B456_005G204500                    168   1e-44   
ref|XP_002319371.2|  hypothetical protein POPTR_0013s14080g             168   1e-44   
ref|XP_009124712.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   1e-44   
ref|XP_009124710.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   1e-44   
gb|AFW87593.1|  putative STRUBBELIG family receptor protein kinase      156   2e-44   
ref|XP_007043518.1|  Strubbelig-receptor family 3 isoform 1             168   2e-44   
emb|CBI32990.3|  unnamed protein product                                157   2e-44   
ref|XP_011039757.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   2e-44   
ref|XP_004134722.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   2e-44   
emb|CDY43376.1|  BnaA01g30070D                                          167   3e-44   
ref|XP_010057470.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   3e-44   
gb|KFK38641.1|  hypothetical protein AALP_AA3G141300                    167   3e-44   
gb|KJB31723.1|  hypothetical protein B456_005G204500                    167   3e-44   
gb|EMT01284.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    167   4e-44   
emb|CDY48557.1|  BnaA09g01530D                                          167   4e-44   
ref|XP_009623074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   4e-44   
emb|CDY23563.1|  BnaC05g40310D                                          166   5e-44   
tpg|DAA63160.1|  TPA: putative STRUBBELIG family receptor protein...    166   5e-44   
ref|XP_008439889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   5e-44   
ref|XP_003560082.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    167   6e-44   
ref|XP_010689695.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   7e-44   
ref|XP_010905448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   7e-44   
ref|XP_010689694.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   7e-44   
ref|XP_008371312.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    166   7e-44   
ref|XP_003528433.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   7e-44   



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASLI D DQALN N+ SGYGAPEVAMSGQ+TIKSDVYSFGV MLELLTGR 
Sbjct  555  NPHLSDCGLASLIADVDQALNHNTGSGYGAPEVAMSGQFTIKSDVYSFGVVMLELLTGRK  614

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD  R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  615  PFDGGRSRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  674

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTFG D  +  G AD+Q+YE
Sbjct  675  FRPPMSEVVEALVRLVQRANMSKRTFGVDQASPRGEADAQDYE  717



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   288 bits (738),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASLI D DQALN N+ SGYGAPEVAMSGQ+TIKSDVYSFGV MLELLTGR 
Sbjct  554  NPHLSDCGLASLIADVDQALNHNTGSGYGAPEVAMSGQFTIKSDVYSFGVVMLELLTGRK  613

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD  R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  614  PFDGGRTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  673

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTFG D  +  G AD+Q+YE
Sbjct  674  FRPPMSEVVEALVRLVQRANMSKRTFGVDQASPRGEADAQDYE  716



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASLI D DQALN N+ SGYGAPEVAMSG  TIKSDVYSFGV MLELLTGR 
Sbjct  548  NPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRK  607

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  608  PFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  667

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  668  FRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  710



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASLI D DQALN N+ SGYGAPEVAMSG  TIKSDVYSFGV MLELLTGR 
Sbjct  548  NPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRK  607

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  608  PFDSARTRSEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  667

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  668  FRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  710



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASL+ D DQALNQN+ SGYGAPEV+MSGQYTIKSDVYSFGV MLELLTGR 
Sbjct  549  NPHLSDCGLASLVHDIDQALNQNAGSGYGAPEVSMSGQYTIKSDVYSFGVVMLELLTGRQ  608

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  609  PFDSSRARSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  668

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQRANMSRRT G D  S  RS ++D Q+
Sbjct  669  FRPPMSEVVQALVRLVQRANMSRRTLGNDQGSSVRSNNSDDQD  711



>ref|XP_002533323.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
 gb|EEF29059.1| leucine-rich repeat transmembrane protein kinase, putative [Ricinus 
communis]
Length=607

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P+ +QALN N+ SGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  443  NPHLSDSGLASFLPNAEQALNNNAGSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRK  502

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  503  PFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  562

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT G D  +  +  +AD+ +Y
Sbjct  563  FRPPMSEVVQALVRLVQRANMSKRTVGNDQGASRQVDNADAHDY  606



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASLI D DQALN N+ SGYGAPEVAMSG  TIKSDVYSFGV MLELLTGR 
Sbjct  547  NPHLSDCGLASLIADADQALNHNTGSGYGAPEVAMSGLCTIKSDVYSFGVVMLELLTGRK  606

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQ LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  607  PFDSARTRSEQDLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  666

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTFGAD  T  G  D  +YE
Sbjct  667  FRPPMSEVVEALVRLVQRANMSKRTFGADQGTSRGETDGPDYE  709



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLASLI D DQALN N+ SGYGAPEVAM GQ TIKSDVYSFGV MLELLTGRT
Sbjct  544  NPHLSDSGLASLINDADQALNHNTGSGYGAPEVAMYGQCTIKSDVYSFGVVMLELLTGRT  603

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVIALCVQ EPE
Sbjct  604  PFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQSEPE  663

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RT+  D R+  G  DSQ+ +
Sbjct  664  FRPPMSEVVEALVRLVQRANMSKRTYSID-RSSRGETDSQDNQ  705



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLASLI D DQALN N+ SGYGAPE AM GQ TIKSDVYSFGV MLELLTGR 
Sbjct  545  NPHLSDSGLASLIDDADQALNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVVMLELLTGRK  604

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVIALCVQPEPE
Sbjct  605  PFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQPEPE  664

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  665  FRPPMSEVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  706



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   278 bits (711),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P+ DQALN +SASGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  550  NPHLSDSGLASFLPNADQALNNDSASGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGRK  609

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQ EPE
Sbjct  610  PFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQSEPE  669

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ALVRLVQRANMS+RT G D
Sbjct  670  FRPPMSEVVQALVRLVQRANMSKRTVGND  698



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   278 bits (710),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLASLI D DQALN N+ SGYGAPEVAM GQ TIKSDVYSFGV MLELLTGRT
Sbjct  544  NPHLSDSGLASLINDADQALNHNTGSGYGAPEVAMYGQCTIKSDVYSFGVVMLELLTGRT  603

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVIALCVQ EPE
Sbjct  604  PFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQSEPE  663

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQ  186
            FRPPMSEVVEALVRLVQRANMS+RT+  D  SR  + + D+Q
Sbjct  664  FRPPMSEVVEALVRLVQRANMSKRTYSIDRGSRGETDALDNQ  705



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQAL+ N+ SGY APEVAMSGQYT+KSDVY FGV MLELL+GR 
Sbjct  549  NPHLSDSGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYCFGVVMLELLSGRK  608

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD+S+PR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  609  PFDNSKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPE  668

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            FRPPMSEVVEALVRLVQRANMSRRT G D  S    G+AD+Q+
Sbjct  669  FRPPMSEVVEALVRLVQRANMSRRTVGNDQGSSHGGGNADAQD  711



>ref|XP_008465039.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X5 [Cucumis 
melo]
Length=584

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  420  NPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  479

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  480  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  539

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  540  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  568



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS IP+ DQAL  N+ SGY APEVAMSGQYT+KSDVY FGV MLEL++GR 
Sbjct  552  NPHLSDTGLASFIPNADQALEHNAGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELISGRK  611

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSS+PR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  612  PFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  671

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            FRPPMSEVVEALVRLVQRANMSRRT G D     R  +A+ Q+
Sbjct  672  FRPPMSEVVEALVRLVQRANMSRRTIGNDQGGSQRGDNANGQD  714



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 143/164 (87%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  DQ LNQN+ SGYGAPEVAMSG YT+KSDVYSFG  MLELLTGR 
Sbjct  550  NPHLSDSGLASCLPHADQVLNQNAGSGYGAPEVAMSGHYTLKSDVYSFGAVMLELLTGRK  609

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  610  PFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPE  669

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  670  FRPPMSEVVQALVRLVQRANMSKRTIGNEQGETPRAVNPDTQDY  713



>ref|XP_008465038.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X4 [Cucumis 
melo]
Length=637

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  473  NPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  532

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  533  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  592

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  593  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  621



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   275 bits (703),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS IP+ DQAL  N  SGY APEVAMSGQYT+KSDVY FGV MLEL++GR 
Sbjct  552  NPHLSDTGLASFIPNADQALEHNVGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELISGRK  611

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSS+PR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  612  PFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  671

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            FRPPMSEVVEALVRLVQRANMSRRT G D     R  +A+ Q+
Sbjct  672  FRPPMSEVVEALVRLVQRANMSRRTVGNDQGGSQRGDNANGQD  714



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 143/163 (88%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQAL+ N+ SGY APEVAMSGQYT+KSDVYSFGV MLEL++GR 
Sbjct  552  NPHLSDSGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELISGRK  611

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSS+ R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  612  PFDSSKSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  671

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQRANMSRRT G D     R  S D+Q+
Sbjct  672  FRPPMSEVVQALVRLVQRANMSRRTVGNDQGGSQRGDSTDAQD  714



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA LI D DQA N N+ SGYGAPE AM GQ TIKSDVYSFGV MLELLTGR 
Sbjct  536  NPHLSDSGLAILIDDADQARNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVVMLELLTGRK  595

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVIALCVQPEPE
Sbjct  596  PFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQPEPE  655

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  656  FRPPMSEVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  697



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA LI D DQA N N+ SGYGAPE AM GQ TIKSDVYSFGV MLELLTGR 
Sbjct  543  NPHLSDSGLAILIDDADQARNHNTGSGYGAPEGAMYGQCTIKSDVYSFGVVMLELLTGRK  602

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS RPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKS+SRFADVIALCVQPEPE
Sbjct  603  PFDSERPRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSISRFADVIALCVQPEPE  662

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVVEALVRLVQRANMS+RTF  D R+  G  D+Q+ +
Sbjct  663  FRPPMSEVVEALVRLVQRANMSKRTFSLD-RSSRGETDAQDNQ  704



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 142/162 (88%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD  LASL+ D DQ      ASGY APEVAMSGQYTIKSDVYSFGV MLELLTGRT
Sbjct  547  NPHLSDCVLASLVRDPDQV-----ASGYSAPEVAMSGQYTIKSDVYSFGVVMLELLTGRT  601

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  602  PFDSARQRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  661

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RTFG +   RS SAD++EY
Sbjct  662  FRPPMSEVVQALVRLVQRANMSKRTFGNEGAARSDSADAEEY  703



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             P LSD GLAS +P+ D+ALN ++ SGYGAPEVAMSGQY IKSDVYSFGV MLELLTGR 
Sbjct  558  NPQLSDCGLASNMPNADEALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSSRPRLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT G D   +  R  + D+Q+Y
Sbjct  678  FRPPMSEVVQALVRLVQRANMSKRTIGNDQGPTTPRGDNQDTQDY  722



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  522  NPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  581

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  582  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  641

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  642  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  670



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             P LSD GLAS +P+ D+ALN ++ SGYGAPEVAMSGQY IKSDVYSFGV MLELLTGR 
Sbjct  558  NPQLSDCGLASNMPNADEALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSSRPRLEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD---SRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT G D   +  R  + D+Q+Y
Sbjct  678  FRPPMSEVVQALVRLVQRANMSKRTIGNDQGPTTPRGDNQDTQDY  722



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 142/162 (88%), Gaps = 6/162 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD  LASL+ D DQA      SGY APEVAMSGQYTIKSDVYSFGV MLELLTGRT
Sbjct  547  NPHLSDCVLASLVRDPDQA------SGYSAPEVAMSGQYTIKSDVYSFGVVMLELLTGRT  600

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  601  PFDSARQRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  660

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RTFG +   RS SAD++EY
Sbjct  661  FRPPMSEVVQALVRLVQRANMSKRTFGNEGAARSDSADAEEY  702



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   273 bits (698),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  558  NPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  618  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  678  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  706



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + DQAL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  562  NPHLSDCGLASFITNLDQALDQQTGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  621

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  622  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  681

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  682  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  DQ LNQN+ SGY APEVAMSG YT+KSDVYSFG  MLELLTGR 
Sbjct  550  NPHLSDSGLASCLPHADQVLNQNAGSGYVAPEVAMSGHYTLKSDVYSFGAVMLELLTGRK  609

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  610  PFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPE  669

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  670  FRPPMSEVVQALVRLVQRANMSKRTIGNEQGETPRAVNPDTQDY  713



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + D AL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  562  NPHLSDCGLASFITNLDHALDQQAGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  621

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  622  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  681

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  682  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + D AL+Q + SGY APEV MSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  562  NPHLSDCGLASFITNLDHALDQQAGSGYSAPEVTMSGQYTLKSDVYSFGVVMLELLSGRK  621

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADV+ALCVQPEPE
Sbjct  622  PFDSSRPRAEQSLVRWATPQLHDIDALTKMVDPALKGLYPVKSLSRFADVVALCVQPEPE  681

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVVEALVRLVQR+NMSRRTFG+D
Sbjct  682  FRPPMSEVVEALVRLVQRSNMSRRTFGSD  710



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS +P+ +Q LNQN  SGY APEVAMSGQYT+KSDVY FGV MLELLTGR 
Sbjct  563  NPHLSDCGLASYLPNAEQILNQNMGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGRQ  622

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSS+ R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQ EPE
Sbjct  623  PFDSSKGRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQAEPE  682

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVV+ALVRLVQRANMS+RTFG + R      D+  YE
Sbjct  683  FRPPMSEVVQALVRLVQRANMSKRTFGNEHRASQKFDDADAYE  725



>ref|NP_001241934.1| protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine max]
 gb|ACM89564.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
Length=603

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR 
Sbjct  438  NPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRK  497

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  498  PFDSSRPRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  557

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+
Sbjct  558  FRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQD  599



