BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045O04

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796698.1|  PREDICTED: calnexin homolog 1-like                 187   3e-52   Nicotiana sylvestris
ref|XP_009792195.1|  PREDICTED: calnexin homolog 1-like                 186   1e-51   Nicotiana sylvestris
ref|XP_009627797.1|  PREDICTED: calnexin homolog 1-like                 185   3e-51   Nicotiana tomentosiformis
gb|AIL30503.1|  calnexin-like protein                                   184   7e-51   Nicotiana tabacum [American tobacco]
ref|XP_009627792.1|  PREDICTED: calnexin homolog 1-like                 181   1e-49   Nicotiana tomentosiformis
ref|XP_006366282.1|  PREDICTED: calnexin homolog                        178   8e-49   Solanum tuberosum [potatoes]
ref|XP_004241643.1|  PREDICTED: calnexin homolog 1-like isoform X2      177   2e-48   
ref|XP_010322635.1|  PREDICTED: calnexin homolog 1-like isoform X1      177   2e-48   
gb|EYU24545.1|  hypothetical protein MIMGU_mgv1a007617mg                173   7e-48   Erythranthe guttata [common monkey flower]
emb|CDO98285.1|  unnamed protein product                                174   5e-47   Coffea canephora [robusta coffee]
gb|KJB07905.1|  hypothetical protein B456_001G053400                    166   3e-45   Gossypium raimondii
ref|NP_001234129.1|  calnexin-like protein precursor                    168   6e-45   Solanum lycopersicum
gb|ABD59793.1|  calnexin                                                159   7e-45   Arnebia euchroma
gb|KJB07906.1|  hypothetical protein B456_001G053400                    166   3e-44   Gossypium raimondii
ref|XP_006366280.1|  PREDICTED: calnexin homolog                        156   6e-44   Solanum tuberosum [potatoes]
gb|KHG05799.1|  Calnexin                                                164   2e-43   Gossypium arboreum [tree cotton]
ref|XP_007038183.1|  Calnexin 1                                         163   3e-43   
dbj|BAD81043.1|  calnexin                                               163   4e-43   Glycine max [soybeans]
ref|NP_001235116.1|  calnexin homolog precursor                         163   4e-43   Glycine max [soybeans]
ref|XP_003523183.1|  PREDICTED: calnexin homolog                        162   5e-43   Glycine max [soybeans]
ref|XP_006341454.1|  PREDICTED: calnexin homolog                        162   6e-43   Solanum tuberosum [potatoes]
gb|KHN31239.1|  Calnexin like                                           162   6e-43   Glycine soja [wild soybean]
gb|KJB07904.1|  hypothetical protein B456_001G053400                    162   7e-43   Gossypium raimondii
ref|XP_010249364.1|  PREDICTED: calnexin homolog                        160   5e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010112005.1|  Calnexin-1-like protein                            159   8e-42   Morus notabilis
ref|XP_010249367.1|  PREDICTED: calnexin homolog                        159   9e-42   Nelumbo nucifera [Indian lotus]
ref|XP_009380017.1|  PREDICTED: calnexin homolog                        158   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO57647.1|  hypothetical protein CISIN_1g009287mg                   158   2e-41   Citrus sinensis [apfelsine]
gb|KFK25123.1|  hypothetical protein AALP_AA8G068700                    158   3e-41   Arabis alpina [alpine rockcress]
ref|XP_006436992.1|  hypothetical protein CICLE_v10031185mg             157   4e-41   
ref|XP_002511066.1|  calnexin, putative                                 157   4e-41   Ricinus communis
gb|EPS68494.1|  calnexin-like protein                                   156   5e-41   Genlisea aurea
ref|XP_006485059.1|  PREDICTED: calnexin homolog                        157   5e-41   Citrus sinensis [apfelsine]
ref|XP_006436993.1|  hypothetical protein CICLE_v10031185mg             157   7e-41   Citrus clementina [clementine]
gb|AFK38191.1|  unknown                                                 150   1e-40   Lotus japonicus
gb|KJB38817.1|  hypothetical protein B456_006G273500                    154   4e-40   Gossypium raimondii
ref|XP_004145138.1|  PREDICTED: calnexin homolog 1-like                 154   4e-40   
ref|XP_010491342.1|  PREDICTED: calnexin homolog 2-like                 154   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010423220.1|  PREDICTED: calnexin homolog 2                      153   1e-39   Camelina sativa [gold-of-pleasure]
ref|NP_196351.1|  calnexin2                                             153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190249.1|  calnexin2                                          153   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245696.1|  PREDICTED: calnexin homolog 1-like                 153   2e-39   Prunus mume [ume]
gb|KJB38815.1|  hypothetical protein B456_006G273500                    153   2e-39   Gossypium raimondii
gb|KJB38819.1|  hypothetical protein B456_006G273500                    153   2e-39   Gossypium raimondii
ref|XP_011082819.1|  PREDICTED: calnexin homolog 1                      152   2e-39   Sesamum indicum [beniseed]
gb|KDO57648.1|  hypothetical protein CISIN_1g009287mg                   152   3e-39   Citrus sinensis [apfelsine]
ref|XP_008440191.1|  PREDICTED: calnexin homolog                        152   4e-39   Cucumis melo [Oriental melon]
ref|XP_009404191.1|  PREDICTED: calnexin homolog                        152   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007209878.1|  hypothetical protein PRUPE_ppa003899mg             151   5e-39   Prunus persica
ref|XP_006368843.1|  hypothetical protein POPTR_0001s12690g             150   8e-39   
gb|KJB38818.1|  hypothetical protein B456_006G273500                    150   9e-39   Gossypium raimondii
gb|KHG01556.1|  Calnexin                                                150   1e-38   Gossypium arboreum [tree cotton]
ref|XP_009390827.1|  PREDICTED: calnexin homolog 1-like                 150   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011003527.1|  PREDICTED: calnexin homolog                        149   5e-38   Populus euphratica
ref|XP_003525166.1|  PREDICTED: calnexin homolog                        149   5e-38   Glycine max [soybeans]
gb|KHN17447.1|  Calnexin like                                           149   5e-38   Glycine soja [wild soybean]
ref|XP_006399217.1|  hypothetical protein EUTSA_v10013223mg             148   7e-38   Eutrema salsugineum [saltwater cress]
ref|XP_002318189.1|  Calnexin precursor family protein                  148   8e-38   
gb|AAA17742.1|  calnexin homolog                                        147   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273708.1|  PREDICTED: calnexin homolog                        147   1e-37   Vitis vinifera
ref|XP_010929516.1|  PREDICTED: calnexin homolog                        147   1e-37   Elaeis guineensis
ref|XP_003532294.1|  PREDICTED: calnexin homolog                        147   2e-37   Glycine max [soybeans]
gb|AEZ00867.1|  putative calnexin-like protein                          142   3e-37   Elaeis guineensis
ref|XP_009359843.1|  PREDICTED: calnexin homolog 1-like                 146   4e-37   Pyrus x bretschneideri [bai li]
ref|XP_010546112.1|  PREDICTED: calnexin homolog 1-like                 145   8e-37   Tarenaya hassleriana [spider flower]
ref|XP_002277666.1|  PREDICTED: calnexin homolog                        145   1e-36   Vitis vinifera
ref|XP_010910131.1|  PREDICTED: calnexin homolog                        144   1e-36   Elaeis guineensis
gb|AAK94424.1|AF398143_1  calnexin-like protein 1                       136   1e-36   Brassica rapa subsp. pekinensis [bai cai]
emb|CAN83091.1|  hypothetical protein VITISV_041895                     144   2e-36   Vitis vinifera
ref|XP_002321768.1|  Calnexin precursor family protein                  143   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010942328.1|  PREDICTED: calnexin homolog                        143   6e-36   Elaeis guineensis
emb|CDX87226.1|  BnaC09g05410D                                          142   7e-36   
gb|AAK84429.1|  putative papillar cell-specific calnexin                142   1e-35   Brassica napus [oilseed rape]
ref|XP_009130175.1|  PREDICTED: calnexin homolog 1-like                 142   1e-35   Brassica rapa
ref|XP_002866455.1|  hypothetical protein ARALYDRAFT_496347             144   3e-35   
emb|CDY72297.1|  BnaAnng40540D                                          140   3e-35   Brassica napus [oilseed rape]
ref|XP_011040303.1|  PREDICTED: calnexin homolog                        140   3e-35   Populus euphratica
ref|XP_002866454.1|  calnexin 1                                         140   5e-35   
emb|CDY42878.1|  BnaAnng07030D                                          140   5e-35   Brassica napus [oilseed rape]
ref|XP_004503036.1|  PREDICTED: calnexin homolog                        139   9e-35   Cicer arietinum [garbanzo]
ref|XP_008778288.1|  PREDICTED: calnexin homolog                        139   1e-34   
gb|KDP22513.1|  hypothetical protein JCGZ_26344                         139   1e-34   Jatropha curcas
ref|XP_008797088.1|  PREDICTED: calnexin homolog                        139   2e-34   Phoenix dactylifera
gb|KJB51311.1|  hypothetical protein B456_008G211600                    138   2e-34   Gossypium raimondii
ref|NP_200987.1|  calnexin 1                                            138   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KJB51312.1|  hypothetical protein B456_008G211600                    138   2e-34   Gossypium raimondii
ref|XP_009112002.1|  PREDICTED: calnexin homolog 1-like                 138   3e-34   Brassica rapa
ref|XP_008807839.1|  PREDICTED: calnexin homolog                        137   4e-34   Phoenix dactylifera
emb|CDY16801.1|  BnaA09g05810D                                          137   7e-34   Brassica napus [oilseed rape]
gb|KHG01051.1|  Calnexin                                                137   7e-34   Gossypium arboreum [tree cotton]
ref|XP_010452695.1|  PREDICTED: calnexin homolog 2-like                 136   1e-33   Camelina sativa [gold-of-pleasure]
emb|CDX86955.1|  BnaC03g52250D                                          136   1e-33   
ref|XP_007159941.1|  hypothetical protein PHAVU_002G280300g             135   2e-33   Phaseolus vulgaris [French bean]
ref|XP_010457723.1|  PREDICTED: calnexin homolog 1-like                 135   2e-33   Camelina sativa [gold-of-pleasure]
gb|AGV54271.1|  calnexin-like protein                                   135   2e-33   Phaseolus vulgaris [French bean]
gb|KJB38816.1|  hypothetical protein B456_006G273500                    135   3e-33   Gossypium raimondii
ref|XP_009150122.1|  PREDICTED: calnexin homolog 1                      135   3e-33   Brassica rapa
ref|XP_010523385.1|  PREDICTED: calnexin homolog 1-like                 135   4e-33   Tarenaya hassleriana [spider flower]
ref|XP_010483861.1|  PREDICTED: calnexin homolog 1                      134   9e-33   Camelina sativa [gold-of-pleasure]
gb|KJB40064.1|  hypothetical protein B456_007G045500                    134   9e-33   Gossypium raimondii
ref|XP_007159940.1|  hypothetical protein PHAVU_002G280200g             133   1e-32   Phaseolus vulgaris [French bean]
ref|XP_006844691.1|  hypothetical protein AMTR_s00016p00245620          133   2e-32   Amborella trichopoda
ref|XP_003630450.1|  Calnexin-like protein                              133   2e-32   Medicago truncatula
gb|KJB40065.1|  hypothetical protein B456_007G045500                    132   3e-32   Gossypium raimondii
ref|XP_007159942.1|  hypothetical protein PHAVU_002G280300g             132   4e-32   Phaseolus vulgaris [French bean]
gb|KJB40062.1|  hypothetical protein B456_007G045500                    132   4e-32   Gossypium raimondii
gb|ACJ85683.1|  unknown                                                 132   4e-32   Medicago truncatula
gb|KEH35681.1|  Calnexin 2                                              132   4e-32   Medicago truncatula
ref|XP_003602731.1|  Calnexin-like protein                              132   4e-32   Medicago truncatula
ref|XP_008222288.1|  PREDICTED: calnexin homolog                        132   4e-32   Prunus mume [ume]
ref|XP_010444005.1|  PREDICTED: calnexin homolog 1-like                 131   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010044902.1|  PREDICTED: calnexin homolog                        131   6e-32   Eucalyptus grandis [rose gum]
gb|EMT07009.1|  Calnexin-like protein                                   131   7e-32   
gb|EMS59517.1|  Calnexin-like protein 1                                 131   8e-32   Triticum urartu
gb|KDO47053.1|  hypothetical protein CISIN_1g041813mg                   131   1e-31   Citrus sinensis [apfelsine]
emb|CBI35622.3|  unnamed protein product                                124   1e-31   Vitis vinifera
ref|XP_009373671.1|  PREDICTED: calnexin homolog isoform X2             130   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_009373670.1|  PREDICTED: calnexin homolog isoform X1             130   1e-31   
ref|XP_006478659.1|  PREDICTED: calnexin homolog                        131   1e-31   
ref|XP_006423842.1|  hypothetical protein CICLE_v10028154mg             130   1e-31   
dbj|BAK00820.1|  predicted protein                                      130   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010695743.1|  PREDICTED: calnexin homolog                        129   3e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004503809.1|  PREDICTED: calnexin homolog isoform X1             130   3e-31   
ref|XP_008375429.1|  PREDICTED: calnexin homolog                        129   3e-31   
ref|XP_004503810.1|  PREDICTED: calnexin homolog isoform X2             129   4e-31   Cicer arietinum [garbanzo]
dbj|BAJ94182.1|  predicted protein                                      129   4e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007222238.1|  hypothetical protein PRUPE_ppa003823mg             129   4e-31   Prunus persica
gb|KCW87020.1|  hypothetical protein EUGRSUZ_B03570                     129   5e-31   Eucalyptus grandis [rose gum]
ref|XP_010044903.1|  PREDICTED: calnexin homolog                        129   6e-31   Eucalyptus grandis [rose gum]
ref|XP_009360274.1|  PREDICTED: calnexin homolog                        128   8e-31   Pyrus x bretschneideri [bai li]
ref|XP_008392683.1|  PREDICTED: calnexin homolog                        128   1e-30   
ref|XP_010555592.1|  PREDICTED: calnexin homolog 1-like                 128   1e-30   Tarenaya hassleriana [spider flower]
gb|KDP23235.1|  hypothetical protein JCGZ_23068                         127   1e-30   Jatropha curcas
gb|KJB40063.1|  hypothetical protein B456_007G045500                    127   1e-30   Gossypium raimondii
ref|XP_008360201.1|  PREDICTED: calnexin homolog 1-like                 127   2e-30   
ref|XP_009353485.1|  PREDICTED: calnexin homolog 1-like                 127   2e-30   Pyrus x bretschneideri [bai li]
ref|NP_001150317.1|  calnexin precursor                                 127   2e-30   Zea mays [maize]
gb|ABK95212.1|  unknown                                                 120   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008663173.1|  PREDICTED: calnexin homolog                        126   4e-30   
ref|XP_008369590.1|  PREDICTED: calnexin homolog                        126   5e-30   
gb|AGE09565.1|  CNX1-like protein                                       125   5e-30   Eucalyptus cladocalyx
emb|CAA54678.1|  calnexin                                               125   6e-30   Zea mays [maize]
gb|ACN41018.1|  unknown                                                 125   1e-29   Picea sitchensis
gb|KCW87019.1|  hypothetical protein EUGRSUZ_B03570                     125   2e-29   Eucalyptus grandis [rose gum]
ref|XP_006652238.1|  PREDICTED: calnexin homolog                        124   3e-29   Oryza brachyantha
gb|AGF69181.1|  calnexin precursor                                      120   1e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010536572.1|  PREDICTED: calnexin homolog 1-like                 121   2e-28   Tarenaya hassleriana [spider flower]
emb|CDY00229.1|  BnaA06g21300D                                          119   1e-27   
dbj|BAJ89767.1|  predicted protein                                      119   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001052692.1|  Os04g0402100                                       119   2e-27   
gb|EAZ30613.1|  hypothetical protein OsJ_14665                          119   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003567632.1|  PREDICTED: calnexin homolog                        118   3e-27   Brachypodium distachyon [annual false brome]
gb|EAY93972.1|  hypothetical protein OsI_15749                          118   3e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_004309487.1|  PREDICTED: calnexin homolog                        117   8e-27   Fragaria vesca subsp. vesca
gb|KJB07903.1|  hypothetical protein B456_001G053400                    113   9e-26   Gossypium raimondii
ref|XP_004975494.1|  PREDICTED: calnexin homolog                        113   2e-25   Setaria italica
ref|XP_006287793.1|  hypothetical protein CARUB_v10001009mg             111   5e-25   
gb|KDO57649.1|  hypothetical protein CISIN_1g009287mg                   110   7e-25   Citrus sinensis [apfelsine]
sp|Q39994.1|CALX_HELTU  RecName: Full=Calnexin homolog; Flags: Pr...    112   7e-25   Helianthus tuberosus [Jerusalem artichoke]
gb|EMT03767.1|  Calnexin-like protein                                   110   2e-24   
ref|XP_009380018.1|  PREDICTED: calnexin homolog 1-like                 110   4e-24   
ref|XP_010230383.1|  PREDICTED: calnexin homolog isoform X2             109   5e-24   
ref|XP_010230382.1|  PREDICTED: calnexin homolog isoform X1             108   1e-23   Brachypodium distachyon [annual false brome]
gb|KJB38820.1|  hypothetical protein B456_006G273500                    105   7e-23   Gossypium raimondii
gb|KJB38814.1|  hypothetical protein B456_006G273500                    105   7e-23   Gossypium raimondii
ref|XP_006399216.1|  hypothetical protein EUTSA_v10013223mg             104   1e-22   
sp|O82709.1|CALX_PEA  RecName: Full=Calnexin homolog; Flags: Prec...    105   2e-22   Pisum sativum [garden pea]
ref|XP_001773069.1|  predicted protein                                  100   1e-20   
gb|KDO57646.1|  hypothetical protein CISIN_1g009287mg                 98.2    4e-20   Citrus sinensis [apfelsine]
ref|XP_001773029.1|  predicted protein                                98.2    5e-20   
ref|XP_006280507.1|  hypothetical protein CARUB_v10026443mg           95.1    3e-19   
ref|XP_001756944.1|  predicted protein                                95.9    3e-19   
gb|ABC42907.1|  calnexin-like protein                                 90.5    4e-19   Dendrobium hybrid cultivar
gb|ABA27008.1|  TO49-2                                                84.3    9e-17   Taraxacum officinale [dandelion]
gb|AFG48475.1|  hypothetical protein CL130Contig1_06                  81.6    1e-16   Pinus taeda
gb|AFW58148.1|  hypothetical protein ZEAMMB73_760338                  82.0    3e-15   
tpg|DAA38018.1|  TPA: hypothetical protein ZEAMMB73_672981            82.0    4e-15   
ref|XP_001765831.1|  predicted protein                                63.2    3e-08   
ref|XP_005777632.1|  Calnexin                                         58.9    8e-07   Emiliania huxleyi CCMP1516
ref|XP_005781424.1|  hypothetical protein EMIHUDRAFT_442861           58.9    8e-07   Emiliania huxleyi CCMP1516
ref|XP_002735033.1|  PREDICTED: calnexin-like                         58.5    1e-06   Saccoglossus kowalevskii
gb|EMS52697.1|  hypothetical protein TRIUR3_31072                     56.2    1e-06   Triticum urartu
gb|KEZ43169.1|  Calnexin-like protein                                 57.8    2e-06   Scedosporium apiospermum
ref|XP_003853151.1|  calnexin protein                                 57.0    3e-06   Zymoseptoria tritici IPO323
ref|XP_007805590.1|  Calnexin                                         57.0    4e-06   Endocarpon pusillum Z07020
ref|XP_007413029.1|  hypothetical protein MELLADRAFT_72534            55.5    1e-05   Melampsora larici-populina 98AG31
ref|XP_011111038.1|  hypothetical protein H072_5152                   55.5    1e-05   
ref|XP_008710607.1|  hypothetical protein HMPREF1541_00076            55.1    1e-05   Cyphellophora europaea CBS 101466
ref|XP_007929717.1|  hypothetical protein MYCFIDRAFT_50886            54.7    2e-05   Pseudocercospora fijiensis CIRAD86
ref|XP_002674608.1|  predicted protein                                54.7    2e-05   Naegleria gruberi strain NEG-M
gb|EKV07146.1|  hypothetical protein PDIG_74200                       54.3    3e-05   Penicillium digitatum PHI26
gb|EFA78842.1|  calnexin                                              54.3    3e-05   Heterostelium album PN500
emb|CCG81941.1|  Calnexin                                             54.3    3e-05   Taphrina deformans PYCC 5710
gb|ESA03120.1|  hypothetical protein GLOINDRAFT_336953                54.3    3e-05   
ref|XP_009648869.1|  calnexin                                         54.3    3e-05   Verticillium dahliae VdLs.17
emb|CCI42590.1|  unnamed protein product                              53.5    3e-05   Albugo candida
ref|XP_004355969.1|  hypothetical protein DFA_08481                   54.3    4e-05   Cavenderia fasciculata
gb|KIW07741.1|  hypothetical protein PV09_01671                       53.9    4e-05   Verruconis gallopava
ref|XP_009859719.1|  PREDICTED: calnexin isoform X2                   53.9    4e-05   
ref|XP_002127428.1|  PREDICTED: calnexin isoform X3                   53.9    4e-05   
ref|XP_009859718.1|  PREDICTED: calnexin isoform X1                   53.9    4e-05   
ref|XP_008023635.1|  hypothetical protein SETTUDRAFT_168222           53.9    4e-05   Exserohilum turcica Et28A
ref|XP_003055258.1|  predicted protein                                53.5    4e-05   Micromonas pusilla CCMP1545
emb|CCI42589.1|  unnamed protein product                              53.5    4e-05   Albugo candida
emb|CCA18171.1|  calciumdependent protein 2 putative                  53.5    5e-05   Albugo laibachii Nc14
ref|XP_008910920.1|  hypothetical protein PPTG_15911                  52.8    8e-05   Phytophthora parasitica INRA-310
gb|ETI39239.1|  hypothetical protein F443_15186                       52.8    8e-05   Phytophthora parasitica P1569
gb|KEQ88681.1|  calnexin-like protein                                 52.8    8e-05   Aureobasidium pullulans EXF-150
ref|XP_011121725.1|  hypothetical protein AOL_s00078g160              52.8    1e-04   Arthrobotrys oligospora ATCC 24927
dbj|GAE00076.1|  calnexin precursor                                   52.8    1e-04   Byssochlamys spectabilis No. 5
gb|EEQ88189.1|  calnexin                                              52.8    1e-04   Blastomyces dermatitidis ER-3
ref|XP_002627579.1|  calnexin                                         52.4    1e-04   Blastomyces gilchristii SLH14081
gb|EFX05243.1|  calnexin precursor                                    52.4    1e-04   Grosmannia clavigera kw1407
dbj|GAM18605.1|  hypothetical protein SAMD00019534_017800             52.4    1e-04   Acytostelium subglobosum LB1
ref|XP_005792888.1|  hypothetical protein EMIHUDRAFT_49942            49.3    1e-04   Emiliania huxleyi CCMP1516
gb|EKG22397.1|  Calreticulin/calnexin                                 52.4    1e-04   Macrophomina phaseolina MS6
gb|KGO73367.1|  Concanavalin A-like lectin/glucanases superfamily     52.4    1e-04   Penicillium italicum
ref|XP_004455355.1|  PREDICTED: calreticulin-3                        51.6    1e-04   Dasypus novemcinctus
dbj|GAA81928.1|  calnexin precursor                                   52.0    2e-04   Aspergillus kawachii IFO 4308
gb|EPS33667.1|  hypothetical protein PDE_08629                        52.0    2e-04   Penicillium oxalicum 114-2
ref|XP_005536371.1|  calnexin                                         52.0    2e-04   Cyanidioschyzon merolae strain 10D
gb|KGO37689.1|  Concanavalin A-like lectin/glucanase, subgroup        52.0    2e-04   Penicillium expansum
ref|XP_003324724.1|  calnexin                                         52.0    2e-04   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_009060914.1|  hypothetical protein LOTGIDRAFT_219285           52.0    2e-04   Lottia gigantea
ref|XP_661196.1|  hypothetical protein AN3592.2                       52.0    2e-04   Aspergillus nidulans FGSC A4
ref|XP_001389264.1|  calnexin protein                                 52.0    2e-04   Aspergillus niger CBS 513.88
tpe|CBF75819.1|  TPA: calnexin, putative (Eurofung)                   52.0    2e-04   Aspergillus nidulans FGSC A4
dbj|GAM85986.1|  hypothetical protein ANO11243_039960                 52.0    2e-04   fungal sp. No.11243
ref|XP_009019390.1|  hypothetical protein HELRODRAFT_184962           52.0    2e-04   Helobdella robusta
ref|XP_645704.1|  hypothetical protein DDB_G0271144                   51.6    2e-04   Dictyostelium discoideum AX4
gb|EYE92779.1|  calnexin precursor                                    51.6    2e-04   Aspergillus ruber CBS 135680
gb|KEQ65971.1|  Calreticulin-domain-containing protein                51.6    2e-04   Aureobasidium melanogenum CBS 110374
gb|KFH63342.1|  calnexin                                              51.6    2e-04   Mortierella verticillata NRRL 6337
ref|XP_007582295.1|  putative calnexin protein                        51.6    2e-04   
gb|KGK40585.1|  hypothetical protein JL09_g184                        51.6    2e-04   Pichia kudriavzevii
gb|EMS65078.1|  Calnexin-like protein 1                               48.9    2e-04   Triticum urartu
ref|XP_001816793.1|  calnexin protein                                 51.6    3e-04   Aspergillus oryzae RIB40
ref|XP_007872324.1|  hypothetical protein PNEG_00446                  51.6    3e-04   Pneumocystis murina B123
gb|KHO00046.1|  calreticulin                                          51.2    3e-04   Metarhizium album ARSEF 1941
ref|XP_002383280.1|  calnexin                                         51.2    3e-04   Aspergillus flavus NRRL3357
ref|XP_005710568.1|  Calnexin                                         51.2    3e-04   Chondrus crispus [carageen]
emb|CDR42027.1|  CYFA0S08e02762g1_1                                   51.2    3e-04   Cyberlindnera fabianii
ref|XP_004688704.1|  PREDICTED: calreticulin-3                        51.2    3e-04   Condylura cristata
ref|XP_007709681.1|  hypothetical protein COCCADRAFT_24118            51.2    3e-04   Bipolaris zeicola 26-R-13
gb|EMD94330.1|  hypothetical protein COCHEDRAFT_1130883               51.2    3e-04   Bipolaris maydis C5
ref|XP_007701102.1|  hypothetical protein COCSADRAFT_38208            51.2    3e-04   Bipolaris sorokiniana ND90Pr
ref|XP_003701110.1|  PREDICTED: calreticulin-like                     51.2    3e-04   Megachile rotundata
gb|KEQ92935.1|  hypothetical protein AUEXF2481DRAFT_42635             51.2    3e-04   Aureobasidium subglaciale EXF-2481
ref|XP_002598323.1|  hypothetical protein BRAFLDRAFT_204584           51.2    3e-04   Branchiostoma floridae
ref|XP_003123521.1|  PREDICTED: calreticulin-3                        50.8    3e-04   Sus scrofa [pigs]
ref|XP_006099717.1|  PREDICTED: calreticulin-3                        50.8    3e-04   Myotis lucifugus
ref|XP_003746903.1|  PREDICTED: calnexin-like                         50.8    4e-04   Galendromus occidentalis
ref|XP_002997004.1|  calnexin, putative                               50.8    4e-04   Phytophthora infestans T30-4
ref|XP_007689046.1|  hypothetical protein COCMIDRAFT_98137            50.8    4e-04   Bipolaris oryzae ATCC 44560
gb|EEH20809.1|  hypothetical protein PABG_03040                       50.8    4e-04   Paracoccidioides brasiliensis Pb03
ref|XP_008581224.1|  PREDICTED: calreticulin-3                        50.4    4e-04   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010757501.1|  hypothetical protein PADG_01565                  50.8    4e-04   Paracoccidioides brasiliensis Pb18
ref|XP_001502923.1|  PREDICTED: calreticulin-3 isoform X1             50.4    4e-04   Equus caballus [domestic horse]
ref|XP_002499895.1|  predicted protein                                50.4    5e-04   Micromonas commoda
ref|XP_006768508.1|  PREDICTED: calreticulin-3 isoform X2             50.4    5e-04   Myotis davidii
emb|CDK24692.1|  unnamed protein product                              50.4    5e-04   Kuraishia capsulata CBS 1993
ref|XP_001212344.1|  calnexin precursor                               50.4    5e-04   Aspergillus terreus NIH2624
gb|ELK26684.1|  Calreticulin-3                                        50.4    5e-04   Myotis davidii
ref|XP_001688470.1|  AGAP005032-PA                                    50.4    5e-04   Anopheles gambiae str. PEST
ref|XP_010642618.1|  PREDICTED: calreticulin-3 isoform X3             50.1    6e-04   Fukomys damarensis [Damara mole rat]
ref|XP_313899.4|  AGAP005032-PB                                       50.4    6e-04   Anopheles gambiae str. PEST
ref|XP_007810134.1|  calreticulin                                     50.4    6e-04   Metarhizium acridum CQMa 102
ref|XP_006768507.1|  PREDICTED: calreticulin-3 isoform X1             50.1    6e-04   
ref|XP_002956983.1|  hypothetical protein VOLCADRAFT_77379            50.4    7e-04   Volvox carteri f. nagariensis
ref|XP_010804869.1|  PREDICTED: calreticulin-3 isoform X2             50.1    7e-04   
gb|EMF10900.1|  calreticulin precursor                                50.1    7e-04   Sphaerulina musiva SO2202
ref|XP_002545525.1|  predicted protein                                50.1    7e-04   Candida tropicalis MYA-3404
ref|XP_010642616.1|  PREDICTED: calreticulin-3 isoform X2             50.1    7e-04   Fukomys damarensis [Damara mole rat]
gb|EGE00302.1|  calnexin                                              50.1    7e-04   Trichophyton tonsurans CBS 112818
ref|XP_010642615.1|  PREDICTED: calreticulin-3 isoform X1             50.1    8e-04   Fukomys damarensis [Damara mole rat]
gb|EGE03014.1|  calnexin                                              50.1    8e-04   Trichophyton equinum CBS 127.97
ref|XP_008559929.1|  PREDICTED: calreticulin                          50.1    8e-04   Microplitis demolitor
gb|EZF33950.1|  hypothetical protein H101_02494                       50.1    8e-04   Trichophyton interdigitale H6
gb|KDB27473.1|  hypothetical protein H109_00736                       50.1    8e-04   Trichophyton interdigitale MR816
gb|KFO24686.1|  Calreticulin-3                                        49.7    8e-04   
ref|XP_001938332.1|  calreticulin precursor                           50.1    8e-04   
emb|CCE30657.1|  probable calcium-binding protein precursor cnx1      50.1    8e-04   
ref|XP_010843973.1|  PREDICTED: calreticulin-3                        50.1    8e-04   
ref|XP_011153086.1|  PREDICTED: calreticulin                          49.7    8e-04   
ref|XP_005758760.1|  Calnexin                                         49.7    9e-04   
tpg|DAA28171.1|  TPA: calreticulin-3 precursor                        49.7    9e-04   
ref|XP_004329792.1|  PREDICTED: calreticulin-3-like                   48.5    9e-04   
ref|XP_002401232.1|  calnexin, putative                               50.1    9e-04   
ref|NP_001033603.1|  calreticulin-3 precursor                         49.7    9e-04   
ref|XP_006057920.1|  PREDICTED: calreticulin-3 isoform X1             49.7    9e-04   
ref|XP_005632796.1|  PREDICTED: calreticulin-3 isoform X1             49.7    9e-04   
ref|XP_002564324.1|  Pc22g02800                                       49.7    9e-04   
ref|XP_005208556.1|  PREDICTED: calreticulin-3 isoform X1             49.7    9e-04   
gb|AAX45072.1|  calreticulin                                          49.7    9e-04   
ref|XP_003489404.1|  PREDICTED: calnexin-like                         50.1    9e-04   
ref|XP_007779475.1|  hypothetical protein W97_03388                   49.7    9e-04   
gb|ELR52274.1|  Calreticulin-3                                        49.7    9e-04   
ref|XP_005901537.1|  PREDICTED: calreticulin-3                        49.7    0.001   
ref|XP_001538455.1|  hypothetical protein HCAG_06060                  49.7    0.001   
gb|EGC41358.1|  calnexin                                              49.7    0.001   
gb|EER45416.1|  calnexin                                              49.7    0.001   
gb|EWC45165.1|  calnexin-like protein                                 49.7    0.001   
ref|XP_533885.1|  PREDICTED: calreticulin-3 isoform X2                49.7    0.001   
ref|XP_003024212.1|  hypothetical protein TRV_01645                   49.7    0.001   