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQ LN N  SGY APEVA+SGQYT+KSDVYSFGV MLELL+GR 
Sbjct  556  NPHLSDSGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRN  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPA+KGLYPVKSLSRFADVIALCVQPEPE
Sbjct  616  PFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGA  222
            FRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  676  FRPPMSEVVQALVRLVQRANMSKRTFSS  703



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQ LN N  SGY APEVA+SGQYT+KSDVYSFGV MLELL+GR 
Sbjct  543  NPHLSDSGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRN  602

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPA+KGLYPVKSLSRFADVIALCVQPEPE
Sbjct  603  PFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPE  662

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGA  222
            FRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  663  FRPPMSEVVQALVRLVQRANMSKRTFSS  690



>ref|XP_008462233.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Cucumis melo]
Length=655

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSDSGL S IP+ DQAL+ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  492  SPHLSDSGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRK  551

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVIALCVQ EPE
Sbjct  552  PFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVIALCVQTEPE  611

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  612  FRPPMSEVVEALVRLVQRANMSKRTYGSDNAT  643



>ref|XP_004141737.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=621

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSDSGL S IP+ DQA++ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  458  SPHLSDSGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRK  517

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKS+SRFADVIALCVQ EPE
Sbjct  518  PFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVIALCVQTEPE  577

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVVEALVRLVQRANMS+RT+G D+ T
Sbjct  578  FRPPMSEVVEALVRLVQRANMSKRTYGNDNAT  609



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQ LN N  SGY APEVA+SGQYT+KSDVYSFGV MLELL+GR 
Sbjct  557  NPHLSDSGLASYIPNADQILNHNVGSGYDAPEVALSGQYTLKSDVYSFGVVMLELLSGRK  616

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDPA+KGLYPVKSLSRFADVIALCVQPEPE
Sbjct  617  PFDSSRPRSEQSLVRWATPQLHDIDALAKMVDPAMKGLYPVKSLSRFADVIALCVQPEPE  676

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGA  222
            FRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  677  FRPPMSEVVQALVRLVQRANMSKRTFSS  704



>ref|XP_008462232.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Cucumis melo]
Length=692

 Score =   269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSDSGL S IP+ DQAL+ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  529  SPHLSDSGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRK  588

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVIALCVQ EPE
Sbjct  589  PFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVIALCVQTEPE  648

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  649  FRPPMSEVVEALVRLVQRANMSKRTYGSDNAT  680



>gb|KHN01483.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=675

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR 
Sbjct  511  NPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRK  570

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  571  PFDSSRPRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVIALCVQPEPE  630

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVV+ALVRLVQR NMS+RTFG D    +   D Q+ +
Sbjct  631  FRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDQDTQ  673



>ref|XP_008462231.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis melo]
Length=716

 Score =   270 bits (689),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSDSGL S IP+ DQAL+ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  553  SPHLSDSGLESFIPNTDQALDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRK  612

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVIALCVQ EPE
Sbjct  613  PFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSLSRFADVIALCVQTEPE  672

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVVEALVRLVQRANMS+RT+G+D+ T
Sbjct  673  FRPPMSEVVEALVRLVQRANMSKRTYGSDNAT  704



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   270 bits (689),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR 
Sbjct  550  NPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRK  609

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  610  PFDSSRPRSEQALVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  669

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQEYE  177
            FRPPMSEVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+ +
Sbjct  670  FRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQ  713



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN NS SGY APEV MSGQYT+KSDV+SFGV MLELL+GR 
Sbjct  553  NPHLSDSGLASYIPNANQVLNNNSGSGYEAPEVGMSGQYTLKSDVFSFGVIMLELLSGRK  612

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQ LVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  613  PFDSSRPRSEQGLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  672

Query  305  FRPPMSEVVEALVRLVQRANMSRR-TFGADSRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQR NMS+R TFG D    +   D+QE
Sbjct  673  FRPPMSEVVQALVRLVQRTNMSKRTTFGTDQGGSNRGGDNQE  714



>ref|XP_004510591.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=711

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN N+ SGY APEV +SGQYT KSDVYSFGV MLELL+GR 
Sbjct  548  NPHLSDSGLASYIPNANQVLNNNAGSGYDAPEVGLSGQYTFKSDVYSFGVVMLELLSGRK  607

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  608  PFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  667

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVV+ALVRLVQR NMS+RTFG D +  S   D QE +
Sbjct  668  FRPPMSEVVQALVRLVQRTNMSKRTFGTD-QGGSNRGDDQETQ  709



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 141/164 (86%), Gaps = 6/164 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+  P+ DQ LN +  + SGYGAPEV MSGQY++KSDVYSFGV MLELLTG
Sbjct  554  NPHLSDSGLATFFPNADQVLNHDDVTMSGYGAPEVTMSGQYSLKSDVYSFGVVMLELLTG  613

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALCVQPE
Sbjct  614  RKPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALEGLYPVKSLSRFADVIALCVQPE  673

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD----SRTRSGSAD  192
            PEFRPPMSEVVEALVRLVQRANMS+RT G D     RT +  AD
Sbjct  674  PEFRPPMSEVVEALVRLVQRANMSKRTIGTDQGASQRTDNAVAD  717



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 144/162 (89%), Gaps = 7/162 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLA+L+ + DQA      SGY APEVAMSGQYTIKSD+YSFGV MLELLTGR 
Sbjct  556  NPHLSDCGLANLVREPDQA------SGYSAPEVAMSGQYTIKSDLYSFGVVMLELLTGRK  609

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  610  PFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  669

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RTFG ++ +R+ SAD ++Y
Sbjct  670  FRPPMSEVVQALVRLVQRANMSKRTFGNEA-SRAESADGEDY  710



>ref|XP_008783430.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Phoenix 
dactylifera]
Length=700

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA+LIPD E QA +QN +SGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR
Sbjct  534  NPHLSDCGLANLIPDAEFQASDQNMSSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGR  593

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  594  MPFDSSRSRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  653

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANMS+R  G D +    RS   D+Q+Y
Sbjct  654  EFRPPMSEVVQALVRLVQRANMSKRMLGGDMQETARRSDDPDTQDY  699



>ref|XP_008783422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA+LIPD E QA +QN +SGYGAPEVAMSGQYT+KSDVYSFGV MLELLTGR
Sbjct  558  NPHLSDCGLANLIPDAEFQASDQNMSSGYGAPEVAMSGQYTLKSDVYSFGVVMLELLTGR  617

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  618  MPFDSSRSRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  677

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANMS+R  G D +    RS   D+Q+Y
Sbjct  678  EFRPPMSEVVQALVRLVQRANMSKRMLGGDMQETARRSDDPDTQDY  723



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN NS SGY APEV ++GQYT+KSDVYSFGV MLELL+GR 
Sbjct  521  NPHLSDSGLASYIPNTNQVLNNNSGSGYDAPEVGLTGQYTLKSDVYSFGVVMLELLSGRK  580

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPAL+G+YPVKSLSRFADVIALCVQ EPE
Sbjct  581  PFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVIALCVQSEPE  640

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQR NMS+RTFGAD    +   D Q+
Sbjct  641  FRPPMSEVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQD  681



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR 
Sbjct  549  NPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRK  608

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQ+LVRWATPQLHDIDAL+KMVDP L+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  609  PFDSSRPRSEQALVRWATPQLHDIDALAKMVDPTLEGLYPVKSLSRFADVIALCVQPEPE  668

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            FRPPMSEVV+ALVRLVQR NMS+RTFG D    +   D Q+ +
Sbjct  669  FRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDQDTQ  711



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQ L+ N  SGY APEVA+SGQYT++SDVYSFGV MLELL+GR 
Sbjct  555  NPHLSDSGLASYIPNADQILSHNVGSGYDAPEVALSGQYTLQSDVYSFGVVMLELLSGRK  614

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  615  PFDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  674

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGA  222
            FRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  675  FRPPMSEVVQALVRLVQRANMSKRTFSS  702



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHL+D GLAS IP+ DQ LN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  543  NPHLTDCGLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLSGRK  602

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  603  PFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  662

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  663  FRPPMSEVVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  706



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 142/163 (87%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS IP+ DQAL+ N+ SGY APEVAMSGQYT+KSDVY FGV MLELL+GR 
Sbjct  575  NPHLSDAGLASSIPNADQALDHNAGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLSGRK  634

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
             FD+ +PR EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  635  AFDNLKPRSEQSLVRWATPQLHDIDALSKMVDPELKGLYPVKSLSRFADVIALCVQPEPE  694

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQRANMSRRT G D  S    G+AD+Q+
Sbjct  695  FRPPMSEVVQALVRLVQRANMSRRTVGNDQGSSHGGGNADAQD  737



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 142/164 (87%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHL+D GLAS IP+ DQ LN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  549  NPHLTDCGLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLSGRK  608

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  609  PFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  668

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT   +  +  R  + D+Q++
Sbjct  669  FRPPMSEVVQALVRLVQRANMSKRTISNEQGASPRGDNPDTQDH  712



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN NS SGY APEV ++GQYT+KSDVYSFGV MLELL+GR 
Sbjct  552  NPHLSDSGLASYIPNTNQVLNNNSGSGYDAPEVGLTGQYTLKSDVYSFGVVMLELLSGRK  611

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPAL+G+YPVKSLSRFADVIALCVQ EPE
Sbjct  612  PFDSSRSRFEQSLVRWATPQLHDIDALAKMVDPALEGMYPVKSLSRFADVIALCVQSEPE  671

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQR NMS+RTFGAD    +   D Q+
Sbjct  672  FRPPMSEVVQALVRLVQRTNMSKRTFGADQGGSNRGGDDQD  712



>gb|AFW90526.1| strubbelig-receptor family 6-like protein [Phaseolus vulgaris]
Length=662

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ DQ L+ N  SGY APEVA+SGQYT++SDVYSFGV MLELL+GR 
Sbjct  497  NPHLSDSGLASYIPNADQILSHNVGSGYDAPEVALSGQYTLQSDVYSFGVVMLELLSGRK  556

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  557  PFDSSRPRFEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  616

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGA  222
            FRPPMSEVV+ALVRLVQRANMS+RTF +
Sbjct  617  FRPPMSEVVQALVRLVQRANMSKRTFSS  644



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   267 bits (683),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS IP+ +Q LN N+ SGY APEV +SG YT+KSDVYSFGV MLELL+GR 
Sbjct  549  NPHLSDSGLASYIPNANQVLNNNAGSGYEAPEVGLSGHYTLKSDVYSFGVVMLELLSGRK  608

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQ+LVRWA PQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  609  PFDSSRPRSEQALVRWAAPQLHDIDALAKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  668

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSADSQEYE  177
            FRPPMSEVV+ALVRLVQR NMS+RTFG D   +  G  D+Q+ +
Sbjct  669  FRPPMSEVVQALVRLVQRTNMSKRTFGTDQGGSNRGGDDNQDTQ  712



>gb|KDO53740.1| hypothetical protein CISIN_1g0080551mg, partial [Citrus sinensis]
Length=148

 Score =   250 bits (638),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 131/147 (89%), Gaps = 3/147 (2%)
 Frame = -1

Query  611  ALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPRPEQSLVRWAT  432
            ALN ++ SGYGAPEVAMSGQY IKSDVYSFGV MLELLTGR PFDSSRPR EQSLVRWAT
Sbjct  1    ALNNDAGSGYGAPEVAMSGQYNIKSDVYSFGVVMLELLTGRKPFDSSRPRLEQSLVRWAT  60

Query  431  PQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQR  252
            PQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVV+ALVRLVQR
Sbjct  61   PQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQR  120

Query  251  ANMSRRTFGAD---SRTRSGSADSQEY  180
            ANMS+RT G D   +  R  + D+Q+Y
Sbjct  121  ANMSKRTIGNDQGPTTPRGDNQDTQDY  147



>ref|XP_004159012.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=715

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSDSGL S IP+ DQA++ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  552  SPHLSDSGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRK  611

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKS+SRFADVIALCVQ EPE
Sbjct  612  PFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVIALCVQTEPE  671

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVVEALVRLVQRANMS+RT+G D+ T
Sbjct  672  FRPPMSEVVEALVRLVQRANMSKRTYGNDNAT  703



>gb|KGN45433.1| hypothetical protein Csa_7G447950 [Cucumis sativus]
Length=715

 Score =   267 bits (682),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSDSGL S IP+ DQA++ + +SGY APEV MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  552  SPHLSDSGLESFIPNADQAMDGSGSSGYTAPEVTMSGQYTLKSDVYSFGVVMLELLTGRK  611

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKS+SRFADVIALCVQ EPE
Sbjct  612  PFDSSRPRSEQSLVRWATPQLHDIDALTKMVDPELKGLYPVKSISRFADVIALCVQTEPE  671

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVVEALVRLVQRANMS+RT+G D+ T
Sbjct  672  FRPPMSEVVEALVRLVQRANMSKRTYGNDNAT  703



>ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=722

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS +P+ +Q LN N  SGY APEVA+SGQYT KSDVYSFGV MLELL+GR 
Sbjct  558  NPHLSDCGLASYVPNAEQILNHNVGSGYDAPEVALSGQYTFKSDVYSFGVVMLELLSGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQ EPE
Sbjct  618  PFDSSRLRAEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQSEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+A+VRLVQRANMSRRTFG+D
Sbjct  678  FRPPMSEVVQAMVRLVQRANMSRRTFGSD  706



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLA+ IPD DQ LN++   SGY APEVAMSG Y++KSDVYSFGV MLELLTGR
Sbjct  554  NPHLSDSGLATFIPDADQVLNRDDVGSGYSAPEVAMSGLYSLKSDVYSFGVVMLELLTGR  613

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP
Sbjct  614  KPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  673

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            EFRPPMSEVV+ALVRLVQRANMS+RT G D
Sbjct  674  EFRPPMSEVVQALVRLVQRANMSKRTIGTD  703