>ref|XP_009796698.1| PREDICTED: calnexin homolog 1-like [Nicotiana sylvestris]
Length=539

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR+TAWKPKFDVEKEKQKAEE T S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYRKTAWKPKFDVEKEKQKAEEATTSG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QK+VFD LYK+AD+P LGEHK K+LDLLEKAE QPN+T+GV++S+IV++ T+L+K
Sbjct  424  GLKGFQKMVFDLLYKVADIPLLGEHKSKVLDLLEKAETQPNLTVGVVISIIVIIFTVLLK  483

Query  325  lLFGGKKQIPAR  290
            L FGGKKQ PAR
Sbjct  484  LTFGGKKQQPAR  495



>ref|XP_009792195.1| PREDICTED: calnexin homolog 1-like [Nicotiana sylvestris]
Length=539

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR TAWKPKFD EKEKQKAEEV  S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYRNTAWKPKFDAEKEKQKAEEVASSG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QKVVFD LYK+AD+P LGEHK K+LDLLEKAE QPN+TIGV++S+I+V+ T+L+K
Sbjct  424  GLKGFQKVVFDLLYKVADIPLLGEHKSKVLDLLEKAETQPNLTIGVVISIIIVIFTVLLK  483

Query  325  lLFGGKKQIPAR  290
            L+FGGKKQ PAR
Sbjct  484  LIFGGKKQQPAR  495



>ref|XP_009627797.1| PREDICTED: calnexin homolog 1-like [Nicotiana tomentosiformis]
Length=540

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR+TAWKPKFD EKEKQKAEEV +S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYRKTAWKPKFDAEKEKQKAEEVANSG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QKVVFD LYK+AD+P LGEHK K+LDLL KAE QPN+T+GV++S+I+V+ T+L+K
Sbjct  424  GLKGFQKVVFDLLYKVADIPLLGEHKSKVLDLLAKAETQPNLTVGVVISIIIVIFTVLLK  483

Query  325  lLFGGKKQIPAR  290
            L+FGGKKQ PAR
Sbjct  484  LIFGGKKQQPAR  495



>gb|AIL30503.1| calnexin-like protein [Nicotiana tabacum]
Length=539

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DE+VAESYR+TAWKPKFD EKEKQKAEE T S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDERVAESYRKTAWKPKFDAEKEKQKAEEATISG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QKVVFD LYK+AD+P LGEHK K+LDLLEKAE +PN+T+GV++S+++V+ T+L+K
Sbjct  424  GLKGFQKVVFDLLYKVADIPLLGEHKSKVLDLLEKAETKPNLTVGVVISIVIVIFTVLLK  483