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS + + DQ LN N+ SGY APEVAMSG YT+KSDVYSFG  MLELLTGR 
Sbjct  551  NPHLSDAGLASSLHNADQVLNYNAGSGYSAPEVAMSGHYTLKSDVYSFGAVMLELLTGRK  610

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDID+LSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  611  PFDSSRPRSEQSLVRWATPQLHDIDSLSKMVDPELKGLYPVKSLSRFADVIALCVQPEPE  670

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANMS+RT G +     R+ + D+Q+Y
Sbjct  671  FRPPMSEVVQALVRLVQRANMSKRTIGNEQGETPRADNPDTQDY  714



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS + + DQ LN N+ SGY APEVAMSG YT+KSDVYSFGV MLELLTGR 
Sbjct  551  NPHLSDAGLASSLHNADQVLNYNAGSGYSAPEVAMSGHYTLKSDVYSFGVVMLELLTGRK  610

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDID+LSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  611  PFDSSRPRSEQSLVRWATPQLHDIDSLSKMVDPELKGLYPVKSLSRFADVIALCVQPEPE  670

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEY  180
            FRPPMSEVV+AL RLVQRANMS+RT G +     ++ + D+Q+Y
Sbjct  671  FRPPMSEVVQALFRLVQRANMSKRTIGNEQGETPKADNPDTQDY  714



>gb|KHG18134.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=721

 Score =   265 bits (676),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 135/150 (90%), Gaps = 1/150 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLA+ IP+ D+ LN++   SGY APEV MSGQY++KSDVY FGV MLELLTGR
Sbjct  554  NPHLSDSGLATFIPNADEVLNRDDVGSGYSAPEVTMSGQYSLKSDVYGFGVVMLELLTGR  613

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP
Sbjct  614  KPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  673

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            EFRPPMSEVVEALVRLVQRANMS+RT G D
Sbjct  674  EFRPPMSEVVEALVRLVQRANMSKRTTGTD  703



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 139/166 (84%), Gaps = 3/166 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS I + DQALN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  561  NPHLSDCGLASFI-NADQALNHNAGSGYDAPEVAMSGQYTLKSDVYSFGVVMLELLTGRK  619

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL KMVDPALKGLYP KSLSRFAD+IALCVQPEPE
Sbjct  620  PFDSSRQRSEQSLVRWATPQLHDIDALDKMVDPALKGLYPAKSLSRFADIIALCVQPEPE  679

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQEYEL  174
            FRPPMSEVV+ALVRLVQRANMS+RT G +     R+   D Q+Y  
Sbjct  680  FRPPMSEVVQALVRLVQRANMSKRTTGDEQGGSRRADEPDVQDYTF  725



>gb|ADB93024.1| leucine-rich repeat receptor-like protein kinase [Dendrobium 
nobile]
Length=255

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 4/166 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA LIP+ E Q  + N +SGY APEV+MSGQYT+KSDVYSFGV MLELLTGR
Sbjct  85   NPHLSDCGLACLIPNAEYQGAHHNLSSGYSAPEVSMSGQYTLKSDVYSFGVVMLELLTGR  144

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQ LVRWATPQLHDIDAL KMVDP L+GLYP KSLSRFADVIALCVQPEP
Sbjct  145  KPFDSARPRSEQYLVRWATPQLHDIDALDKMVDPQLQGLYPAKSLSRFADVIALCVQPEP  204

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGA---DSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRA M+++       D+  R+   D+Q+Y
Sbjct  205  EFRPPMSEVVQALVRLVQRAKMNKKVLAGDVQDANRRADDRDAQDY  250



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   261 bits (668),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLA+ IP+ DQ LN++   SGY APEV MS QY++KSDVYSFGV MLELLTGR
Sbjct  522  NPHLSDSGLATFIPNADQLLNRDDVGSGYCAPEVTMSSQYSLKSDVYSFGVVMLELLTGR  581

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYP+KSLSRFADVIALCVQ EP
Sbjct  582  KPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADVIALCVQSEP  641

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            EFRPPMSEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  642  EFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  685



>gb|KJB70030.1| hypothetical protein B456_011G054100 [Gossypium raimondii]
Length=709

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 3/161 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLA+ IP+ D+ LN++   SGY APEV MSGQY++KSDVY FGV MLELLTGR
Sbjct  542  NPHLSDSGLATFIPNADEVLNRDDVGSGYSAPEVTMSGQYSLKSDVYGFGVVMLELLTGR  601

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP
Sbjct  602  KPFDSTRHRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  661

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSAD  192
            EFRPPMSEVVEALVRLVQRANMS+RT G D  +  R+G+ D
Sbjct  662  EFRPPMSEVVEALVRLVQRANMSKRTTGTDQGASPRTGNPD  702



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLA+ IP+ DQ LN++   SGY APEV MS QY++KSDVYSFGV MLELLTGR
Sbjct  561  NPHLSDSGLATFIPNADQLLNRDDMGSGYCAPEVTMSSQYSLKSDVYSFGVVMLELLTGR  620

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYP+KSLSRFADVIALCVQ EP
Sbjct  621  KPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADVIALCVQSEP  680

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            EFRPPMSEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  681  EFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  724



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 140/164 (85%), Gaps = 3/164 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNS-ASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLA+ IP+ DQ LN++   SGY APEV MS QY++KSDVYSFGV MLELLTGR
Sbjct  561  NPHLSDSGLATFIPNADQLLNRDDVGSGYCAPEVTMSSQYSLKSDVYSFGVVMLELLTGR  620

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYP+KSLSRFADVIALCVQ EP
Sbjct  621  KPFDSTRPRLEQSLVRWATPQLHDIDALSKMVDPALKGLYPIKSLSRFADVIALCVQSEP  680

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSADSQE  183
            EFRPPMSEVV+ALVRLVQRANMS+RT G D  +  R+ + D Q 
Sbjct  681  EFRPPMSEVVQALVRLVQRANMSKRTIGTDQGASPRTNNTDEQH  724



>ref|XP_010939842.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Elaeis guineensis]
Length=664

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA+LIPD E QAL+QN  SGY +PEV MSGQYT+KSDVYSFGV MLELLTGR
Sbjct  511  NPHLSDCGLANLIPDAEFQALDQNMGSGYTSPEVTMSGQYTLKSDVYSFGVVMLELLTGR  570

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SR R EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  571  KPFDDSRLRAEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  630

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSR  213
            EFRPPMSEVV+ALVRLVQRANMS+R  G D++
Sbjct  631  EFRPPMSEVVQALVRLVQRANMSKRMLGGDTQ  662



>gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula]
Length=723

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 133/151 (88%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS IP+ +Q LN N  SGY APEVA+SGQYT KSD+YSFGV MLELL+GR 
Sbjct  557  NPHLSDCGLASYIPNAEQILNHNVGSGYDAPEVALSGQYTFKSDIYSFGVVMLELLSGRR  616

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  617  PFDSSRARQEQSLVRWATPQLHDIDALAKMVDPTLKGLYPVKSLSRFADVIALCVQPEPE  676

Query  305  FRPPMSEVVEALVRLVQRANMSRR--TFGAD  219
            FRP MSEVV+ALVRLVQRANMSRR  TFG+D
Sbjct  677  FRPQMSEVVQALVRLVQRANMSRRTFTFGSD  707



>ref|XP_010939841.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Elaeis guineensis]
Length=699

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA+LIPD E QAL+QN  SGY +PEV MSGQYT+KSDVYSFGV MLELLTGR
Sbjct  546  NPHLSDCGLANLIPDAEFQALDQNMGSGYTSPEVTMSGQYTLKSDVYSFGVVMLELLTGR  605

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SR R EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  606  KPFDDSRLRAEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  665

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSR  213
            EFRPPMSEVV+ALVRLVQRANMS+R  G D++
Sbjct  666  EFRPPMSEVVQALVRLVQRANMSKRMLGGDTQ  697



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN-SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGLAS +P  D+ LNQN   SGY APEV+MSGQY+++SDVYSFGV MLELLTGR
Sbjct  553  NPHLSDSGLASFLPTADEVLNQNDEGSGYSAPEVSMSGQYSMQSDVYSFGVVMLELLTGR  612

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP
Sbjct  613  KPFDSARPRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  672

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALV LVQRANMS+RT G D   RSGS ++ +Y
Sbjct  673  EFRPPMSEVVQALVVLVQRANMSKRTIGVDQSQRSGSNEANDY  715



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             P+LSD GLA+LIPD E QAL+ N  SGY APEVAMSGQYT+KSDVYSFGV MLELLTG 
Sbjct  558  NPYLSDCGLANLIPDAEFQALDLNMGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGW  617

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  618  KPFDSSRLRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  677

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            EFRPPMSEVV+ALVRLVQRANMS+R  G D++  +  AD
Sbjct  678  EFRPPMSEVVQALVRLVQRANMSKRMLGRDTQETARRAD  716



>emb|CAN80221.1| hypothetical protein VITISV_027894 [Vitis vinifera]
Length=672

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 142/185 (77%), Gaps = 23/185 (12%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHL+D GLAS IP+ DQ LN N+ SGY APEVAMSGQYT+KSDVYSFGV MLELL+GR 
Sbjct  486  NPHLTDCGLASFIPNADQVLNHNAGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLSGRK  545

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQ----  318
            PFDSSR R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQ    
Sbjct  546  PFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQVRCL  605

Query  317  -----------------PEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD--SRTRSGSA  195
                             PEPEFRPPMSEVV+ALVRLVQRANMS+RT   +  +  R  + 
Sbjct  606  VKVKSADGFIILFQLLMPEPEFRPPMSEVVQALVRLVQRANMSKRTISNEQGASPRGDNP  665

Query  194  DSQEY  180
            D+Q++
Sbjct  666  DTQDH  670



>ref|XP_009777356.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X3 [Nicotiana sylvestris]
Length=611

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA+L+ D DQ LN N+ SGYGAPE A+SG+ T KSDVYSFGV MLEL +GR 
Sbjct  461  NPHLSDSGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVMLELFSGRK  520

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIALCVQPEPE
Sbjct  521  PFDSSRPRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIALCVQPEPE  580

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  581  FRPPMSEVVQALVRLVQRANLSKRLHGID  609



>ref|XP_009386772.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GL SL+PD E QA +QN ASGY  PEV+MSGQYT+KSDVY+FG+ MLELLTGR
Sbjct  556  NPHLSDCGLESLVPDAEFQASDQNMASGYDPPEVSMSGQYTLKSDVYNFGIVMLELLTGR  615

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPRPEQSLV+WATPQLHDIDAL +MVDP LKGLYP KSLSRFADVIALCVQPEP
Sbjct  616  KPFDSSRPRPEQSLVQWATPQLHDIDALDRMVDPVLKGLYPAKSLSRFADVIALCVQPEP  675

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRS  204
            EFRPPMSEVV+ALVRLVQRANMS+R  G + +  S
Sbjct  676  EFRPPMSEVVQALVRLVQRANMSKRMVGGEMQETS  710



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA+L+ D DQ LN N+ SGYGAPE A+SG+ T KSDVYSFGV MLEL +GR 
Sbjct  547  NPHLSDSGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVMLELFSGRK  606

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIALCVQPEPE
Sbjct  607  PFDSSRPRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIALCVQPEPE  666

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  667  FRPPMSEVVQALVRLVQRANLSKRLHGID  695



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA+L+ D DQ LN N+ SGYGAPE A+SG+ T KSDVYSFGV MLEL +GR 
Sbjct  543  NPHLSDSGLANLVADVDQGLNHNTESGYGAPEAAISGKCTAKSDVYSFGVVMLELFSGRK  602

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSRPR EQSLVRWATPQLHDIDAL ++VDPAL GLY VKSLSRFADVIALCVQPEPE
Sbjct  603  PFDSSRPRSEQSLVRWATPQLHDIDALEQIVDPALDGLYSVKSLSRFADVIALCVQPEPE  662

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  663  FRPPMSEVVQALVRLVQRANLSKRLHGID  691



>ref|XP_004983096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Setaria 
italica]
Length=719

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GL+S +PD E QA +Q   SGYGAPEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  558  NPHISDAGLSSFVPDAEFQASDQ--GSGYGAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  615

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  616  KPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVVALCVQPEP  675

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  676  EFRPPMSEVVQALVRLVQRANMTRRMLDGEEASRRPDDQDQEF  718



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD G  SL+PD E QA  QN ASGY  PEVAMSGQYT+KSDVY+FGV MLELLTGR
Sbjct  555  NPHLSDCGFESLVPDAEFQASEQNMASGYSPPEVAMSGQYTLKSDVYNFGVVMLELLTGR  614

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +M+DP LKGLYP KSLSRFADVIALCVQPEP
Sbjct  615  KPFDSSRPRSEQSLVRWATPQLHDIDALDRMIDPDLKGLYPAKSLSRFADVIALCVQPEP  674

Query  308  EFRPPMSEVVEALVRLVQRANM-SRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM S+RT G +      + +S +Y
Sbjct  675  EFRPPMSEVVQALVRLVQRANMSSKRTVGGEGPETRRADESDDY  718



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 5/161 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLASL P+ +QA+N N+     APEVA SGQYT+KSDVYSFGV MLELL+GR 
Sbjct  549  NPHLSDCGLASLHPNGNQAINHNAC----APEVADSGQYTLKSDVYSFGVVMLELLSGRK  604

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSS PR EQSLVRWATPQLHDIDAL+KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  605  PFDSSFPRAEQSLVRWATPQLHDIDALTKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  664

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  183
            FRPPMSEVV+ALVRLVQRANMS+RT G  +R +S S D+ +
Sbjct  665  FRPPMSEVVQALVRLVQRANMSKRTVGNAAR-QSESMDAND  704



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 137/167 (82%), Gaps = 3/167 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GL   + + D +A NQN  SGY APEVAMSG YT+KSDVYSFGVAMLELLTGR
Sbjct  555  NPHLSDCGLGDFVANPDSEASNQNQGSGYSAPEVAMSGVYTMKSDVYSFGVAMLELLTGR  614

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSS+ R EQSLVRWATPQLHDIDALSKMVDP LK LYPVKSLSRFADV+ALCVQPEP
Sbjct  615  KPFDSSKARSEQSLVRWATPQLHDIDALSKMVDPGLKELYPVKSLSRFADVVALCVQPEP  674

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQEYEL  174
            EFRPPMSEVV+ALVRLVQRA+MS+RT   DS    ++   D+ EY L
Sbjct  675  EFRPPMSEVVQALVRLVQRASMSKRTNSEDSGASRKAEEHDNHEYSL  721



>ref|NP_001167741.1| uncharacterized protein LOC100381429 precursor [Zea mays]
 gb|ACN25932.1| unknown [Zea mays]
Length=720

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+G +S +PD E QA +Q   SGY APEV MSGQYT+KSDVYSFGV MLELLTGR
Sbjct  559  NPHISDAGHSSFVPDAEFQASDQ--GSGYSAPEVEMSGQYTLKSDVYSFGVVMLELLTGR  616

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  617  KPFDSSRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVIALCVQPEP  676

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  677  EFRPPMSEVVQALVRLVQRANMTRRMLDGEEASRRPDDQEQEF  719



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++GY APEV M+GQYT KSDVYSFGV MLELLTGR
Sbjct  524  NPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTFKSDVYSFGVVMLELLTGR  581

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  582  RPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  641

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  207
            EFRPPMSEVV+ALVRLVQRANM++R    D+  R
Sbjct  642  EFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRR  675



>ref|XP_008651696.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Zea 
mays]
Length=712

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  552  NPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  609

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  610  RPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  669

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            EFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  670  EFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDLD  708



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 133/154 (86%), Gaps = 3/154 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  576  NPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  633

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  634  RPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  693

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  207
            EFRPPMSEVV+ALVRLVQRANM++R    D+  R
Sbjct  694  EFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRR  727



>gb|ACG49227.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=676

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+G +S +PD E QA +Q   SGY APEV MSGQYT+KSDVYSFGV MLELLTGR
Sbjct  515  NPHISDAGHSSFVPDAEFQASDQ--GSGYSAPEVEMSGQYTLKSDVYSFGVVMLELLTGR  572

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS RPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  573  KPFDSXRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVIALCVQPEP  632

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  633  EFRPPMSEVVQALVRLVQRANMTRRMLDGEEASRRPDDQEQEF  675



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA+L+ D DQ LN N  SGYGAPE A+SG+ T KSDVYSFGV MLEL TGR 
Sbjct  566  NPHLSDSGLANLMADADQGLNHNIESGYGAPEAAISGKCTTKSDVYSFGVVMLELCTGRK  625

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL KMVDPAL GLY VKSLSRFADVIALCVQ EPE
Sbjct  626  PFDSSRSRSEQSLVRWATPQLHDIDALEKMVDPALSGLYSVKSLSRFADVIALCVQLEPE  685

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ALVRLVQRANMS+R    D
Sbjct  686  FRPPMSEVVQALVRLVQRANMSKRLHNND  714



>ref|XP_008659003.1| PREDICTED: leucine-rich repeat transmembrane protein kinase 2 
isoform X1 [Zea mays]
Length=684

 Score =   248 bits (632),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 135/163 (83%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  523  NPHLSDTGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  580

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWA PQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  581  RPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  640

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  641  EFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  682



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  562  NPHVSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  619

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  620  RPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  679

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            EFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  680  EFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  718



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   248 bits (634),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++GY APEV M+GQY +KSDVYSFGV MLELLTGR
Sbjct  570  NPHLSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYNLKSDVYSFGVVMLELLTGR  627

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  628  RPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  687

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            EFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  688  EFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  726



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  555  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  613

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  614  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  673

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  674  FRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  712



>ref|XP_006661732.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  556  NPHVSDAGLASFVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  613

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  614  KPFDSSRQRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVVALCVQPEP  673

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  674  EFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  716



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  557  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  616  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  676  FRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  714



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 135/163 (83%), Gaps = 8/163 (5%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             P LSD GLA LI +  DQ       SGY APEVAMSGQYT+KSDVYSFGV MLEL++GR
Sbjct  548  NPRLSDCGLARLISEPADQG------SGYVAPEVAMSGQYTVKSDVYSFGVVMLELISGR  601

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSS+PR EQSLVRWATPQLHDIDALSKMVDP+LKGLYP KSLS+FAD+IALCVQ EP
Sbjct  602  KPFDSSKPRSEQSLVRWATPQLHDIDALSKMVDPSLKGLYPAKSLSQFADIIALCVQAEP  661

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRS-GSADSQE  183
            EFRP MSEVVEA+VRLVQRANMSRRTFG +   RS GS+D  E
Sbjct  662  EFRPSMSEVVEAIVRLVQRANMSRRTFGNEGSNRSAGSSDGNE  704



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA+LI D DQ LN  + SGYGAPE A+SG+ + KSDVYSFGV MLEL +GR 
Sbjct  553  NPHLSDSGLANLIADTDQGLN--TESGYGAPEAAISGKCSTKSDVYSFGVVMLELFSGRK  610

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD SRPR EQSLVRWATPQLHDIDAL KMVDPAL GLY VKSLSRFADVIALCVQPEPE
Sbjct  611  PFDCSRPRSEQSLVRWATPQLHDIDALEKMVDPALVGLYSVKSLSRFADVIALCVQPEPE  670

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ALVRLVQRAN+S+R  G D
Sbjct  671  FRPPMSEVVQALVRLVQRANLSKRLHGID  699



>ref|XP_004985464.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Setaria italica]
Length=752

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  592  NPHVSDAGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  649

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  650  RPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  709

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            EFRPPMSEVV+ALVRLVQRANM++R    D+  R    D
Sbjct  710  EFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRPDDQD  748



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 135/163 (83%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  564  NPHLSDTGLASFIPDAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  621

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWA PQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  622  RPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  681

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  682  EFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  723



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  557  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  616  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  676  FRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRTGSADA  714



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSD+YSFGV MLELLTGR 
Sbjct  557  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRK  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  616  PFDSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  676  FRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSADT  714



>ref|XP_006649512.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS I D +    Q SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR 
Sbjct  557  NPHLSDAGLASFISDAEFQAAQQSA-GCTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRR  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS++PRPEQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEPE
Sbjct  616  PFDSTKPRPEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            FRPPMSEVV+ALVRLVQRANM++R    DS  R+   D
Sbjct  676  FRPPMSEVVQALVRLVQRANMTKRMLDGDSSRRADDQD  713



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSD+YSFGV MLELLTGR 
Sbjct  559  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   R+GSA++
Sbjct  678  FRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSAET  716



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  557  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  616  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   RSGSAD+
Sbjct  676  FRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRSGSADT  714



>ref|NP_001064502.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|AAO72637.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABB47491.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26416.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|EEE50892.1| hypothetical protein OsJ_31383 [Oryza sativa Japonica Group]
Length=719

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  558  NPHVSDAGLASSVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  615

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+R R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  616  KPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  675

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  676  EFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  718



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   246 bits (628),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  D+ +NQ +  GY APEV+MSGQYT+KSDVYSFGV MLELLTGR 
Sbjct  559  NPHLSDSGLASFLPTADELINQ-TDEGYSAPEVSMSGQYTLKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  678  FRPPMSEVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>gb|EEC66871.1| hypothetical protein OsI_33412 [Oryza sativa Indica Group]
Length=719

 Score =   246 bits (627),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  558  NPHVSDAGLASNVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  615

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+R R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  616  KPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  675

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  676  EFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  718



>ref|XP_010096526.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
 gb|EXB64646.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
Length=689

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLA+ IP   + L+ +   G+ APE+ M+GQY++KSDVYSFGV MLELLTGR 
Sbjct  527  NPHLSDCGLANFIPRAKEYLSSHVEVGFNAPEILMAGQYSVKSDVYSFGVIMLELLTGRK  586

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS RPR EQSLV+WA+PQLHDIDALSKMVDPAL+GLYPVKSLSRFADVIALC+Q EPE
Sbjct  587  PFDSLRPRSEQSLVQWASPQLHDIDALSKMVDPALEGLYPVKSLSRFADVIALCIQAEPE  646

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  183
            FRPPMSEVV+ALV LVQRANMS+RT G D  T S   DSQ+
Sbjct  647  FRPPMSEVVQALVLLVQRANMSKRTIGVDQGT-SRRGDSQD  686



>gb|AAK52120.1|AC079936_16 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
Length=736

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+GLAS +PD E QA +Q   SGY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  575  NPHVSDAGLASSVPDSEFQASDQ--GSGYSAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  632

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+R R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  633  KPFDSARLRTEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  692

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  693  EFRPPMSEVVQALVRLVQRANMTRRMIDGEEGSRRPDDQDQEF  735



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS I D +    Q SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR 
Sbjct  557  NPHLSDAGLASFISDAEFQAAQQSA-GCTAPEVDMTGQYTLKSDVYSFGVVMLELLTGRR  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+RPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEPE
Sbjct  616  PFDSTRPRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANM++R    D+ +R      Q++
Sbjct  676  FRPPMSEVVQALVRLVQRANMTKRMLDGDTSSRRTDDQEQDF  717



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  554  NPHLSDTGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  612

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  613  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  672

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV++LV LVQRANMS+RT G D   RSGSA++
Sbjct  673  FRPPMSEVVQSLVVLVQRANMSKRTVGVDPSQRSGSAET  711



>ref|XP_010937238.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Elaeis 
guineensis]
Length=676

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 139/166 (84%), Gaps = 4/166 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA+L PD E QA +QN  SGY APEVAMSGQYT+KSDVY FGV MLELLTGR
Sbjct  510  NPHLSDCGLANLTPDAEFQASDQNMGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGR  569

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PF+SSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  570  KPFESSRSRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  629

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANMS+R    D++    RS   D+Q+Y
Sbjct  630  EFRPPMSEVVQALVRLVQRANMSKRVLSGDTQETARRSDDPDTQDY  675



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  D+ +NQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  559  NPHLSDSGLASFLPTADELINQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  678  FRPPMSEVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|NP_001104882.1| leucine-rich repeat transmembrane protein kinase 2 precursor 
[Zea mays]
 gb|AAC27895.1| leucine-rich repeat transmembrane protein kinase 2 [Zea mays]
Length=725

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 134/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IP  E QA  Q  ++GY APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  564  NPHLSDTGLASFIPGAEFQAAEQ--SAGYTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  621

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWA PQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  622  RPFDSSRPRSEQSLVRWAAPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  681

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM++R       +R G  D  +Y
Sbjct  682  EFRPPMSEVVQALVRLVQRANMTKRMLDGGDTSR-GPDDQDQY  723



>ref|XP_010534992.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 isoform X2 [Tarenaya 
hassleriana]
Length=641

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQ-NSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGL   +P  D+ LNQ +  +GY APEV+MSGQY+ KSDVYSFGV MLELLTGR
Sbjct  478  NPHLSDSGLTCFLPMADELLNQSDEGTGYSAPEVSMSGQYSTKSDVYSFGVVMLELLTGR  537

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDI+AL KMVDP+LK LYPVKSLSRFADVIALCVQPEP
Sbjct  538  KPFDSTRPRSEQSLVRWATPQLHDINALGKMVDPSLKRLYPVKSLSRFADVIALCVQPEP  597

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALV LVQRANMS+RT G D   RS SA+  +Y
Sbjct  598  EFRPPMSEVVQALVVLVQRANMSKRTIGVDQSQRSSSAEVNDY  640



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 141/163 (87%), Gaps = 2/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  554  NPHLSDTGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  612

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  613  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  672

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD-SQEY  180
            FRPPMSEVV++LV LVQRANMS+RT G D   RSGSA+ S +Y
Sbjct  673  FRPPMSEVVQSLVVLVQRANMSKRTVGVDPSQRSGSAEPSNDY  715



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  554  NPHLSDTGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  612

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQPEPE
Sbjct  613  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPE  672

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV++LV LVQRANMS+RT G D   RSGSA++
Sbjct  673  FRPPMSEVVQSLVVLVQRANMSKRTVGVDPSQRSGSAET  711



>ref|XP_010937237.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Elaeis 
guineensis]
Length=724

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 139/166 (84%), Gaps = 4/166 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GLA+L PD E QA +QN  SGY APEVAMSGQYT+KSDVY FGV MLELLTGR
Sbjct  558  NPHLSDCGLANLTPDAEFQASDQNMGSGYSAPEVAMSGQYTLKSDVYGFGVVMLELLTGR  617

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PF+SSR R EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQPEP
Sbjct  618  KPFESSRSRSEQSLVRWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQPEP  677

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRT---RSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANMS+R    D++    RS   D+Q+Y
Sbjct  678  EFRPPMSEVVQALVRLVQRANMSKRVLSGDTQETARRSDDPDTQDY  723



>ref|XP_003558655.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brachypodium 
distachyon]
Length=720

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 136/165 (82%), Gaps = 6/165 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD+GLAS IPD E QA  Q  ++G  APEV M+GQYT+KSDVYSFGV MLELLTGR
Sbjct  560  NPHLSDAGLASFIPDAEFQAAEQ--SAGCTAPEVDMTGQYTLKSDVYSFGVVMLELLTGR  617