Query  325  lLFGGKKQIPAR  290
            L FGGKKQ PAR
Sbjct  484  LTFGGKKQQPAR  495



>ref|XP_009627792.1| PREDICTED: calnexin homolog 1-like [Nicotiana tomentosiformis]
Length=539

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DE+VAESYR+TAWKPKFD EKEKQKAEE T S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDERVAESYRKTAWKPKFDAEKEKQKAEEATISG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QKVVFD LYK+AD+P LGEHK K+LDLLEKAE +PN+T+GV++S+++V+ T+L+K
Sbjct  424  GLKGFQKVVFDLLYKMADIPLLGEHKSKVLDLLEKAETKPNLTVGVVISIVIVIFTVLLK  483

Query  325  lLFGGKKQIPAR  290
            L FGGKK  PAR
Sbjct  484  LTFGGKKLQPAR  495



>ref|XP_006366282.1| PREDICTED: calnexin homolog [Solanum tuberosum]
Length=538

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNI+IA+DEKVAESYR TAWKPKFD+EKEKQKAEE   + 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNIMIASDEKVAESYRMTAWKPKFDIEKEKQKAEEAASTG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QK+V D LYK+AD+PFLGEHK K+LD+LEKAEKQPN+T+G ++S+I+++ T+ +K
Sbjct  424  GLKGFQKMVLDLLYKVADIPFLGEHKSKVLDILEKAEKQPNLTVGAVISIIIIIFTVFLK  483

Query  325  lLFGGKKQIPAR  290
            L+FGG +Q PA+
Sbjct  484  LIFGGTQQQPAK  495



>ref|XP_004241643.1| PREDICTED: calnexin homolog 1-like isoform X2 [Solanum lycopersicum]
Length=538

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR TAWKPKFD+EKEKQKAEE   + 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYRMTAWKPKFDIEKEKQKAEEAASAG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QK+V D LYK+AD+PFLGEH+ K+LDLLEKAEKQPN+T+G ++S+I+++ T+ +K
Sbjct  424  GLKGFQKMVLDLLYKVADIPFLGEHRSKVLDLLEKAEKQPNLTVGAVISIIIIIFTVFLK  483

Query  325  lLFGGKKQIPAR  290
            L+FGG +Q P +
Sbjct  484  LIFGGTQQQPVK  495



>ref|XP_010322635.1| PREDICTED: calnexin homolog 1-like isoform X1 [Solanum lycopersicum]
Length=552

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR TAWKPKFD+EKEKQKAEE   + 
Sbjct  378  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYRMTAWKPKFDIEKEKQKAEEAASAG  437

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG+QK+V D LYK+AD+PFLGEH+ K+LDLLEKAEKQPN+T+G ++S+I+++ T+ +K
Sbjct  438  GLKGFQKMVLDLLYKVADIPFLGEHRSKVLDLLEKAEKQPNLTVGAVISIIIIIFTVFLK  497

Query  325  lLFGGKKQIPAR  290
            L+FGG +Q P +
Sbjct  498  LIFGGTQQQPVK  509



>gb|EYU24545.1| hypothetical protein MIMGU_mgv1a007617mg [Erythranthe guttata]
Length=401

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAAVGIEIWTMQDGI+FDNILIA+DEKVAESYR++AWKPKF+ EK KQK EE T+SD
Sbjct  226  FEPIAAVGIEIWTMQDGIVFDNILIASDEKVAESYRESAWKPKFEAEKLKQKEEETTESD  285

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            GLKG QKVVFD LYK+ADLPFLGEHK K+LDLLEKAEKQ N
Sbjct  286  GLKGVQKVVFDNLYKVADLPFLGEHKVKVLDLLEKAEKQAN  326



>emb|CDO98285.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR T WKPKF+VEKEKQKAEE   D+
Sbjct  365  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYRTTTWKPKFEVEKEKQKAEEAAADT  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
              LKG+QK VFD LYK+ADLPFLGEHK K+LDLLEKAEKQPN+TIGVI+S+IVV+ T+L+
Sbjct  425  GALKGFQKTVFDLLYKVADLPFLGEHKLKVLDLLEKAEKQPNLTIGVIISIIVVIFTLLL  484

Query  328  klLFGGKKQIPAR  290
            K++FGGKK   AR
Sbjct  485  KIIFGGKKPARAR  497



>gb|KJB07905.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=402

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E TDS
Sbjct  226  FEPIAAVGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDESTDS  285

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G QK VFD LYK+AD+PFL E+K +ILDL+EKAEKQPNITIGVIVS++V++LT+L 
Sbjct  286  DGLSGVQKKVFDVLYKVADIPFLSEYKLQILDLIEKAEKQPNITIGVIVSILVIILTVLF  345

Query  328  klLFGGKKQ  302
            +LLFGGKKQ
Sbjct  346  RLLFGGKKQ  354



>ref|NP_001234129.1| calnexin-like protein precursor [Solanum lycopersicum]
 dbj|BAD99512.1| calnexin-like protein [Solanum lycopersicum]
Length=538

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILIA+DE+VAESYR+TAWKPKFDVEKEKQKAEE  +S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIASDEEVAESYRKTAWKPKFDVEKEKQKAEEEAESG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKGYQK+VFD LYK+A +PFLGEHK K+LDLLEKAEKQPNIT+GV+VS++VVV ++L+K
Sbjct  424  GLKGYQKLVFDLLYKVAGIPFLGEHKTKVLDLLEKAEKQPNITVGVVVSIVVVVFSVLLK  483

Query  325  lLFGGKKQIPAR  290
            L+FGGKKQ PAR
Sbjct  484  LIFGGKKQQPAR  495



>gb|ABD59793.1| calnexin, partial [Arnebia euchroma]
Length=166

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGILFDNILIATDEKVAESYR  AWKPKF  E+EKQ+AEE    D
Sbjct  42   FEPIAAIGIEIWTMQDGILFDNILIATDEKVAESYRNDAWKPKFLAEEEKQRAEEAAAAD  101

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            S  LKG QK VFD +YKI D+PFL +HK KILDL+EKAEKQPN
Sbjct  102  SGPLKGIQKAVFDVIYKIVDIPFLSDHKIKILDLIEKAEKQPN  144



>gb|KJB07906.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
 gb|KJB07907.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=535

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E TDS
Sbjct  359  FEPIAAVGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDESTDS  418

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G QK VFD LYK+AD+PFL E+K +ILDL+EKAEKQPNITIGVIVS++V++LT+L 
Sbjct  419  DGLSGVQKKVFDVLYKVADIPFLSEYKLQILDLIEKAEKQPNITIGVIVSILVIILTVLF  478

Query  328  klLFGGKKQ  302
            +LLFGGKKQ
Sbjct  479  RLLFGGKKQ  487



>ref|XP_006366280.1| PREDICTED: calnexin homolog [Solanum tuberosum]
Length=162

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  646  MQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSDGLKGYQKVVFDQL  467
            MQDGILFDNI+IA+DEKVAESYR TAWKPKFD+EKEKQKAEE   + GLKG+QK+V D L
Sbjct  1    MQDGILFDNIMIASDEKVAESYRMTAWKPKFDIEKEKQKAEEAASTGGLKGFQKMVLDLL  60

Query  466  YKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvklLFGGKKQIPARP  287
            YK+AD+PFLGEHK K+LD+LEKAEKQPN+T+G ++S+I+++ T+ +KL+FGG +Q PA+ 
Sbjct  61   YKVADIPFLGEHKSKVLDILEKAEKQPNLTVGAVISIIIIIFTVFLKLIFGGTQQQPAKA  120

Query  286  V  284
             
Sbjct  121  T  121



>gb|KHG05799.1| Calnexin [Gossypium arboreum]
Length=533

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E TDS
Sbjct  359  FEPIAAVGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDESTDS  418

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL   QK VFD LYK+AD+PFL E+K +ILDL+EKAEKQPNITIGVIVS++V++LT+L 
Sbjct  419  DGLSAVQKKVFDVLYKVADIPFLSEYKLQILDLIEKAEKQPNITIGVIVSILVIMLTVLF  478

Query  328  klLFGGKKQ  302
            +LLFGGKKQ
Sbjct  479  RLLFGGKKQ  487



>ref|XP_007038183.1| Calnexin 1 [Theobroma cacao]
 gb|EOY22684.1| Calnexin 1 [Theobroma cacao]
Length=531

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA +EK AESYR+TAWKPKF+VEKEKQKAE EV  S
Sbjct  361  FEPIAAIGIEIWTMQDGILFDNILIAKNEKAAESYRETAWKPKFEVEKEKQKAEDEVAGS  420

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYK+AD+PFL ++K +ILDL+EKAEKQPN+TIGV+VS++V++LT   
Sbjct  421  DGLAGFQKKVFDVLYKVADIPFLSKYKLQILDLIEKAEKQPNLTIGVLVSIVVIILTAFF  480

Query  328  klLFGGKKQ  302
            KL+FGGKKQ
Sbjct  481  KLIFGGKKQ  489



>dbj|BAD81043.1| calnexin [Glycine max]
Length=546

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA D+KVAESYR+T WKPKF VEK+K KAEE   T 
Sbjct  371  FEPIAAIGIEIWTMQDGILFDNVLIANDDKVAESYRETTWKPKFTVEKDKLKAEEEAATG  430

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDG+ G+QK VFD LYKIAD+PFL EHK KI DL+EKAEKQPN+TIG++V+V+VV ++I 
Sbjct  431  SDGISGFQKKVFDLLYKIADIPFLSEHKSKIFDLIEKAEKQPNLTIGILVAVVVVFVSIF  490

Query  331  vklLFGGKK  305
            ++L+FGGKK
Sbjct  491  LRLIFGGKK  499



>ref|NP_001235116.1| calnexin homolog precursor [Glycine max]
 sp|Q39817.1|CALX_SOYBN RecName: Full=Calnexin homolog; Flags: Precursor [Glycine max]
 gb|AAA80588.1| calnexin [Glycine max]
 gb|KHN09695.1| Calnexin like [Glycine soja]
Length=546

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA D+KVAESYR+T WKPKF VEK+K KAEE   T 
Sbjct  371  FEPIAAIGIEIWTMQDGILFDNVLIANDDKVAESYRETTWKPKFTVEKDKLKAEEEAATG  430

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDG+ G+QK VFD LYKIAD+PFL EHK KI DL+EKAEKQPN+TIG++V+V+VV ++I 
Sbjct  431  SDGISGFQKKVFDLLYKIADIPFLSEHKSKIFDLIEKAEKQPNLTIGILVAVVVVFVSIF  490

Query  331  vklLFGGKK  305
             +L+FGGKK
Sbjct  491  FRLIFGGKK  499



>ref|XP_003523183.1| PREDICTED: calnexin homolog [Glycine max]
Length=543

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGILFDNILIA D+KVAESYR+T WKPKF +EKEKQKAE+   T 
Sbjct  372  FEPIAALGIEIWTMQDGILFDNILIANDDKVAESYRETTWKPKFTIEKEKQKAEDEAATG  431

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDG+ G+QK VFD LYKIAD+PFL +HK KI DL+EKAEKQPN+TIG++V+V+VV ++I 
Sbjct  432  SDGIAGFQKKVFDLLYKIADIPFLSDHKSKIYDLIEKAEKQPNLTIGILVAVVVVFVSIF  491

Query  331  vklLFGGKK  305
             +L+FGGKK
Sbjct  492  FRLIFGGKK  500



>ref|XP_006341454.1| PREDICTED: calnexin homolog [Solanum tuberosum]
Length=541

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 1/133 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDGILFDNILI +DEKVAESYR+TAWKPKFDVEKEKQK EE  +S 
Sbjct  364  FEPIAAIGIEIWTMQDGILFDNILIGSDEKVAESYRKTAWKPKFDVEKEKQKVEEEAESG  423

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKGYQKVVFD LYK+A +PFLGEHK K+LDLLEKAEKQPNIT+GV+VSV+VVV ++L+K
Sbjct  424  GLKGYQKVVFDLLYKVAGVPFLGEHKAKVLDLLEKAEKQPNITVGVVVSVVVVVFSVLLK  483