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSS+ R EQSLVRWA+PQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  618  KPFDSSKSRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQPEP  677

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  174
            EFRPPMSEVV+ALVRLVQRANM++R    D+   SG  D Q+ + 
Sbjct  678  EFRPPMSEVVQALVRLVQRANMTKRMLDGDT---SGRGDDQDQDF  719



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSD+YSFGV MLELLTGR 
Sbjct  557  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDIYSFGVVMLELLTGRK  615

Query  485  PFDSS-RPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
            PFDSS R R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEP
Sbjct  616  PFDSSTRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEP  675

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            EFRPPMSEVV+ALV LVQRANMS+RT G D   R+GSAD+
Sbjct  676  EFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGSADT  715



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  D+ +NQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  559  NPHLSDSGLASFLPAADELINQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS++ R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSTKSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV+ALV LVQRANMS+RT G D   RSG+ D+
Sbjct  678  FRPPMSEVVQALVVLVQRANMSKRTVGVDPPQRSGNPDT  716



>ref|XP_010487232.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=554

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  397  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  455

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  456  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  515

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  516  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  553



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQ +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  558  NPHLSDSGLASFLPTANELLNQ-TDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  616

Query  485  PFDSS-RPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
            PFDSS R R EQSLVRWATPQLHDIDAL+KMVDPALKGLYPVKSLSRFADVIALCVQPEP
Sbjct  617  PFDSSKRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEP  676

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            EFRPPMSEVV+ALV LVQRANMS+RT G D   R+G+AD+
Sbjct  677  EFRPPMSEVVQALVVLVQRANMSKRTVGVDPSQRAGNADT  716



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS +P  ++ LNQN   GYGAPEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  567  NPHLSDAGLASFLPTANELLNQND-EGYGAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  625

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  626  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  685

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  686  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  723



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQ-NSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSGL   +P  D+ LNQ +  +GY APEV+MSGQY+ KSDVYSFGV MLELLTGR
Sbjct  555  NPHLSDSGLTCFLPMADELLNQSDEGTGYSAPEVSMSGQYSTKSDVYSFGVVMLELLTGR  614

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDS+RPR EQSLVRWATPQLHDI+AL KMVDP+LK LYPVKSLSRFADVIALCVQPEP
Sbjct  615  KPFDSTRPRSEQSLVRWATPQLHDINALGKMVDPSLKRLYPVKSLSRFADVIALCVQPEP  674

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALV LVQRANMS+RT G D   RS SA+  +Y
Sbjct  675  EFRPPMSEVVQALVVLVQRANMSKRTIGVDQSQRSSSAEVNDY  717



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD+GLAS +P  ++ LNQN   GYGAPEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  566  NPHLSDAGLASFLPTANELLNQND-EGYGAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  624

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  625  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  684

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  685  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APEV+MSGQY+++SDVYSFGV MLELLTGR 
Sbjct  566  NPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGVVMLELLTGRK  624

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  625  PFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  684

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  685  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>gb|EMS47769.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Triticum urartu]
Length=619

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PH+SD+GLAS IPD +    + SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR 
Sbjct  459  NPHVSDAGLASFIPDAEFQTAEQSA-GCTAPEVDMTGQYTMKSDVYSFGVVMLELLTGRK  517

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSS+PR EQSLVRWA+PQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQ EPE
Sbjct  518  PFDSSKPRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQAEPE  577

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANM+++    D+ +R G    Q++
Sbjct  578  FRPPMSEVVQALVRLVQRANMTKKMLDGDA-SRRGDDQDQDF  618



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APEV+MSGQY+++SDVYSFG+ MLELLTGR 
Sbjct  566  NPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGIVMLELLTGRK  624

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  625  PFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  684

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  685  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  722



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 128/140 (91%), Gaps = 5/140 (4%)
 Frame = -1

Query  659  HLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTPF  480
            HLSD GLASL+    ++L+Q  ASGY APEV+MSGQYTIKSDVYSFGV MLELL+GRTPF
Sbjct  554  HLSDCGLASLV---HESLDQ--ASGYNAPEVSMSGQYTIKSDVYSFGVVMLELLSGRTPF  608

Query  479  DSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFR  300
            DSSRPR EQSL RWATPQLHDIDAL+KMVDPAL GLYPVKSLSRFADVIALCVQPEPEFR
Sbjct  609  DSSRPRTEQSLARWATPQLHDIDALAKMVDPALDGLYPVKSLSRFADVIALCVQPEPEFR  668

Query  299  PPMSEVVEALVRLVQRANMS  240
            PPMSEVVE+LVRLV++ANMS
Sbjct  669  PPMSEVVESLVRLVEQANMS  688



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 138/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  557  NPHLSDSGLASFLPTANELLNQND-EGYNAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  615

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDP LKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  616  PFDSARSRSEQSLVRWATPQLHDIDALSKMVDPTLKGLYPVKSLSRFADVIALCVQPEPE  675

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  676  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  713



>ref|XP_002467303.1| hypothetical protein SORBIDRAFT_01g024160 [Sorghum bicolor]
 gb|EER94301.1| hypothetical protein SORBIDRAFT_01g024160 [Sorghum bicolor]
Length=698

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD+  +  +PD E QA +Q   SGY APEV MS QY++KSDVYSFGV MLELLTGR
Sbjct  537  NPHISDAVHSCFVPDVEFQASDQ--GSGYSAPEVGMSSQYSLKSDVYSFGVVMLELLTGR  594

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQPEP
Sbjct  595  KPFDSSRPRSEQSLVRWATPQLHDIDALDQMVDPALKGLYPAKSLSRFADVVALCVQPEP  654

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV+ALVRLVQRANM+RR    +  +R      QE+
Sbjct  655  EFRPPMSEVVQALVRLVQRANMTRRMIDGEEASRRPDDQEQEF  697



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   241 bits (615),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  559  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDSSR R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSSRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT GA     SGS+   +Y
Sbjct  678  FRPPMSEVVQALVVLVQRANMSKRTVGAG----SGSSGVNDY  715



>ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
 gb|ERN06791.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda]
Length=381

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  214  NPHLSDCGLAALTPNTERQVSTQMLGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  273

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPALKG+YP KSLSRFAD+IALCVQPE
Sbjct  274  RKPLDSSRQRSEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLSRFADIIALCVQPE  333

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRL+QRA+M++R
Sbjct  334  PEFRPPMSEVVQALVRLMQRASMNKR  359



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 136/158 (86%), Gaps = 4/158 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  559  NPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  617

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  618  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  677

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSAD  192
            FRPPMSEVV+ALV LVQRANMS+RT G  S   SG+ D
Sbjct  678  FRPPMSEVVQALVVLVQRANMSKRTVGVGS---SGTND  712



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  560  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  618

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  619  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  678

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  679  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  716



>ref|XP_006657962.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=721

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 134/165 (81%), Gaps = 5/165 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSG   LIP+ E QA + NS  GY APEV MSGQY++KSDVYSFGV MLELLTGR
Sbjct  559  NPHLSDSGFGGLIPNQESQASDDNS--GYKAPEVTMSGQYSLKSDVYSFGVVMLELLTGR  616

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SRPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  617  KPFDRSRPRPEQSLVRWATPQLHDIDALDRMVDPALQGLYPSKSLSRFADAIALCVQPEP  676

Query  308  E-FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYE  177
            E F PPMSEVV+ LVRLVQRANM+ RT GAD  +     +S ++E
Sbjct  677  ELFGPPMSEVVQLLVRLVQRANMT-RTCGADGHSWRRDGESGDHE  720



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  564  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  622

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  623  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  682

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  683  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  720



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  564  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  622

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  623  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  682

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  683  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  720



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 130/162 (80%), Gaps = 3/162 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GL  L+P+ E QA   N   GY APEVAMSGQYT+KSDVYSFGV MLEL+TGR
Sbjct  542  NPHLSDCGLEGLVPNAEFQASELNM--GYSAPEVAMSGQYTMKSDVYSFGVVMLELMTGR  599

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQ EP
Sbjct  600  KPFDSSRPRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQSEP  659

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  183
            EFRPPMSEVV+ALVRLV+R  M+ R  G D +  S  A  Q+
Sbjct  660  EFRPPMSEVVQALVRLVKRVKMNNRMAGGDGQETSRRAGDQD  701



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 130/162 (80%), Gaps = 3/162 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSD GL  L+P+ E QA   N   GY APEVAMSGQYT+KSDVYSFGV MLEL+TGR
Sbjct  540  NPHLSDCGLEGLVPNAEFQASELNM--GYSAPEVAMSGQYTMKSDVYSFGVVMLELMTGR  597

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFDSSRPR EQSLV+WATPQLHDIDAL +MVDPALKGLYP KSLSRFADVIALCVQ EP
Sbjct  598  KPFDSSRPRSEQSLVQWATPQLHDIDALDRMVDPALKGLYPAKSLSRFADVIALCVQSEP  657

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQE  183
            EFRPPMSEVV+ALVRLV+R  M+ R  G D +  S  A  Q+
Sbjct  658  EFRPPMSEVVQALVRLVKRVKMNNRMAGGDGQETSRRAGDQD  699



>gb|EMT02096.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Aegilops tauschii]
Length=690

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 2/162 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PH+SD+GLAS IPD +    + SA G  APEV M+GQYT+KSDVYSFGV MLELLTGR 
Sbjct  530  NPHVSDAGLASFIPDAEFQTAEQSA-GCTAPEVDMTGQYTMKSDVYSFGVVMLELLTGRK  588

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PF+SS+PR EQSLVRWA+PQLHDIDAL +MVDPALKGLYP KSLSRFADV+ALCVQ EPE
Sbjct  589  PFESSKPRSEQSLVRWASPQLHDIDALDRMVDPALKGLYPAKSLSRFADVLALCVQAEPE  648

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALVRLVQRANM+++    D+ +R G    Q++
Sbjct  649  FRPPMSEVVQALVRLVQRANMTKKMLDGDA-SRRGDDQDQDF  689



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 133/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SDSG A L P+ + Q  ++NS  GY APEV MSGQY++KSDVYSFGV MLELLTGR
Sbjct  555  NPHVSDSGFADLTPNHEFQESDENS--GYRAPEVTMSGQYSLKSDVYSFGVVMLELLTGR  612

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  613  KPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEP  672

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            EFRPPMSEVV++LVRLVQRANM+ RT  + SR    S    E+
Sbjct  673  EFRPPMSEVVQSLVRLVQRANMT-RTHESHSRRHGESGGDYEF  714



>ref|XP_008653346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Zea mays]
Length=687

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 6/165 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
            TPHLSDSG A L+ +++ Q  ++NS  GY APEV ++GQY++KSDVYSFGV MLELLTGR
Sbjct  528  TPHLSDSGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGVVMLELLTGR  585

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  586  KPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEP  645

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  174
            EFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  646  EFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  687



>ref|XP_001780717.1| predicted protein [Physcomitrella patens]
 gb|EDQ54501.1| predicted protein, partial [Physcomitrella patens]
Length=316

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PH+SD GLA L     ++    ++ GY APE AM G YT+KSD+YSFGV MLELLTGR 
Sbjct  154  NPHISDCGLAILASSGSES-ELTTSFGYSAPEYAMFGTYTVKSDIYSFGVVMLELLTGRK  212

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+RPR EQSLVRWATPQLHDIDAL++MVDPALKG+YP KSLSRFADV+ALCVQPEPE
Sbjct  213  PFDSTRPRSEQSLVRWATPQLHDIDALARMVDPALKGMYPAKSLSRFADVVALCVQPEPE  272

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            FRPPMSEVV++LVRL+QRA+MS+R     ++T
Sbjct  273  FRPPMSEVVQSLVRLIQRASMSKRGLELATQT  304



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS +P  ++ L QN   GY APEV+MSGQY+++SDVYSFGV MLELLTGR 
Sbjct  565  NPHLSDCGLASFLPTANELLTQND-EGYSAPEVSMSGQYSLQSDVYSFGVVMLELLTGRK  623

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  624  PFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  683

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  684  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  721



>gb|AAV64203.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 gb|AAV64241.1| leucine-rich repeat transmembrane protein kinase 1-like protein 
[Zea mays]
 tpg|DAA63621.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=693

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 6/165 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
            TPHLSDSG A L+ +++ Q  ++NS  GY APEV ++GQY++KSDVYSFGV MLELLTGR
Sbjct  534  TPHLSDSGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGVVMLELLTGR  591

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  592  KPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEP  651

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  174
            EFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  652  EFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  693



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 6/165 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
            TPHLSDSG A L+ +++ Q  ++NS  GY APEV ++GQY++KSDVYSFGV MLELLTGR
Sbjct  557  TPHLSDSGFAGLLANQEFQESDENS--GYRAPEVILAGQYSLKSDVYSFGVVMLELLTGR  614

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD +RPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  615  KPFDRTRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEP  674

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  174
            EFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  675  EFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  716



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 5/162 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHLSD+GLAS +P  ++ LNQN   GY APEV+MS QY++KSDVYSFGV MLELLTGR 
Sbjct  554  SPHLSDAGLASFLPTANELLNQND-EGYNAPEVSMSDQYSLKSDVYSFGVVMLELLTGRK  612

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  613  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  672

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEY  180
            FRPPMSEVV+ALV LVQRANMS+RT G      SGS+ + +Y
Sbjct  673  FRPPMSEVVQALVVLVQRANMSKRTVGVG----SGSSGANDY  710



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 135/165 (82%), Gaps = 6/165 (4%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSG A L+ +++ Q  ++NS  GY APEV +SGQY++KSDVYSFGV MLELLTGR
Sbjct  559  NPHLSDSGFAGLLSNQEFQESDENS--GYRAPEVILSGQYSLKSDVYSFGVVMLELLTGR  616

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SRPRPEQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  617  KPFDRSRPRPEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQPEP  676

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQEYEL  174
            EFRPPMSEVV++LVRLVQRANM+R     +S++R       +YE 
Sbjct  677  EFRPPMSEVVQSLVRLVQRANMTRM---HESQSRRHGESGGDYEF  718



>ref|XP_001776313.1| predicted protein [Physcomitrella patens]
 gb|EDQ58812.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD--EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PH+SD GLA+L P   E Q   Q   S GY APE AMSG YT+KSDVYSFGV MLELLT
Sbjct  219  NPHVSDCGLAALAPSGSERQVSAQMLGSFGYSAPEYAMSGTYTVKSDVYSFGVVMLELLT  278

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSRPR EQSLVRWATPQLHDIDAL++MVDP+LKG+YP KSLSRFAD++ALCVQP
Sbjct  279  GRKPLDSSRPRSEQSLVRWATPQLHDIDALARMVDPSLKGIYPAKSLSRFADIVALCVQP  338

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++S+R
Sbjct  339  EPEFRPPMSEVVQALVRLMQRASLSKR  365



>ref|NP_001173462.1| Os03g0397700 [Oryza sativa Japonica Group]
 dbj|BAH92190.1| Os03g0397700, partial [Oryza sativa Japonica Group]
Length=216

 Score =   222 bits (566),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PH+SD G A LIP+++ Q  ++NS  GY APEV MSGQY+ KSDVYSFGV MLELLTGR
Sbjct  55   NPHVSDCGFAELIPNQELQESDENS--GYRAPEVTMSGQYSQKSDVYSFGVVMLELLTGR  112

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
              FD S+P P+QSLVRWA+PQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQPEP
Sbjct  113  KAFDRSQPWPQQSLVRWASPQLHDIDALDQMVDPALEGLYPAKSLSRFADAIALCVQPEP  172

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  207
            EFRPPMSEVV++LVRLVQR++M     G +S +R
Sbjct  173  EFRPPMSEVVQSLVRLVQRSSMGSVLSGGESISR  206



>gb|ACN58180.1| leucine-rich repeat protein [Dasypyrum villosum]
Length=260

 Score =   223 bits (569),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -1

Query  659  HLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            HLSD GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR 
Sbjct  93   HLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRK  152

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPE
Sbjct  153  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  212

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  213  FRPPMSEVVQQLVRLMQRASIVRRQSGEE  241



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  523  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  581

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  582  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  641

Query  305  FRPPMSEVVEALVRLVQRANMSRRT  231
            FRPPMSEVV+ALV LVQRANMS+RT
Sbjct  642  FRPPMSEVVQALVVLVQRANMSKRT  666



>emb|CAA18116.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 emb|CAB79168.1| serine/threonine protein kinase like protein [Arabidopsis thaliana]
 gb|ABL66730.1| At4g22130 [Arabidopsis thaliana]
Length=338

 Score =   226 bits (575),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  171  NPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTG  230

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  231  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  290

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            PEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  291  PEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  322



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  532  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  590

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  591  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  650

Query  305  FRPPMSEVVEALVRLVQRANMSRRT  231
            FRPPMSEVV+ALV LVQRANMS+RT
Sbjct  651  FRPPMSEVVQALVVLVQRANMSKRT  675



>gb|ABQ53156.1| leucine-rich repeat protein [Triticum aestivum]
Length=263

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -1

Query  659  HLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            HLSD GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR 
Sbjct  96   HLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRK  155

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPE
Sbjct  156  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  215

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  216  FRPPMSEVVQQLVRLMQRASIVRRQSGEE  244



>dbj|BAG99361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=683

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 131/163 (80%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSG A LIP+ +  ++ +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  521  NPHLSDSGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRK  579

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPE
Sbjct  580  PFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPE  639

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  183
            FRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  640  FRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  681



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 129/145 (89%), Gaps = 1/145 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APE +MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  560  NPHLSDSGLASFLPTANELLNQND-EGYSAPETSMSGQYSLKSDVYSFGVVMLELLTGRK  618

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  619  PFDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  678

Query  305  FRPPMSEVVEALVRLVQRANMSRRT  231
            FRPPMSEVV+ALV LVQRANMS+RT
Sbjct  679  FRPPMSEVVQALVVLVQRANMSKRT  703



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 130/144 (90%), Gaps = 1/144 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  ++ LNQN   GY APEV+MSGQY+++SDVYSFG+ MLELLTGR 
Sbjct  562  NPHLSDSGLASFLPTANELLNQND-EGYSAPEVSMSGQYSLQSDVYSFGIVMLELLTGRK  620

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE
Sbjct  621  PFDSTRSRSEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  680

Query  305  FRPPMSEVVEALVRLVQRANMSRR  234
            FRPPMSEVV+ALV LVQRANMS+R
Sbjct  681  FRPPMSEVVQALVVLVQRANMSKR  704



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 130/163 (80%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSG A LIP+ +  +  +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  558  NPHLSDSGFADLIPNRESQV-SDEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRK  616

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPE
Sbjct  617  PFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPE  676

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  183
            FRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  677  FRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  718



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 131/163 (80%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSG A LIP+ +  ++ +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  558  NPHLSDSGFADLIPNRESQVS-DEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRK  616

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPE
Sbjct  617  PFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPE  676

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  183
            FRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  677  FRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  718



>ref|XP_010235400.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Brachypodium distachyon]
Length=712

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSG A LIP+++ Q   +NS  GY APE+ MSGQY++KSDVYSFGV MLELLTGR
Sbjct  552  NPHLSDSGYADLIPNQEFQESEENS--GYRAPELTMSGQYSLKSDVYSFGVVMLELLTGR  609

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SRPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EP
Sbjct  610  KPFDRSRPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQAEP  669

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSAD  192
            EFRPPMSEVV++LVRLVQRAN++R +   + SR  S S D
Sbjct  670  EFRPPMSEVVQSLVRLVQRANITRMSSSENYSRRHSESGD  709



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 130/163 (80%), Gaps = 4/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSG A LIP+ +  +  +  SGY APEV MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  570  NPHLSDSGFADLIPNRESQV-SDEDSGYRAPEVTMSGQYSVKSDVYSFGVVMLELLTGRK  628

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFD SRPR EQSLV WATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EPE
Sbjct  629  PFDRSRPRSEQSLVGWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQSEPE  688

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRT--RSGSADSQE  183
            FRPPMSEVV+ LVRLVQRANM+R   GAD  +  R G +  QE
Sbjct  689  FRPPMSEVVQLLVRLVQRANMTRMC-GADGHSWRRDGESRDQE  730



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 134/158 (85%), Gaps = 5/158 (3%)
 Frame = -1

Query  662  PHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRTP  483
            PHLSDSGLASL+P  +  L   +  GY APEV+MSGQY++KSDVY+FGV MLELLTGR P
Sbjct  541  PHLSDSGLASLLPTANVQLLNQTDEGYSAPEVSMSGQYSMKSDVYTFGVVMLELLTGRKP  600

Query  482  FDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPEF  303
            FDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQ EPEF
Sbjct  601  FDSTRSRSEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQAEPEF  660

Query  302  RPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            RPPMSEVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  661  RPPMSEVVQSLVVLVQRANMSKRT-----SKRSGSADA  693



>ref|XP_006449793.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63033.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=698

 Score =   233 bits (593),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  531  NPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  590

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  591  RKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  650

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  651  PEFRPPMSEVVQALVRLVQRASVVKR  676



>ref|XP_002965192.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
 gb|EFJ34030.1| hypothetical protein SELMODRAFT_83158 [Selaginella moellendorffii]
Length=362

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIP---DEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
            +PHL+D GLA+L     D   A     + GY APE AMSG YT+KSDVYSFGV MLELLT
Sbjct  196  SPHLTDCGLAALSSTSSDRQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLT  255

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSR R EQSLVRWATPQLHDIDALSKMVDPALKG+YP KSLSRFADVI+ CVQP
Sbjct  256  GRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQP  315

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            EPEFRPPMSEVV++LVRL+QRA++S+R+ G
Sbjct  316  EPEFRPPMSEVVQSLVRLMQRASLSKRSSG  345



>ref|XP_006467381.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Citrus sinensis]
Length=696

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  529  NPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  588

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  589  RKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  648

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  649  PEFRPPMSEVVQALVRLVQRASVVKR  674



>gb|KDO78347.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=720

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVKR  698



>ref|XP_006449794.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63034.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=720

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVKR  698



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 125/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     A GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSTQMVGAFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVKR  698



>dbj|BAJ87185.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSG   LIP+++ Q   +NS  GY APEVAMSGQY++KSDVYSFGV MLELLTGR
Sbjct  437  NPHLSDSGYGDLIPNQEFQESEENS--GYRAPEVAMSGQYSLKSDVYSFGVVMLELLTGR  494

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SRPR EQSLVRWA PQLHDIDAL +MVDPAL+GLY  KSLSRFAD IALCVQ EP
Sbjct  495  KPFDRSRPRSEQSLVRWAAPQLHDIDALDQMVDPALQGLYHSKSLSRFADAIALCVQAEP  554

Query  308  EFRPPMSEVVEALVRLVQRANMSR  237
            EFRPPMSEVV++LVRLVQRANM+R
Sbjct  555  EFRPPMSEVVQSLVRLVQRANMTR  578



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 133/159 (84%), Gaps = 5/159 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  +  L   +  GY APEV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  561  NPHLSDSGLASFLPTANVQLLNQTDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRK  620

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQ EPE
Sbjct  621  PFDSTRSRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQAEPE  680

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  681  FRPPMSEVVQSLVVLVQRANMSKRT-----SKRSGSADA  714



>ref|XP_010538738.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Tarenaya 
hassleriana]
Length=701

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 124/148 (84%), Gaps = 3/148 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY  PE A+SG YTIKSDVYSFGV MLELLTG
Sbjct  534  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSPPEFALSGVYTIKSDVYSFGVVMLELLTG  593

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPRPEQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  594  RKPLDSSRPRPEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  653

Query  311  PEFRPPMSEVVEALVRLVQRAN-MSRRT  231
            PEFRPPMSEVV+ LVRLVQRA+ M RRT
Sbjct  654  PEFRPPMSEVVQQLVRLVQRASVMKRRT  681



>gb|KJB67279.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=651

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  484  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  543

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFAD+IALCVQPE
Sbjct  544  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPVKSLSRFADIIALCVQPE  603

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  604  PEFRPPMSEVVQALVRLVQRASVVKR  629



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
            TPHLSD GLA+L P+ ++ ++      + GY APE A+SG YTIKSDVYSFGV MLELLT
Sbjct  554  TPHLSDCGLAALTPNTERQVSSTQMVGSFGYSAPEFALSGIYTIKSDVYSFGVVMLELLT  613

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSRPR EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQP
Sbjct  614  GRKPLDSSRPRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQP  673

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  674  EPEFRPPMSEVVQALVRLMQRASVVKR  700



>ref|XP_008355924.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Malus domestica]
Length=719

 Score =   231 bits (589),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDSSRSRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRT  231
            PEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_010928424.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=619

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  450  NPHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  509

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  510  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  569

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            PEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  570  PEFRPPMSEVVQQLVRLMQRASIVRRSSG  598



>gb|KJB67276.1| hypothetical protein B456_010G183400 [Gossypium raimondii]
Length=710

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  543  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  602

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YPVKSLSRFAD+IALCVQPE
Sbjct  603  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPVKSLSRFADIIALCVQPE  662

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  663  PEFRPPMSEVVQALVRLVQRASVVKR  688



>ref|XP_007026174.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
 gb|EOY28796.1| STRUBBELIG-receptor family 8 isoform 2 [Theobroma cacao]
Length=624

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  457  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGLYTVKSDVYSFGVVMLELLTG  516

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  517  RKPLDSSRTRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  576

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  577  PEFRPPMSEVVQALVRLVQRASVVKR  602



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT KSDVYSFGV MLELLTG
Sbjct  545  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTTKSDVYSFGVVMLELLTG  604

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWA+PQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  605  RKPLDSSRPRSEQSLVRWASPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  664

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            PEFRPPMSEVV+ALVRLVQRA +++R    DS
Sbjct  665  PEFRPPMSEVVQALVRLVQRAGVAKRRSSDDS  696



>ref|XP_009357210.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRT  231
            PEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_002518426.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF43813.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=640

 Score =   228 bits (582),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  473  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  532

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  533  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  592

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  593  PEFRPPMSEVVQALVRLVQRASVVKR  618



>ref|NP_001119030.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 gb|AEE84561.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=562

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  395  NPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTG  454

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  455  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  514

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            PEFRPPMSEVV+ LVRLVQRA++ +R    D+
Sbjct  515  PEFRPPMSEVVQQLVRLVQRASVVKRRSSDDT  546



>ref|XP_010539262.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  532  NPHLSDCGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  591

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALC+QPE
Sbjct  592  RKPLDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPE  651

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  652  PEFRPPMSEVVQQLVRLVQRASVIKR  677



>ref|XP_010539255.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Tarenaya 
hassleriana]
Length=702

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  535  NPHLSDCGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  594

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALC+QPE
Sbjct  595  RKPLDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPE  654

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  655  PEFRPPMSEVVQQLVRLVQRASVIKR  680



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 132/159 (83%), Gaps = 5/159 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLAS +P  +  L   +  GY A EV+MSGQY++KSDVYSFGV MLELLTGR 
Sbjct  561  NPHLSDSGLASFLPTANVQLLNQTDEGYSASEVSMSGQYSLKSDVYSFGVVMLELLTGRK  620