Query  325  lLFGG-KKQIPAR  290
            L+FGG KKQ PAR
Sbjct  484  LIFGGKKKQQPAR  496



>gb|KHN31239.1| Calnexin like [Glycine soja]
Length=543

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGILFDNILIA D+KVAESYR+T WKPKF +EKEKQKAE+   T 
Sbjct  372  FEPIAALGIEIWTMQDGILFDNILIANDDKVAESYRETTWKPKFTIEKEKQKAEDEAATG  431

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDG+ G+QK VFD LYKIAD+PFL +HK KI DL+EKAEKQPN+TIG++V+V+VV ++I 
Sbjct  432  SDGIAGFQKKVFDLLYKIADIPFLSDHKSKIYDLIEKAEKQPNLTIGILVAVVVVFVSIF  491

Query  331  vklLFGGKK  305
             +L+FGGKK
Sbjct  492  FRLIFGGKK  500



>gb|KJB07904.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=534

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E TDS
Sbjct  359  FEPIAAVGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDESTDS  418

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G QK VFD LYK+AD+PFL E+K +ILDL+EKAEKQPNITIGVIVS++V++LT+L 
Sbjct  419  DGLSGVQK-VFDVLYKVADIPFLSEYKLQILDLIEKAEKQPNITIGVIVSILVIILTVLF  477

Query  328  klLFGGKKQ  302
            +LLFGGKKQ
Sbjct  478  RLLFGGKKQ  486



>ref|XP_010249364.1| PREDICTED: calnexin homolog [Nelumbo nucifera]
 ref|XP_010249365.1| PREDICTED: calnexin homolog [Nelumbo nucifera]
Length=535

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEP+AA+GIEIWTMQDGILFDNILIA+DEKVAESYR+TAWKPK++VEKEKQKAEE T   
Sbjct  360  FEPVAAIGIEIWTMQDGILFDNILIASDEKVAESYRETAWKPKYEVEKEKQKAEEATPGL  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G +K VFD LYK+AD+PFL  +K KILDL+EKAE QPN+TIG++VS+++V+LT+ 
Sbjct  420  SDGLSGIKKKVFDLLYKVADIPFLDGYKLKILDLIEKAETQPNLTIGILVSIVIVILTVF  479

Query  331  vklLFGGKK  305
             ++LFGGKK
Sbjct  480  FRILFGGKK  488



>ref|XP_010112005.1| Calnexin-1-like protein [Morus notabilis]
 gb|EXC32350.1| Calnexin-1-like protein [Morus notabilis]
Length=548

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEP+AA+GIEIWTMQDG+LFDNILIA DEKVAESYR T+WKPKFDVEKEKQK+EE  D  
Sbjct  365  FEPLAAIGIEIWTMQDGLLFDNILIADDEKVAESYRLTSWKPKFDVEKEKQKSEEAADGL  424

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SDGL  +QK +FD LYKIADLPFL  ++  I+DL+EKAEKQPN
Sbjct  425  SDGLSAFQKKIFDVLYKIADLPFLSAYQPTIIDLIEKAEKQPN  467



>ref|XP_010249367.1| PREDICTED: calnexin homolog [Nelumbo nucifera]
Length=535

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEP+AA+GIEIWTMQDGILFDNILIA+DEKVAESYR+TAWKPK++VEKEKQKAEE T   
Sbjct  360  FEPVAAIGIEIWTMQDGILFDNILIASDEKVAESYRETAWKPKYEVEKEKQKAEEPTAGL  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G +K VFD LYK+AD+PFL  +K KILDL+EKAE QPN+TIG++VS+++V+LTI 
Sbjct  420  SDGLSGIKKKVFDLLYKVADIPFLDAYKLKILDLIEKAETQPNLTIGILVSIVIVILTIF  479

Query  331  vklLFGGKK  305
             ++LFGGKK
Sbjct  480  FRILFGGKK  488



>ref|XP_009380017.1| PREDICTED: calnexin homolog [Musa acuminata subsp. malaccensis]
Length=535

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT-DS  509
            FEPI A+GIEIWTMQDGILFDNILIA+DEKVAESYR   WKPK++VEKEKQKAE+ +  S
Sbjct  360  FEPITAIGIEIWTMQDGILFDNILIASDEKVAESYRTETWKPKYEVEKEKQKAEDASVSS  419

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYK AD+PFL  HK KI+D++EKAEKQPN+TIG++ S++VV+LT++ 
Sbjct  420  DGLSGFQKKVFDVLYKFADIPFLESHKIKIIDVIEKAEKQPNLTIGILASILVVILTVIF  479

Query  328  klLFGGKK-QIPARPV  284
            ++LFGGKK Q P  P 
Sbjct  480  RILFGGKKPQAPVAPT  495



>gb|KDO57647.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=538

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK KAEE    S
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGS  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYK+AD+PFL  +K KI+D++EK EKQPN+TIG++VSV+ V++T+L 
Sbjct  425  DGLAGFQKTVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLF  484

Query  328  klLFGGKK  305
            K++FGGKK
Sbjct  485  KIIFGGKK  492



>gb|KFK25123.1| hypothetical protein AALP_AA8G068700 [Arabis alpina]
Length=532

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQKAE+    +
Sbjct  363  FEPIAAIGIEIWTMQDGILFDNVLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEDDAAGE  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQK VFD LYK+AD+ FL  +K KI++L+EKAE QPN+T+GV++SV+VV L++ 
Sbjct  423  ADGLKSYQKKVFDLLYKVADISFLSAYKSKIMELIEKAETQPNLTLGVLISVVVVFLSLF  482

Query  331  vklLFGGKK  305
            +KL+FGGKK
Sbjct  483  LKLVFGGKK  491



>ref|XP_006436992.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
 gb|ESR50232.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
Length=498

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK KAEE    S
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGS  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYK+AD+PFL  +K KI+D++EK EKQPN+TIG++VSV+ V++T+L 
Sbjct  425  DGLAGFQKKVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLF  484

Query  328  klLFGGKK  305
            K++FGGKK
Sbjct  485  KIIFGGKK  492



>ref|XP_002511066.1| calnexin, putative [Ricinus communis]
 gb|EEF51668.1| calnexin, putative [Ricinus communis]
Length=542

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILF +ILIA DEKVAES RQTAWKPKFD EKEKQKAE+    S
Sbjct  366  FEPIAAVGIEIWTMQDGILFGHILIADDEKVAESLRQTAWKPKFDAEKEKQKAEDAAAGS  425

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LY++AD+PFL EHK KI+D++EK EKQPN+TIG++VS++VV+ T+L 
Sbjct  426  DGLAGFQKKVFDLLYQVADIPFLSEHKDKIIDIIEKGEKQPNLTIGILVSIVVVIFTVLF  485

Query  328  klLFGGKK  305
            K+LFGGKK
Sbjct  486  KILFGGKK  493



>gb|EPS68494.1| calnexin-like protein, partial [Genlisea aurea]
Length=460

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            ++PIAAVGIEIWTMQDGILFDNILIA+  +V+ESYR++AWKPKFD EKEKQKAE+  T S
Sbjct  333  YDPIAAVGIEIWTMQDGILFDNILIASSVQVSESYRESAWKPKFDAEKEKQKAEDSTTSS  392

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            +GLK +QK+ FD LYK ADLPFL  HK KIL+LLEKAEKQPN+TIG++VS+  ++L+++ 
Sbjct  393  EGLKNFQKLAFDYLYKAADLPFLANHKDKILELLEKAEKQPNLTIGILVSISAILLSVIF  452

Query  328  klLFGGKK  305
            +LLFGG+K
Sbjct  453  RLLFGGRK  460



>ref|XP_006485059.1| PREDICTED: calnexin homolog [Citrus sinensis]
Length=538

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK KAEE    S
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGS  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYK+AD+PFL  +K KI+D++EK EKQPN+TIG++VSV+ V++T+L 
Sbjct  425  DGLAGFQKKVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLF  484

Query  328  klLFGGKK  305
            K++FGGKK
Sbjct  485  KIIFGGKK  492



>ref|XP_006436993.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
 gb|ESR50233.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
Length=538

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK KAEE    S
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGS  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYK+AD+PFL  +K KI+D++EK EKQPN+TIG++VSV+ V++T+L 
Sbjct  425  DGLAGFQKKVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLF  484

Query  328  klLFGGKK  305
            K++FGGKK
Sbjct  485  KIIFGGKK  492



>gb|AFK38191.1| unknown [Lotus japonicus]
Length=235

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+A SYR+T WKPKF +EKEKQK E+V T S
Sbjct  66   FEPIAAIGIEIWTMQDGILFDNILIAQDDKIAASYRETTWKPKFTIEKEKQKEEDVETGS  125

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL  +QK VFD LYKIAD+PFL  +K KI D++EK EKQPN+TIG++VSV+VV L+I  
Sbjct  126  SGLASFQKKVFDLLYKIADIPFLSAYKLKIYDIIEKGEKQPNLTIGILVSVVVVFLSIFF  185

Query  328  klLFGGKK  305
            ++LFGGKK
Sbjct  186  RILFGGKK  193



>gb|KJB38817.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=494

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
              L G+Q+ VFD LYK+AD+PFL ++K +ILDL+E AE QPN+TIGV+VS++V++LTI  
Sbjct  422  ARLAGFQRKVFDVLYKVADIPFLSKYKHQILDLIEHAETQPNLTIGVLVSIVVIILTIFF  481

Query  328  klLFGGKKQI  299
            KL+FGGKKQ+
Sbjct  482  KLIFGGKKQV  491



>ref|XP_004145138.1| PREDICTED: calnexin homolog 1-like [Cucumis sativus]
 ref|XP_004154010.1| PREDICTED: calnexin homolog 1-like [Cucumis sativus]
 ref|XP_004169924.1| PREDICTED: calnexin homolog 1-like [Cucumis sativus]
 gb|KGN64444.1| Calnexin [Cucumis sativus]
Length=539

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 114/134 (85%), Gaps = 2/134 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDS-  509
            F+P+AA+GIEIWTMQDGILFDNILIA DEK+A SYR   WKPKF+VEKEKQKAEE   S 
Sbjct  361  FDPVAAIGIEIWTMQDGILFDNILIAKDEKLATSYRDEKWKPKFEVEKEKQKAEEAAASG  420

Query  508  -DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
             DGL  YQK VFD LYKIAD+ FL ++K KI+D++EK EKQPN+TIG+IVS++VV+ TIL
Sbjct  421  PDGLAEYQKKVFDVLYKIADISFLSQYKSKIIDVIEKGEKQPNLTIGIIVSIVVVIFTIL  480

Query  331  vklLFGGKKQIPAR  290
            ++L+FGGKKQ PA+
Sbjct  481  LRLVFGGKKQQPAK  494



>ref|XP_010491342.1| PREDICTED: calnexin homolog 2-like [Camelina sativa]
Length=532

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 89/103 (86%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGI+FDNILIA DEKVAE+YRQT WKPKFDVEKEKQK+E+    +
Sbjct  362  FEPIAAIGIEIWTMQDGIIFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKSEDEAAGE  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            ++GLK YQK VFD LYK+AD+ FL  +K KI++L+EKAE QPN
Sbjct  422  ANGLKSYQKKVFDLLYKVADISFLSAYKSKIMELIEKAETQPN  464



>ref|XP_010423220.1| PREDICTED: calnexin homolog 2 [Camelina sativa]
Length=533

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPIAA+GIEIWTMQDGI+FDNILIA +EKVAE+YRQT WKPK DVEKEKQKAE+    D
Sbjct  362  FEPIAAIGIEIWTMQDGIIFDNILIAKEEKVAETYRQTTWKPKSDVEKEKQKAEDEAAGD  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQK VFD LYK+AD+ FL  +K KI++L+EKAE QPN
Sbjct  422  ADGLKSYQKKVFDLLYKVADISFLSAYKSKIMELIEKAETQPN  464