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+R R EQSLVRWATPQLHDIDAL KMVDPAL+GLYPVKSLSRFADVIALCVQ EPE
Sbjct  621  PFDSTRSRAEQSLVRWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQAEPE  680

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADS  189
            FRPPMSEVV++LV LVQRANMS+RT       RSGSAD+
Sbjct  681  FRPPMSEVVQSLVVLVQRANMSKRT-----SKRSGSADT  714



>ref|XP_010539270.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Tarenaya 
hassleriana]
Length=685

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  518  NPHLSDCGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  577

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSRPR EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALC+QPE
Sbjct  578  RKPLDSSRPRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCIQPE  637

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  638  PEFRPPMSEVVQQLVRLVQRASVIKR  663



>ref|XP_007026173.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
 gb|EOY28795.1| STRUBBELIG-receptor family 8 isoform 1 [Theobroma cacao]
Length=719

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  552  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGLYTVKSDVYSFGVVMLELLTG  611

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  612  RKPLDSSRTRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  671

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  672  PEFRPPMSEVVQALVRLVQRASVVKR  697



>ref|XP_010928422.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010928423.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=720

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  551  NPHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  610

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  611  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  670

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            PEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  671  PEFRPPMSEVVQQLVRLMQRASIVRRSSG  699



>ref|XP_008384096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Malus domestica]
Length=719

 Score =   229 bits (583),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 125/147 (85%), Gaps = 2/147 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSPQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPE
Sbjct  613  RKPLDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRT  231
            PEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_008458999.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Cucumis 
melo]
Length=612

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  445  NPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  504

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  505  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPE  564

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  565  PEFRPPMSEVVQALVRLVQRASVVKR  590



>ref|XP_002979973.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
 ref|XP_002991949.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ07060.1| hypothetical protein SELMODRAFT_186440 [Selaginella moellendorffii]
 gb|EFJ18843.1| hypothetical protein SELMODRAFT_112070 [Selaginella moellendorffii]
Length=343

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIP--DEDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             P +SD GLA+L P   E Q  +Q   S GY APE AMSG YT+KSDVYSFGV MLELLT
Sbjct  173  NPRVSDCGLAALAPYGAERQVSSQMLVSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLT  232

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR   DSSR R EQSLVRWA PQLHDIDALS+MVDPALKG+YP KSLSRFAD+I+ CVQP
Sbjct  233  GRKSLDSSRSRAEQSLVRWAVPQLHDIDALSRMVDPALKGIYPAKSLSRFADIISSCVQP  292

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            EPEFRPPMSEVV+ALVRL+QRA++S+R   AD
Sbjct  293  EPEFRPPMSEVVQALVRLMQRASLSKRRLTAD  324



>ref|XP_010052885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Eucalyptus 
grandis]
Length=627

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 7/149 (5%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSAS-----GYGAPEVAMSGQYTIKSDVYSFGVAMLEL  501
             PHLSD GLA+L P+ ++   Q SA      GY APE A+SG YT+KSDVYSFGV MLEL
Sbjct  459  NPHLSDCGLAALTPNTER--QQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLEL  516

Query  500  LTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCV  321
            LTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCV
Sbjct  517  LTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCV  576

Query  320  QPEPEFRPPMSEVVEALVRLVQRANMSRR  234
            QPEPEFRPPMSEVV+ LVRLVQRA +S+R
Sbjct  577  QPEPEFRPPMSEVVQQLVRLVQRAGISKR  605



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  551  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  610

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  611  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  670

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  671  PEFRPPMSEVVQALVRLVQRASVVKR  696



>gb|ACN34179.1| unknown [Zea mays]
 tpg|DAA43733.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=128

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -1

Query  563  MSGQYTIKSDVYSFGVAMLELLTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPA  384
            M+GQYT+KSDVYSFGV MLELLTGR PFDSSRPR EQSLVRWATPQLHDIDAL +MVDPA
Sbjct  1    MTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRMVDPA  60

Query  383  LKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRS  204
            LKGLYP KSLSRFADV+ALCVQPEPEFRPPMSEVV+ALVRLVQRANM++R    D+  R 
Sbjct  61   LKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANMTKRMLDGDTSRRP  120

Query  203  GSAD  192
               D
Sbjct  121  DDLD  124



>ref|XP_009357487.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Pyrus x 
bretschneideri]
Length=719

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 123/147 (84%), Gaps = 2/147 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P D SR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDCSRSRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRT  231
            PEFRPPMSEVV+ALVRLVQRA++ RR+
Sbjct  673  PEFRPPMSEVVQALVRLVQRASVVRRS  699



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE AMSG YT+KSDV+SFGV MLELLTG
Sbjct  562  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFAMSGIYTVKSDVHSFGVVMLELLTG  621

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  622  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  681

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            PEFRPPMSEVV+ALVRL+QRA++ +R    DS
Sbjct  682  PEFRPPMSEVVQALVRLMQRASVVKRRLSDDS  713



>ref|XP_010943264.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Elaeis guineensis]
Length=690

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFG+ MLELLTG
Sbjct  521  NPHLSDCGLAALTPNTERQVSTEMVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTG  580

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPE
Sbjct  581  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFADVIALCVQPE  640

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            PEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  641  PEFRPPMSEVVQQLVRLMQRASIVRRSSG  669



>gb|KDP20703.1| hypothetical protein JCGZ_21174 [Jatropha curcas]
Length=721

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  554  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  613

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  614  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  673

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  674  PEFRPPMSEVVQALVRLVQRASVVKR  699



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSAS--GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++       GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  553  NPHLSDCGLAALTPNTERQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  612

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  613  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  672

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA +S+R
Sbjct  673  PEFRPPMSEVVQQLVRLVQRAGISKR  698



>ref|XP_004164349.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
Length=647

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  480  NPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  539

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  540  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPE  599

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  600  PEFRPPMSEVVQALVRLVQRASVVKR  625



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  554  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  613

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  614  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  673

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  674  PEFRPPMSEVVQALVRLVQRASVVKR  699



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 132/159 (83%), Gaps = 4/159 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSG A LIP+++ Q   +NS  GY APE+ MSGQY++KSDVYSFGV MLELLTGR
Sbjct  560  NPHLSDSGYADLIPNQEFQESEENS--GYRAPELTMSGQYSLKSDVYSFGVVMLELLTGR  617

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SRPR EQSLVRWATPQLHDIDAL +MVDPAL+GLYP KSLSRFAD IALCVQ EP
Sbjct  618  KPFDRSRPRSEQSLVRWATPQLHDIDALDQMVDPALQGLYPSKSLSRFADAIALCVQAEP  677

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGAD-SRTRSGSA  195
            EFRPPMSEVV++LVRLVQRAN++R +   + SR  S SA
Sbjct  678  EFRPPMSEVVQSLVRLVQRANITRMSSSENYSRRHSESA  716



>gb|EEC72655.1| hypothetical protein OsI_06182 [Oryza sativa Indica Group]
Length=718

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  549  NPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  608

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  609  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  668

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            PEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  669  PEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  699



>ref|NP_001046150.1| Os02g0190500 [Oryza sativa Japonica Group]
 dbj|BAD16477.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 dbj|BAF08064.1| Os02g0190500 [Oryza sativa Japonica Group]
 gb|EEE56479.1| hypothetical protein OsJ_05699 [Oryza sativa Japonica Group]
Length=718

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  549  NPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  608

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  609  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  668

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            PEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  669  PEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  699



>ref|XP_004486188.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cicer arietinum]
Length=680

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  513  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  572

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  573  RKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPCLNGMYPAKSLSRFADIIALCVQPE  632

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  633  PEFRPPMSEVVQALVRLVQRASVVKR  658



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSAS--GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++       GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  561  NPHLSDCGLAALTPNTERQVSTQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  620

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  621  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  680

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  681  PEFRPPMSEVVQALVRLVQRASVIKR  706



>dbj|BAD37979.1| putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 dbj|BAG99301.1| unnamed protein product [Oryza sativa Japonica Group]
Length=558

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  674  RSSTPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLEL  501
            +  +PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLEL
Sbjct  387  KEYSPHLSDCGLAALTPNPEREVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLEL  446

Query  500  LTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCV  321
            LT R P DSSR R EQSLV WATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALCV
Sbjct  447  LTARKPLDSSRERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCV  506

Query  320  QPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            QPEPEFRPPMSEVV+ LVRLVQRA+M RR  G D
Sbjct  507  QPEPEFRPPMSEVVQQLVRLVQRASMVRRQSGED  540



>ref|XP_006284970.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
 gb|EOA17868.1| hypothetical protein CARUB_v10006274mg [Capsella rubella]
Length=705

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  538  NPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTG  597

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  598  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  657

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            PEFRPPMSEVV+ LVRLVQRA++ +R    DS
Sbjct  658  PEFRPPMSEVVQQLVRLVQRASVVKRRSSDDS  689



>ref|XP_011086205.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Sesamum indicum]
Length=634

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PHLSD GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLT
Sbjct  467  NPHLSDCGLAALGPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLT  526

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQP
Sbjct  527  GRKPLDSSRARSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADVIALCVQP  586

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  587  EPEFRPPMSEVVQALVRLMQRASIVKR  613



>ref|XP_010943263.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Elaeis guineensis]
Length=742

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFG+ MLELLTG
Sbjct  573  NPHLSDCGLAALTPNTERQVSTEMVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTG  632

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFADVIALCVQPE
Sbjct  633  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGIYPAKSLSRFADVIALCVQPE  692

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            PEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  693  PEFRPPMSEVVQQLVRLMQRASIVRRSSG  721



>ref|XP_006648399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Oryza brachyantha]
Length=720

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  550  NPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  609

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  610  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  669

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            PEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  670  PEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  700



>ref|XP_008803525.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
 ref|XP_008803526.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
Length=739

 Score =   228 bits (580),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFG+ MLELLTG
Sbjct  570  NPHLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGVYTVKSDVYSFGIVMLELLTG  629

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  630  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  689

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            PEFRPP+SEVV+ LVRL+QRA+M RR+ G
Sbjct  690  PEFRPPISEVVQQLVRLMQRASMVRRSSG  718



>ref|XP_010448928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=704

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  537  NPHLSDSGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTG  596

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  597  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  656

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  657  PEFRPPMSEVVQQLVRLVQRASVVKR  682



>ref|XP_006383864.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
 gb|ERP61661.1| hypothetical protein POPTR_0004s00710g [Populus trichocarpa]
Length=625

 Score =   225 bits (574),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  458  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  517

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  518  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPILNGMYPAKSLSRFADIIALCVQPE  577

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  578  PEFRPPMSEVVQALVRLVQRASVVKR  603



>ref|XP_010439362.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Camelina sativa]
Length=703

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  536  NPHLSDSGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTG  595

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  596  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  655

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  656  PEFRPPMSEVVQQLVRLVQRASVVKR  681



>ref|XP_011002570.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Populus euphratica]
Length=692

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  525  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  584

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  585  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  644

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  645  PEFRPPMSEVVQALVRLVQRASVVKR  670



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 123/149 (83%), Gaps = 7/149 (5%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSAS-----GYGAPEVAMSGQYTIKSDVYSFGVAMLEL  501
             PHLSD GLA+L P+ ++   Q SA      GY APE A+SG YT+KSDVYSFGV MLEL
Sbjct  553  NPHLSDCGLAALTPNTER--QQVSAQMVGQFGYSAPEFALSGVYTVKSDVYSFGVVMLEL  610

Query  500  LTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCV  321
            LTGR P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCV
Sbjct  611  LTGRKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCV  670

Query  320  QPEPEFRPPMSEVVEALVRLVQRANMSRR  234
            QPEPEFRPPMSEVV+ LVRLVQRA +S+R
Sbjct  671  QPEPEFRPPMSEVVQQLVRLVQRAGISKR  699



>ref|XP_002962278.1| hypothetical protein SELMODRAFT_76873, partial [Selaginella moellendorffii]
 gb|EFJ37538.1| hypothetical protein SELMODRAFT_76873, partial [Selaginella moellendorffii]
Length=673

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            +PHL+D GLA+L  +   A     + GY APE AMSG YT+KSDVYSFGV MLELLTGR 
Sbjct  510  SPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRK  569

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            P DSSR R EQSLVRWATPQLHDIDALSKMVDPALKG+YP KSLSRFADVI+ CVQPEPE
Sbjct  570  PLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPE  629

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFG  225
            FRPPMSEVV++LVRL+QRA++S+R+ G
Sbjct  630  FRPPMSEVVQSLVRLMQRASLSKRSSG  656



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  551  NPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  610

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  611  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  670

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            PEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  671  PEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  701



>ref|XP_007147687.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
 gb|ESW19681.1| hypothetical protein PHAVU_006G146100g [Phaseolus vulgaris]
Length=713

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  546  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  605

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  606  RKPLDSSRIRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPE  665

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADSRT  210
            PEFRPPMSEVV+ALVRLVQRA++ +R    DS T
Sbjct  666  PEFRPPMSEVVQALVRLVQRASVVKRRPSDDSGT  699



>gb|KFK28787.1| hypothetical protein AALP_AA7G048200 [Arabis alpina]
Length=694

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  527  NPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTG  586

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  587  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  646

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  647  PEFRPPMSEVVQQLVRLVQRASVVKR  672



>ref|XP_004241858.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
lycopersicum]
Length=692

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSDSGLA+L+ D DQ LN N  SGYGAPE A+SG+ T KSDVYSFGV MLEL TGR 
Sbjct  542  NPHLSDSGLANLMADVDQGLNHNIESGYGAPEAAISGKCTTKSDVYSFGVVMLELCTGRK  601

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            PFDS+RPR EQSLVRWATPQLHDIDAL KMVDP+L GLY VKSLSRFADVIALCVQ EPE
Sbjct  602  PFDSTRPRSEQSLVRWATPQLHDIDALEKMVDPSLSGLYSVKSLSRFADVIALCVQLEPE  661