>ref|NP_196351.1| calnexin2 [Arabidopsis thaliana]
 sp|Q38798.2|CALX2_ARATH RecName: Full=Calnexin homolog 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB87923.1| calnexin homolog [Arabidopsis thaliana]
 gb|AAN72010.1| calnexin homolog [Arabidopsis thaliana]
 gb|AAQ56828.1| At5g07340 [Arabidopsis thaliana]
 gb|AED91138.1| calnexin2 [Arabidopsis thaliana]
Length=532

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
             EPIAA+GIEIWTMQDGILFDNILI+ DEKVAE+YRQ+ WKPKFDVEKEKQKAE+    +
Sbjct  364  LEPIAAIGIEIWTMQDGILFDNILISKDEKVAETYRQSTWKPKFDVEKEKQKAEDEAAGE  423

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQK VFD LYK+AD+ FL  +K KI++L+EKAE QPN
Sbjct  424  ADGLKSYQKKVFDLLYKVADISFLSAYKSKIMELIEKAETQPN  466



>ref|NP_001190249.1| calnexin2 [Arabidopsis thaliana]
 gb|AED91139.1| calnexin2 [Arabidopsis thaliana]
Length=540

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
             EPIAA+GIEIWTMQDGILFDNILI+ DEKVAE+YRQ+ WKPKFDVEKEKQKAE+    +
Sbjct  372  LEPIAAIGIEIWTMQDGILFDNILISKDEKVAETYRQSTWKPKFDVEKEKQKAEDEAAGE  431

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQK VFD LYK+AD+ FL  +K KI++L+EKAE QPN
Sbjct  432  ADGLKSYQKKVFDLLYKVADISFLSAYKSKIMELIEKAETQPN  474



>ref|XP_008245696.1| PREDICTED: calnexin homolog 1-like [Prunus mume]
Length=541

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEP+AAVGIEIWTMQDGILFDNILI  DEKVAE+YR+T WKPKF+VEKEKQK EE V  S
Sbjct  363  FEPVAAVGIEIWTMQDGILFDNILITKDEKVAETYRETTWKPKFEVEKEKQKDEEDVQGS  422

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +G L  +QK VFD LY +AD+PFL  HK KI+DL+EKAE+QPN+T+G+IVS+ V++ T+ 
Sbjct  423  EGFLSSFQKKVFDLLYAVADIPFLSAHKSKIIDLIEKAEQQPNLTVGIIVSIAVIIFTVF  482

Query  331  vklLFGGKKQIPAR  290
            +KLLFGGKK  PAR
Sbjct  483  IKLLFGGKK--PAR  494



>gb|KJB38815.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
 gb|KJB38822.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=532

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
              L G+Q+ VFD LYK+AD+PFL ++K +ILDL+E AE QPN+TIGV+VS++V++LTI  
Sbjct  422  ARLAGFQRKVFDVLYKVADIPFLSKYKHQILDLIEHAETQPNLTIGVLVSIVVIILTIFF  481

Query  328  klLFGGKKQ  302
            KL+FGGKKQ
Sbjct  482  KLIFGGKKQ  490



>gb|KJB38819.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=531

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  361  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  420

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
              L G+Q+ VFD LYK+AD+PFL ++K +ILDL+E AE QPN+TIGV+VS++V++LTI  
Sbjct  421  ARLAGFQRKVFDVLYKVADIPFLSKYKHQILDLIEHAETQPNLTIGVLVSIVVIILTIFF  480

Query  328  klLFGGKKQ  302
            KL+FGGKKQ
Sbjct  481  KLIFGGKKQ  489



>ref|XP_011082819.1| PREDICTED: calnexin homolog 1 [Sesamum indicum]
Length=536

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
             EPIAA+GIEIWTMQDGILFDNILIA+ EKVAESYRQTAWKPKF+VEKEKQK EE  +SD
Sbjct  365  IEPIAALGIEIWTMQDGILFDNILIASSEKVAESYRQTAWKPKFEVEKEKQKEEEAKESD  424

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GLKG QKVVFD LYK+ADLPFLGEHK K+LDL+EKAEKQPN+TIG++VSV+VV+ +I  K
Sbjct  425  GLKGVQKVVFDYLYKVADLPFLGEHKAKVLDLIEKAEKQPNLTIGILVSVVVVIFSIFFK  484

Query  325  lLFGGKK  305
            L+FGGKK
Sbjct  485  LIFGGKK  491



>gb|KDO57648.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=537

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK KAEE    S
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGS  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+Q  VFD LYK+AD+PFL  +K KI+D++EK EKQPN+TIG++VSV+ V++T+L 
Sbjct  425  DGLAGFQ-TVFDLLYKVADIPFLDAYKLKIIDVIEKGEKQPNLTIGILVSVVAVIITVLF  483

Query  328  klLFGGKK  305
            K++FGGKK
Sbjct  484  KIIFGGKK  491



>ref|XP_008440191.1| PREDICTED: calnexin homolog [Cucumis melo]
Length=539

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            F+P+AA+GIEIWTMQDGILFDNILIA DEK+A SYR   WKPKF+VEKEKQKAEE     
Sbjct  361  FDPVAAIGIEIWTMQDGILFDNILIAKDEKLATSYRDEKWKPKFEVEKEKQKAEEAAAGG  420

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
             DGL  YQK VFD LYKIAD+ FL +++ KI+D++EK EKQPN+TIG+IVS++VV+ TIL
Sbjct  421  PDGLAEYQKKVFDVLYKIADISFLSQYRSKIIDVIEKGEKQPNLTIGIIVSIVVVIFTIL  480

Query  331  vklLFGGKKQIPAR  290
            ++L+FGGKKQ PA+
Sbjct  481  LRLVFGGKKQQPAK  494



>ref|XP_009404191.1| PREDICTED: calnexin homolog [Musa acuminata subsp. malaccensis]
Length=539

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            FEPIAA+GIEIWTMQDGILFDNILI  DEKVAESYR   WKPK++VEKEKQKAE+     
Sbjct  360  FEPIAAIGIEIWTMQDGILFDNILITGDEKVAESYRSETWKPKYEVEKEKQKAEDAAAES  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SDGL G+QK VFD LYKIAD+PFL  +K KI+D++EKAEKQPN
Sbjct  420  SDGLSGFQKKVFDVLYKIADVPFLEPYKIKIIDVIEKAEKQPN  462



>ref|XP_007209878.1| hypothetical protein PRUPE_ppa003899mg [Prunus persica]
 gb|EMJ11077.1| hypothetical protein PRUPE_ppa003899mg [Prunus persica]
Length=541

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEP+AAVGIEIWTMQDGILFDNILI  DEKVAE+YR+T WKPKF+VEKEKQK EE V  S
Sbjct  363  FEPVAAVGIEIWTMQDGILFDNILITKDEKVAETYRETTWKPKFEVEKEKQKDEEDVQGS  422

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +G L  +QK VFD LY +AD+PFL  HK KI+DL+EKAE+QPN+T+G+IVS+ V++ T+ 
Sbjct  423  EGFLSSFQKKVFDLLYTVADIPFLSAHKSKIIDLIEKAEQQPNLTVGIIVSIAVIIFTVF  482

Query  331  vklLFGGKK  305
            +KLLFGGKK
Sbjct  483  IKLLFGGKK  491



>ref|XP_006368843.1| hypothetical protein POPTR_0001s12690g [Populus trichocarpa]
 gb|ERP65412.1| hypothetical protein POPTR_0001s12690g [Populus trichocarpa]
Length=479

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIW+MQDGILFDNILIA+DEKVA++YR+T WKPKF+VEKEK KAEE T   
Sbjct  299  FEPIAAIGIEIWSMQDGILFDNILIASDEKVADTYRETTWKPKFEVEKEKLKAEEATAGH  358

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            G+  ++K +F+ LYKI D+PFLG +K KI+DL+E+ EKQPN
Sbjct  359  GISSFKKKIFNLLYKIGDIPFLGAYKPKIIDLIEQGEKQPN  399



>gb|KJB38818.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=515

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
              L G+Q+ VFD LYK+AD+PFL ++K +ILDL+E AE QPN
Sbjct  422  ARLAGFQRKVFDVLYKVADIPFLSKYKHQILDLIEHAETQPN  463



>gb|KHG01556.1| Calnexin [Gossypium arboreum]
Length=532

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
              L  +Q+ VFD LYK+AD+PFL ++K +ILDL+E AE QPN+TIGV+VS++V++LTI  
Sbjct  422  ARLADFQRKVFDVLYKVADIPFLSKYKHQILDLIEHAETQPNLTIGVLVSIVVIILTIFF  481

Query  328  klLFGGKKQ  302
            KL+FGGKKQ
Sbjct  482  KLIFGGKKQ  490



>ref|XP_009390827.1| PREDICTED: calnexin homolog 1-like [Musa acuminata subsp. malaccensis]
Length=538

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 3/104 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE---VT  515
            FEPIAA+GIEIWTMQDGILFDNILI+T+EKVAESYR   WKPK+++EKEKQKAE+    +
Sbjct  360  FEPIAAIGIEIWTMQDGILFDNILISTNEKVAESYRADTWKPKYEIEKEKQKAEDAAAAS  419

Query  514  DSDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
             SDGL G+QK VFD LYKIAD+PFL  +K KI+D++EKAEKQPN
Sbjct  420  SSDGLSGFQKQVFDVLYKIADIPFLEAYKIKIIDVIEKAEKQPN  463



>ref|XP_011003527.1| PREDICTED: calnexin homolog [Populus euphratica]
Length=539

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNIL+A DEK A S R T WKPKFD EKEKQKAEE  T +
Sbjct  363  FEPIAAVGIEIWTMQDGILFDNILVAKDEKAAASIRDTTWKPKFDAEKEKQKAEEAATGT  422

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VF+ LY+ A+L FL +HK KI++L+EKAEKQPNITIGV+VSV+VV+LT+  
Sbjct  423  DGLAGFQKKVFELLYQAAELSFLSKHKDKIIELIEKAEKQPNITIGVLVSVVVVILTLFC  482

Query  328  klLFGGKK  305
            +++FGGKK
Sbjct  483  RIIFGGKK  490



>ref|XP_003525166.1| PREDICTED: calnexin homolog [Glycine max]
Length=541

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF VEKEKQK E+    S
Sbjct  368  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFTVEKEKQKEEDSEAGS  427

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL G+QK VFD LYKIAD+PFL  +K KI D++EK ++QPN+T+G++V+V+VV++++ +
Sbjct  428  SGLAGFQKKVFDLLYKIADIPFLSAYKLKIYDVIEKGQEQPNLTVGIVVAVVVVIVSVFL  487

Query  328  klLFGGKKQIPAR  290
            +L+FGGKK+ P R
Sbjct  488  RLIFGGKKK-PTR  499



>gb|KHN17447.1| Calnexin like [Glycine soja]
Length=542

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF VEKEKQK E+    S
Sbjct  369  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFTVEKEKQKEEDSEAGS  428

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL G+QK VFD LYKIAD+PFL  +K KI D++EK ++QPN+T+G++V+V+VV++++ +
Sbjct  429  SGLAGFQKKVFDLLYKIADIPFLSAYKLKIYDVIEKGQEQPNLTVGIVVAVVVVIVSVFL  488

Query  328  klLFGGKKQIPAR  290
            +L+FGGKK+ P R
Sbjct  489  RLIFGGKKK-PTR  500



>ref|XP_006399217.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
 gb|ESQ40670.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
Length=531

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 87/103 (84%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK--AEEVTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQK   E   +
Sbjct  362  FEPIAAIGIEIWTMQDGILFDNVLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEDEAAAE  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQK VFD LYK+AD+ FL  +K KI++L+EKAE QPN
Sbjct  422  ADGLKSYQKKVFDLLYKVADISFLSAYKSKIMELIEKAETQPN  464



>ref|XP_002318189.1| Calnexin precursor family protein [Populus trichocarpa]
 gb|ABK95759.1| unknown [Populus trichocarpa]
 gb|EEE96409.1| Calnexin precursor family protein [Populus trichocarpa]
Length=538

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNIL+A DEK A S R T WKPKFD EKEKQKAEE  T +
Sbjct  363  FEPIAAVGIEIWTMQDGILFDNILVAKDEKAAASIRDTTWKPKFDAEKEKQKAEEAATGT  422

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VF+ LY+ A+L FL +HK KI++L+EKAEKQPNITIGV+VSV+VV+LT+  
Sbjct  423  DGLAGFQKKVFELLYQAAELSFLSKHKDKIIELIEKAEKQPNITIGVLVSVVVVILTLFF  482

Query  328  klLFGGKK  305
            +++FGGKK
Sbjct  483  RIIFGGKK  490



>gb|AAA17742.1| calnexin homolog [Arabidopsis thaliana]
Length=528

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 87/103 (84%), Gaps = 4/103 (4%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
             EPIAA+GIEIWTMQDGILFDNILI+ DEKVAE+YRQ+ WKPKFDVEKEKQKAE+    +
Sbjct  364  LEPIAAIGIEIWTMQDGILFDNILISKDEKVAETYRQSTWKPKFDVEKEKQKAEDEAAGE  423

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQ  VFD LYK+AD+ FL  +K KI++L+EKAE QPN
Sbjct  424  ADGLKSYQ--VFDLLYKVADISFLSAYKSKIMELIEKAETQPN  464



>ref|XP_002273708.1| PREDICTED: calnexin homolog [Vitis vinifera]
 emb|CBI29286.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPI A+GIEIWTMQDG+LFDNILIA DEKVAE+YR T WK KF+VEKEKQKAEE     
Sbjct  360  FEPITAIGIEIWTMQDGVLFDNILIANDEKVAEAYRDTTWKLKFEVEKEKQKAEEAASGL  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G QK VFD LYKI  LPFL  +K +I DL+EK EKQPN+TIG++VS++VV+L++ 
Sbjct  420  SDGLSGLQKAVFDILYKIGGLPFLSAYKVQIFDLIEKGEKQPNLTIGILVSIVVVILSVF  479

Query  331  vklLFGGKK  305
             K+LFGGKK
Sbjct  480  FKILFGGKK  488



>ref|XP_010929516.1| PREDICTED: calnexin homolog [Elaeis guineensis]
Length=539

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 119/137 (87%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIA++GIEIWTMQDGILFDNILIA+DEK+AESYR+ +WKPK++VEKEKQKAEE     
Sbjct  360  FEPIASIGIEIWTMQDGILFDNILIASDEKLAESYREKSWKPKYEVEKEKQKAEEAAAGI  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G+QK VFD LYKIAD+PFLG +K KI+D++EK EKQPN+TIGV+VSV+VV+ T++
Sbjct  420  SDGLSGFQKKVFDGLYKIADIPFLGAYKIKIIDIIEKGEKQPNLTIGVLVSVVVVIATVI  479

Query  331  vklLFGGKK-QIPARPV  284
             K+LFGGKK   PARP 
Sbjct  480  TKILFGGKKPAAPARPT  496



>ref|XP_003532294.1| PREDICTED: calnexin homolog [Glycine max]
 gb|KHN16898.1| Calnexin like [Glycine soja]
Length=538

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            FEPIAA+GIEIWTMQDGILFDNILI+ D+K+AESYR+T WKPKF VEKEKQK E+    S
Sbjct  365  FEPIAAIGIEIWTMQDGILFDNILISKDDKIAESYRETRWKPKFTVEKEKQKEEDSEAGS  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL G+QK VFD LYKIAD+PFL  +K KI D++EK ++QPN+T+G++V+V+VV+L+I +
Sbjct  425  SGLAGFQKKVFDLLYKIADIPFLSAYKLKIYDVIEKGQEQPNLTVGIVVAVVVVILSIFL  484

Query  328  klLFGGKKQIPAR  290
            +L+FGGKK+ P R
Sbjct  485  RLIFGGKKK-PTR  496



>gb|AEZ00867.1| putative calnexin-like protein, partial [Elaeis guineensis]
Length=253

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 91/103 (88%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIA++GIEIWTMQDGILFDNILIA+DEK+AESYR+ +WKPK++VEKEKQKAEE     
Sbjct  134  FEPIASIGIEIWTMQDGILFDNILIASDEKLAESYREKSWKPKYEVEKEKQKAEEAAAGI  193

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SDGL G+QK VFD LYKIAD+PFLG +K KI+D++EK EKQPN
Sbjct  194  SDGLSGFQKKVFDGLYKIADIPFLGPYKIKIIDIIEKGEKQPN  236



>ref|XP_009359843.1| PREDICTED: calnexin homolog 1-like [Pyrus x bretschneideri]
Length=549

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA--EEVTD  512
            FEPIAA+GIEIWTMQDGILFDNILIA +EKVAES R T WKPKF+ EKEKQKA  E    
Sbjct  371  FEPIAAIGIEIWTMQDGILFDNILIADNEKVAESVRLTTWKPKFETEKEKQKAGEEAAGL  430

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL  YQK VFD LYKIAD+ FL  +K KI+DL+EK EKQPN+TIGVIVSV+VV+L++ 
Sbjct  431  SDGLSSYQKKVFDLLYKIADVSFLDAYKPKIIDLIEKGEKQPNMTIGVIVSVVVVLLSVF  490

Query  331  vklLFGGKKQIPARP  287
             KL FGGKK +   P
Sbjct  491  FKLFFGGKKPVVTVP  505



>ref|XP_010546112.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=526

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA--EEVTD  512
            FE IAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKE QK   E  T 
Sbjct  362  FEQIAAIGIEIWTMQDGILFDNLLIAKDEKVAETYRQTTWKPKFDVEKEMQKGDDEAATG  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+ LK YQK +FD LYK+AD+ +L  HK KI++L+EKAE+QPNIT+ V++SV+VV+L++ 
Sbjct  422  SNVLKSYQKGLFDLLYKVADIRYLSAHKDKIIELIEKAEQQPNITVSVLISVVVVILSLF  481

Query  331  vklLFGGKK  305
             KL+FGGKK
Sbjct  482  FKLIFGGKK  490



>ref|XP_002277666.1| PREDICTED: calnexin homolog [Vitis vinifera]
Length=539

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDS-  509
             EP+AA+GIEIWTMQDGILFDNILI +DEK AESYR+T WKPKF+VEKEKQKAE+     
Sbjct  364  IEPVAAIGIEIWTMQDGILFDNILITSDEKTAESYRETTWKPKFEVEKEKQKAEDAAAGF  423

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D   G+QK VFD LYKIAD+ FL  +K K+LDL+EK EKQPN+TIG++VS+++V LTI+ 
Sbjct  424  DVPSGFQKKVFDLLYKIADISFLNAYKPKLLDLIEKGEKQPNLTIGILVSIVIVFLTIIF  483

Query  328  klLFGGKKQI  299
            K++FGGKK +
Sbjct  484  KIIFGGKKPV  493



>ref|XP_010910131.1| PREDICTED: calnexin homolog [Elaeis guineensis]
Length=523

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 110/140 (79%), Gaps = 7/140 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIA++GIEIWTMQDGILFDNILIA DEKVAE YR+  WKPK++ E+ KQKAEE     
Sbjct  337  FEPIASIGIEIWTMQDGILFDNILIAVDEKVAELYREKMWKPKYEAEQSKQKAEEAASGF  396

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G++K +FD LYK+AD+PF    + KI+D++EK EKQPN+TIG++ +++VVV T++
Sbjct  397  SDGLAGFEKKLFDVLYKVADVPFFAPCRSKIIDVIEKGEKQPNLTIGILAAIVVVVATVI  456

Query  331  vklLFGGKK-----QIPARP  287
             ++LFGGKK       P+RP
Sbjct  457  FRILFGGKKPAAPPMTPSRP  476



>gb|AAK94424.1|AF398143_1 calnexin-like protein 1 [Brassica rapa subsp. pekinensis]
Length=136

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 2/102 (2%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTDS  509
             P AA GIEIWTMQDGILFDNILIA DEKVAESYRQT WKPKFDV  EK+K++ +    +
Sbjct  1    NPFAATGIEIWTMQDGILFDNILIAKDEKVAESYRQTTWKPKFDVEKEKQKEEEKAAESA  60

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN
Sbjct  61   DGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPN  102



>emb|CAN83091.1| hypothetical protein VITISV_041895 [Vitis vinifera]
Length=539

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDS-  509
             EP+AA+GIEIWTMQDGILFDNILI +DEK AESYR+T WKPKF+VEKEKQKAE+     
Sbjct  364  IEPVAAIGIEIWTMQDGILFDNILITSDEKTAESYRETTWKPKFEVEKEKQKAEDAAAGF  423

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D   G+QK VFD LYKIAD+ FL  +K K+LDL+EK EKQPN+TIG++VS+++V LTI+ 
Sbjct  424  DVPSGFQKKVFDLLYKIADISFLNAYKPKLLDLIEKGEKQPNLTIGILVSIVIVFLTIIF  483

Query  328  klLFGGKK  305
            K++FGGKK
Sbjct  484  KIIFGGKK  491



>ref|XP_002321768.1| Calnexin precursor family protein [Populus trichocarpa]
 gb|EEF05895.1| Calnexin precursor family protein [Populus trichocarpa]
Length=533

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 1/101 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA DEKVA S R T WKPKFDVEKEK+KA E    +
Sbjct  364  FEPIAAVGIEIWTMQDGILFDNILIAQDEKVASSIRDTTWKPKFDVEKEKEKATEAAAGT  423

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQP  386
            D L G+QK VF+ LY++A++ FL EHK KI++L+EKAEKQP
Sbjct  424  DALGGFQKKVFEILYQVAEISFLSEHKDKIIELIEKAEKQP  464



>ref|XP_010942328.1| PREDICTED: calnexin homolog [Elaeis guineensis]
Length=537

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            FEPIAA+GIEIWTMQDGILFDNILIA+DEKVAESYR+  WKPK++VEKEKQKA+E    S
Sbjct  360  FEPIAAIGIEIWTMQDGILFDNILIASDEKVAESYREETWKPKYEVEKEKQKADEAAGIS  419

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL G+QK VFD LYKIAD+PFL  +K KI+D++EK EKQPN+TIG++VS++VV+ T++ 
Sbjct  420  DGLSGFQKKVFDVLYKIADIPFLEAYKIKIIDIIEKGEKQPNLTIGILVSIVVVIATVIF  479

Query  328  klLFGGKKQIPARPV  284
             +LFGGKK  PA PV
Sbjct  480  MILFGGKK--PAAPV  492



>emb|CDX87226.1| BnaC09g05410D [Brassica napus]
Length=533

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAESYRQT WKPKFDV  EK+K++ +    
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAESYRQTTWKPKFDVEKEKQKEEEKAAES  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN+TIGV+VS++VV  ++ 
Sbjct  423  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPNLTIGVLVSIVVVFFSLF  482

Query  331  vklLFGGKKQIPARPV  284
            +KL+FGGKK  PA  V
Sbjct  483  IKLIFGGKKAAPAASV  498



>gb|AAK84429.1| putative papillar cell-specific calnexin [Brassica napus]
Length=533

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAESYRQT WKPKFDV  EK+K++ +    
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAESYRQTTWKPKFDVEKEKQKEEEKAAES  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN+TIGV+VS+++V  ++ 
Sbjct  422  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPNLTIGVLVSIVIVFFSLF  481

Query  331  vklLFGGKKQIPARPV  284
            +KL+FGGKK  PA  V
Sbjct  482  IKLIFGGKKASPAASV  497



>ref|XP_009130175.1| PREDICTED: calnexin homolog 1-like [Brassica rapa]
Length=535