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ LVRLVQRANMS+R    D
Sbjct  662  FRPPMSEVVQVLVRLVQRANMSKRLHNND  690



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  544  NPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  603

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  604  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPE  663

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  PEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_004145432.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Cucumis 
sativus]
 gb|KGN66852.1| hypothetical protein Csa_1G701280 [Cucumis sativus]
Length=711

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  544  NPHLSDCGLAALTPNTERQISTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  603

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  604  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPE  663

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  PEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  563  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  622

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  623  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  682

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            PEFRPPMSEVV+ALVRL+QRA++ +R    DS
Sbjct  683  PEFRPPMSEVVQALVRLMQRASVVKRRSSDDS  714



>ref|XP_011002569.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Populus euphratica]
Length=715

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  548  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  607

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  608  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  667

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  668  PEFRPPMSEVVQALVRLVQRASVVKR  693



>ref|XP_006348158.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Solanum 
tuberosum]
Length=724

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PHLSD GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLT
Sbjct  557  NPHLSDCGLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLT  616

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQP
Sbjct  617  GRKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQP  676

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  677  EPEFRPPMSEVVQALVRLMQRASVVKR  703



>ref|XP_010434074.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Camelina 
sativa]
Length=703

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  536  NPHLSDSGLAALTPNTERQVSTQIVGSFGYSAPEFALSGVYTVKSDVYTFGVVMLELLTG  595

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  596  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  655

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  656  PEFRPPMSEVVQQLVRLVQRASVVKR  681



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  548  NPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  607

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL++MVDPAL G+YP KSLSRFADVIALCVQPE
Sbjct  608  RKPLDSSRERSEQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADVIALCVQPE  667

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            PEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  668  PEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  698



>ref|XP_004232684.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Solanum lycopersicum]
Length=724

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PHLSD GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLT
Sbjct  557  NPHLSDCGLAALTPNTERQVSSTQMIGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLT  616

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQP
Sbjct  617  GRKPLDSSRVRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQP  676

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  677  EPEFRPPMSEVVQALVRLMQRASVVKR  703



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  562  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  621

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP+L G+YP KSLSRFAD+IALCVQPE
Sbjct  622  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFADIIALCVQPE  681

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  682  PEFRPPMSEVVQALVRLVQRASVVKR  707



>ref|NP_193944.2| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
 sp|Q6R2J8.1|SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 8; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99876.1| strubbelig receptor family 8 [Arabidopsis thaliana]
 gb|ACN59345.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84560.1| STRUBBELIG-receptor family 8 protein [Arabidopsis thaliana]
Length=703

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  536  NPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTG  595

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  596  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  655

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  656  PEFRPPMSEVVQQLVRLVQRASVVKR  681



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 125/150 (83%), Gaps = 2/150 (1%)
 Frame = -1

Query  659  HLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            HLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTGR 
Sbjct  565  HLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTGRK  624

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            P DSSR R EQSLVRWATPQLHDIDAL+KMVDP+L G+YP KSLSRFAD+IALCVQPEPE
Sbjct  625  PLDSSRARSEQSLVRWATPQLHDIDALAKMVDPSLNGMYPAKSLSRFADIIALCVQPEPE  684

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADS  216
            FRPPMSEVV+ALVRLVQRA++++R    DS
Sbjct  685  FRPPMSEVVQALVRLVQRASVAKRRSSDDS  714



>ref|XP_001783845.1| predicted protein [Physcomitrella patens]
 gb|EDQ51335.1| predicted protein, partial [Physcomitrella patens]
Length=700

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 128/163 (79%), Gaps = 3/163 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIP---DEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PHL+D G+A+L P   D   +     + GY APE AMSG YT+KSDVYSFGV MLELLT
Sbjct  530  NPHLTDCGIAALTPLGSDRQVSTQMLGSFGYSAPEYAMSGIYTVKSDVYSFGVVMLELLT  589

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DS+R R EQSLVRWATPQLHDIDAL+KMVDPALKG+YP KSLSRFAD+IALCVQP
Sbjct  590  GRKPLDSTRLRAEQSLVRWATPQLHDIDALAKMVDPALKGIYPAKSLSRFADIIALCVQP  649

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRRTFGADSRTRSGSADSQ  186
            EPEFRP MSEVV+ALVRL+QRA++++R  G D    + S D Q
Sbjct  650  EPEFRPVMSEVVQALVRLMQRASLNKRRSGDDLGASNRSMDRQ  692



>ref|XP_011046989.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Populus 
euphratica]
Length=711

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  544  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLTG  603

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  604  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGIYPAKSLSRFADIIALCVQPE  663

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  PEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_006586762.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN40858.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=711

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVYSFGV MLELLTG
Sbjct  544  NPHLSDCGLAALTPNTERQVSTQMVGSFGYSAPEFALSGVYTVKSDVYSFGVVMLELLTG  603

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDP L G+YP KSLSRFAD+IALCVQPE
Sbjct  604  RKPLDSSRVRSEQSLVRWATPQLHDIDALAKMVDPTLNGMYPAKSLSRFADIIALCVQPE  663

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ALVRLVQRA++ +R
Sbjct  664  PEFRPPMSEVVQALVRLVQRASVVKR  689



>ref|XP_006435523.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina]
 gb|ESR48763.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina]
Length=317

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
             PHLSD GLAS      Q  +QN   GY APE      YT+KSDVYSFGV MLELLTGR 
Sbjct  164  NPHLSDYGLASF----HQRTSQNLGVGYNAPECTRPSAYTVKSDVYSFGVVMLELLTGRM  219

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            P+DS +P+ EQ LVRWA PQLHD DAL+KMVDPAL+GLYP KSLSRFADVIALCVQPEPE
Sbjct  220  PYDSEKPKSEQCLVRWAAPQLHDFDALAKMVDPALRGLYPPKSLSRFADVIALCVQPEPE  279

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGADSR  213
            FRPPMSEVVEALVRLVQR++M+ +   A SR
Sbjct  280  FRPPMSEVVEALVRLVQRSSMNMKDDLAASR  310



>ref|XP_008799298.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008799306.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Phoenix dactylifera]
Length=643

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             P LSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  474  NPRLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  533

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL+KMVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  534  RKPLDSSRERSEQSLVRWATPQLHDIDALAKMVDPALNGMYPAKSLSRFADIIALCVQPE  593

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFG  225
            PEFRPPMSEVV+ LVRL+QRA++ RR+ G
Sbjct  594  PEFRPPMSEVVQQLVRLMQRASIVRRSSG  622



>ref|XP_002451696.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
 gb|EES04672.1| hypothetical protein SORBIDRAFT_04g006110 [Sorghum bicolor]
Length=716

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 125/151 (83%), Gaps = 2/151 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLELLTG
Sbjct  547  NPHLSDCGLAALTPNTERQVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLELLTG  606

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDAL++MVDPAL G+YP KSLSRFAD+IALCVQPE
Sbjct  607  RKPLDSSRERSEQSLVRWATPQLHDIDALARMVDPALNGMYPAKSLSRFADIIALCVQPE  666

Query  311  PEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            PEFRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  667  PEFRPPMSEVVQQLVRLMQRASIVRRQSGEE  697



>ref|XP_009777766.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana sylvestris]
Length=723

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PHLSD GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLT
Sbjct  556  NPHLSDCGLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLT  615

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQP
Sbjct  616  GRKPLDSSRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQP  675

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  676  EPEFRPPMSEVVQALVRLMQRASVVKR  702



>ref|XP_009613682.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Nicotiana tomentosiformis]
Length=725

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDEDQALNQN---SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLT  495
             PHLSD GLA+L P+ ++ ++      + GY APE A+SG YT+KSDVYSFGV MLELLT
Sbjct  558  NPHLSDCGLAALNPNTERPVSSTQMVGSFGYSAPEFALSGIYTVKSDVYSFGVVMLELLT  617

Query  494  GRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQP  315
            GR P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQP
Sbjct  618  GRKPLDSSRMRSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQP  677

Query  314  EPEFRPPMSEVVEALVRLVQRANMSRR  234
            EPEFRPPMSEVV+ALVRL+QRA++ +R
Sbjct  678  EPEFRPPMSEVVQALVRLMQRASVVKR  704



>ref|XP_006413689.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
 gb|ESQ55142.1| hypothetical protein EUTSA_v10024563mg [Eutrema salsugineum]
Length=700

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  533  NPHLSDSGLAALNPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTG  592

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DSSR R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  593  RKPLDSSRTRAEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  652

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  653  PEFRPPMSEVVQQLVRLVQRASVVKR  678



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = -1

Query  659  HLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGRT  486
            HLSD GLA+L P+ ++ ++     + GY APE +MSG YT+KSDVYSFGV MLELLTGR 
Sbjct  546  HLSDCGLAALTPNTERQVSTEVVGSFGYSAPEFSMSGIYTVKSDVYSFGVVMLELLTGRK  605

Query  485  PFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEPE  306
            P DSSR R EQSLVRWATPQLHDIDALSKMVDPAL G+YP KSLSRFAD+IALCVQPEPE
Sbjct  606  PLDSSRERSEQSLVRWATPQLHDIDALSKMVDPALNGMYPAKSLSRFADIIALCVQPEPE  665

Query  305  FRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            FRPPMSEVV+ LVRL+QRA++ RR  G +
Sbjct  666  FRPPMSEVVQQLVRLMQRASIVRRQSGEE  694



>gb|EEE66066.1| hypothetical protein OsJ_22073 [Oryza sativa Japonica Group]
Length=690

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  674  RSSTPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLEL  501
            +  +PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLEL
Sbjct  519  KEYSPHLSDCGLAALTPNPEREVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLEL  578

Query  500  LTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCV  321
            LT R P DSSR R EQSLV WATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALCV
Sbjct  579  LTARKPLDSSRERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCV  638

Query  320  QPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            QPEPEFRPPMSEVV+ LVRLVQRA+M RR  G D
Sbjct  639  QPEPEFRPPMSEVVQQLVRLVQRASMVRRQSGED  672



>gb|EMT07607.1| Protein STRUBBELIG-RECEPTOR FAMILY 7 [Aegilops tauschii]
Length=1220

 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = -1

Query  665  TPHLSDSGLASLIPDED-QALNQNSASGYGAPEVAMSGQYTIKSDVYSFGVAMLELLTGR  489
             PHLSDSG   LIP+++ Q   +NS  GY APEVAMSGQY++KSDVYSFGV MLELLTGR
Sbjct  565  NPHLSDSGYGDLIPNQEFQESEENS--GYRAPEVAMSGQYSLKSDVYSFGVVMLELLTGR  622

Query  488  TPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPEP  309
             PFD SRPR EQSLVRWA PQLHDIDAL +MVDPAL+GLY  KSLSRFAD IALCVQ EP
Sbjct  623  KPFDRSRPRSEQSLVRWAAPQLHDIDALDQMVDPALQGLYHSKSLSRFADAIALCVQAEP  682

Query  308  EFRPPMSEVVEALVRLVQRANMSRRTFGADSRTR  207
            EFRPPMSEVV++LVRLVQRANM+R +  ++S TR
Sbjct  683  EFRPPMSEVVQSLVRLVQRANMTRMS-SSESYTR  715



>ref|XP_002869840.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46099.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 123/146 (84%), Gaps = 2/146 (1%)
 Frame = -1

Query  665  TPHLSDSGLASLIPD-EDQALNQNSAS-GYGAPEVAMSGQYTIKSDVYSFGVAMLELLTG  492
             PHLSDSGLA+L P+ E Q   Q   S GY APE A+SG YT+KSDVY+FGV MLELLTG
Sbjct  536  NPHLSDSGLAALTPNTERQVSTQVVGSFGYSAPEFALSGIYTVKSDVYTFGVVMLELLTG  595

Query  491  RTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCVQPE  312
            R P DS+R R EQSLVRWATPQLHDIDALSKMVDP+L G+YP KSLSRFAD+IALC+QPE
Sbjct  596  RKPLDSTRTRVEQSLVRWATPQLHDIDALSKMVDPSLNGMYPAKSLSRFADIIALCIQPE  655

Query  311  PEFRPPMSEVVEALVRLVQRANMSRR  234
            PEFRPPMSEVV+ LVRLVQRA++ +R
Sbjct  656  PEFRPPMSEVVQQLVRLVQRASVIKR  681



>gb|EEC81030.1| hypothetical protein OsI_23812 [Oryza sativa Indica Group]
Length=712

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  674  RSSTPHLSDSGLASLIPDEDQALNQN--SASGYGAPEVAMSGQYTIKSDVYSFGVAMLEL  501
            +  +PHLSD GLA+L P+ ++ ++     + GY APE AMSG YT+KSDVYSFGV MLEL
Sbjct  541  KEYSPHLSDCGLAALTPNPEREVSTEVFGSFGYSAPEFAMSGIYTVKSDVYSFGVVMLEL  600

Query  500  LTGRTPFDSSRPRPEQSLVRWATPQLHDIDALSKMVDPALKGLYPVKSLSRFADVIALCV  321
            LT R P DSSR R EQSLV WATPQLHDIDAL+KMVDPA+ G+YP KSLSRFAD+IALCV
Sbjct  601  LTARKPLDSSRERSEQSLVTWATPQLHDIDALAKMVDPAMDGMYPAKSLSRFADIIALCV  660

Query  320  QPEPEFRPPMSEVVEALVRLVQRANMSRRTFGAD  219
            QPEPEFRPPMSEVV+ LVRLVQRA+M RR  G D
Sbjct  661  QPEPEFRPPMSEVVQQLVRLVQRASMVRRQSGED  694



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600