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            +EPIAA+GIEIWTMQDGILFDN+LIA DEKVAESYRQT WKPKFDV  EK+K + E  + 
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNMLIAKDEKVAESYRQTTWKPKFDVEKEKQKAEEEAASS  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN+TIGV+VS++VV  ++ 
Sbjct  423  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPNLTIGVLVSIVVVFFSLF  482

Query  331  vklLFGGKKQIPARPV  284
            +KL+FGGKK  PA  V
Sbjct  483  IKLIFGGKKAAPAATV  498



>ref|XP_002866455.1| hypothetical protein ARALYDRAFT_496347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42714.1| hypothetical protein ARALYDRAFT_496347 [Arabidopsis lyrata subsp. 
lyrata]
Length=1401

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  685   FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
             +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  1234  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  1293

Query  511   SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
             +DGLK YQKVVFD L K+ADL FL  +K KI +L+EKAE+QPN+TIGV+VS++VV  ++ 
Sbjct  1294  ADGLKSYQKVVFDLLNKVADLSFLSAYKSKITELIEKAEQQPNLTIGVLVSIVVVFFSLF  1353

Query  331   vklLFGGKKQIP  296
             +KL+FGGKK  P
Sbjct  1354  LKLIFGGKKAAP  1365



>emb|CDY72297.1| BnaAnng40540D, partial [Brassica napus]
Length=456

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA DEKVAESYRQT WKPKFDV  EK+K + E  + 
Sbjct  321  FEPIAAIGIEIWTMQDGILFDNMLIAKDEKVAESYRQTTWKPKFDVEKEKQKAEEEAASS  380

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN+TIGV+VS++VV  ++ 
Sbjct  381  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPNLTIGVLVSIVVVFFSLF  440

Query  331  vklLFGGKKQI  299
            +KL+FGGKK I
Sbjct  441  IKLIFGGKKVI  451



>ref|XP_011040303.1| PREDICTED: calnexin homolog [Populus euphratica]
Length=533

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAAVGIEIWTMQDGILFDNILIA DEKVA S R T WKPKFDVEKEK+KA E     
Sbjct  364  FEPIAAVGIEIWTMQDGILFDNILIAQDEKVASSIRDTTWKPKFDVEKEKEKATEAAVGT  423

Query  505  G-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQP  386
            G L G+QK VF+ LY++A++ FL EHK KI +L+EKAEKQP
Sbjct  424  GALGGFQKKVFEILYQVAEISFLSEHKDKITELIEKAEKQP  464



>ref|XP_002866454.1| calnexin 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42713.1| calnexin 1 [Arabidopsis lyrata subsp. lyrata]
Length=529

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+ADL FL  +K KI +L+EKAE+QPN+TIGV+VS++VV  ++ 
Sbjct  422  ADGLKSYQKVVFDLLNKVADLSFLSAYKSKITELIEKAEQQPNLTIGVLVSIVVVFFSLF  481

Query  331  vklLFGGKKQIP  296
            +KL+FGGKK  P
Sbjct  482  LKLIFGGKKAAP  493



>emb|CDY42878.1| BnaAnng07030D [Brassica napus]
Length=535

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNMLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN+TIGV+VS++VV  ++ 
Sbjct  423  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPNLTIGVLVSIVVVFFSLF  482

Query  331  vklLFGGKKQIPARPV  284
            +KL+FGGKK  PA  V
Sbjct  483  IKLIFGGKKAAPAATV  498



>ref|XP_004503036.1| PREDICTED: calnexin homolog [Cicer arietinum]
Length=545

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 3/104 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF +  EK+K + E  T+
Sbjct  371  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFAIEQEKQKAEEEAATE  430

Query  511  SD-GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SD G+ G+QK VFD LYKIAD+PFL  HK KIL+L+EKAEKQPN
Sbjct  431  SDGGIAGFQKKVFDVLYKIADIPFLSGHKDKILELIEKAEKQPN  474



>ref|XP_008778288.1| PREDICTED: calnexin homolog, partial [Phoenix dactylifera]
Length=542

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIA++GIEIWTMQDGILFDNILIA DEKVAESYR+  WKPK++ E+ KQKAEE     
Sbjct  366  FEPIASIGIEIWTMQDGILFDNILIAVDEKVAESYREKMWKPKYEAEQSKQKAEEAVSGF  425

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SD L  +QK VFD LYK+AD+P    ++ KI+ ++EK EKQPN
Sbjct  426  SDALASFQKKVFDVLYKVADIPVFAPYRSKIIGVIEKGEKQPN  468



>gb|KDP22513.1| hypothetical protein JCGZ_26344 [Jatropha curcas]
Length=538

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            FEPIAAVGIEIWTMQDGILF +ILI  DEKVAES R+TAWKPKFDVE+EKQKAEE    +
Sbjct  365  FEPIAAVGIEIWTMQDGILFGHILITDDEKVAESLRKTAWKPKFDVEEEKQKAEEAAAGT  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            DGL G+QK VFD LYKIAD+PFL  HK KILD++EKAEKQPN
Sbjct  425  DGLAGFQKKVFDLLYKIADIPFLSGHKDKILDVIEKAEKQPN  466



>ref|XP_008797088.1| PREDICTED: calnexin homolog [Phoenix dactylifera]
Length=535

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 117/135 (87%), Gaps = 2/135 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIA++GIEIWTMQ+GILFDNILIA+DE+VAESYR+  WKPK++VEKEKQKAEE   +D
Sbjct  360  FEPIASIGIEIWTMQEGILFDNILIASDEEVAESYREKTWKPKYEVEKEKQKAEEAA-AD  418

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            G  G+QK VFD LYKIAD+PFLG +K KI+D++EK EKQPN+TIG++VSV+VV+ T+++K
Sbjct  419  GPSGFQKKVFDGLYKIADIPFLGAYKIKIIDIIEKGEKQPNLTIGILVSVMVVIATVIMK  478

Query  325  lLFGGKK-QIPARPV  284
            +L GGKK   PA+P 
Sbjct  479  ILLGGKKPAAPAKPT  493



>gb|KJB51311.1| hypothetical protein B456_008G211600 [Gossypium raimondii]
Length=509

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA-EEVTDS  509
            FEPIAA+GIEIWTMQ+GILFDNILIA +EKVA+SYR+T WKPKF+VEKE+Q+A EE +  
Sbjct  335  FEPIAAIGIEIWTMQEGILFDNILIAKNEKVAKSYRETKWKPKFEVEKERQQAEEEASGL  394

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L   ++ VF+ LY+IAD+PFL  +K +ILD ++KAEKQPN+T+GV+VS + ++LTI +
Sbjct  395  DFLASIKRKVFNALYQIADIPFLSNYKPQILDHIKKAEKQPNLTMGVLVSTVAIILTIFL  454

Query  328  klLFGGKKQIPAR  290
            KL+FGGK Q   R
Sbjct  455  KLIFGGKNQQCPR  467



>ref|NP_200987.1| calnexin 1 [Arabidopsis thaliana]
 sp|P29402.1|CALX1_ARATH RecName: Full=Calnexin homolog 1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA79144.1| calnexin homolog [Arabidopsis thaliana]
 dbj|BAB10079.1| calnexin homolog precursor [Arabidopsis thaliana]
 gb|AAL24362.1| calnexin homolog precursor [Arabidopsis thaliana]
 gb|AAM47988.1| calnexin-like protein precursor [Arabidopsis thaliana]
 gb|AAM63911.1| calnexin-like protein [Arabidopsis thaliana]
 gb|AED97518.1| calnexin 1 [Arabidopsis thaliana]
Length=530

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+ADL FL  +K KI +L+EKAE+QPN+TIGV+V+++VV  ++ 
Sbjct  422  ADGLKSYQKVVFDLLNKVADLSFLSAYKSKITELIEKAEQQPNLTIGVLVAIVVVFFSLF  481

Query  331  vklLFGGKKQIPARPV  284
            +KL+FGGKK   A PV
Sbjct  482  LKLIFGGKKA--AAPV  495



>gb|KJB51312.1| hypothetical protein B456_008G211600 [Gossypium raimondii]
Length=539

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA-EEVTDS  509
            FEPIAA+GIEIWTMQ+GILFDNILIA +EKVA+SYR+T WKPKF+VEKE+Q+A EE +  
Sbjct  365  FEPIAAIGIEIWTMQEGILFDNILIAKNEKVAKSYRETKWKPKFEVEKERQQAEEEASGL  424

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L   ++ VF+ LY+IAD+PFL  +K +ILD ++KAEKQPN+T+GV+VS + ++LTI +
Sbjct  425  DFLASIKRKVFNALYQIADIPFLSNYKPQILDHIKKAEKQPNLTMGVLVSTVAIILTIFL  484

Query  328  klLFGGKKQIPAR  290
            KL+FGGK Q   R
Sbjct  485  KLIFGGKNQQCPR  497



>ref|XP_009112002.1| PREDICTED: calnexin homolog 1-like [Brassica rapa]
Length=535

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAESYRQT WKPKFDV  EK+K++ +    
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAESYRQTTWKPKFDVEKEKQKEEEKAAES  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN
Sbjct  423  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPN  465



>ref|XP_008807839.1| PREDICTED: calnexin homolog [Phoenix dactylifera]
Length=538

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 115/137 (84%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIAA+GIEIWTMQDG+LFDNILIATDEKVAESYR+  WKPK++VEKEKQKAEE     
Sbjct  360  FEPIAAIGIEIWTMQDGVLFDNILIATDEKVAESYREKTWKPKYEVEKEKQKAEEAAAPL  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGL G+QK VFD LYKIAD+PFL  +K KI+ ++EK E+QPN+TIG++VSV+VV+ T++
Sbjct  420  ADGLSGFQKKVFDVLYKIADIPFLQAYKIKIIGIIEKGEQQPNLTIGILVSVVVVIATVI  479

Query  331  vklLFGGKKQ-IPARPV  284
             ++LFGGKK   P +P 
Sbjct  480  FRILFGGKKSAAPPKPT  496



>emb|CDY16801.1| BnaA09g05810D [Brassica napus]
Length=533

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 110/136 (81%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAESYRQT WKPKFDV  EK+K++ +    
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAESYRQTTWKPKFDVEKEKQKEEEKAAES  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQKVVFD L K+AD+ FL  +K K  +L+EKAE+QPN+TIGV+VS+++V  ++ 
Sbjct  422  ADGLKSYQKVVFDLLNKVADISFLSAYKSKTTELIEKAEEQPNLTIGVLVSIVIVFFSLF  481

Query  331  vklLFGGKKQIPARPV  284
            +KL+FGGKK   A  V
Sbjct  482  IKLIFGGKKASAAASV  497



>gb|KHG01051.1| Calnexin [Gossypium arboreum]
Length=538

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA-EEVTDS  509
            FEPIAA+GIEIWTMQ+GILFDNI+IA +EKVA+SYR+T WKPKF++EKE+Q+A EE +  
Sbjct  364  FEPIAAIGIEIWTMQEGILFDNIVIAKNEKVAKSYRETKWKPKFEIEKERQQAEEEASGL  423

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L   ++ VF+ LY+IAD+PFL  +K +ILD ++KAEKQPN+T+GV+VS + ++LTI +
Sbjct  424  DFLASIKRKVFNALYQIADIPFLSNYKPQILDHIKKAEKQPNLTMGVLVSTVAIILTIFL  483

Query  328  klLFGGKKQIPAR  290
            KL+FGGK Q   R
Sbjct  484  KLIFGGKNQQCPR  496



>ref|XP_010452695.1| PREDICTED: calnexin homolog 2-like [Camelina sativa]
Length=457

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 1/91 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAA+GIEIWTMQDGI+FDNILIA DEKVAE+YRQT WKPK DVEKEKQKAE E    
Sbjct  362  FEPIAAIGIEIWTMQDGIIFDNILIAKDEKVAETYRQTTWKPKSDVEKEKQKAEAEAAGE  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKIL  416
            +GLK YQK VFD LYK+AD+ FL  +K KI+
Sbjct  422  NGLKSYQKKVFDLLYKVADISFLSAYKSKIM  452



>emb|CDX86955.1| BnaC03g52250D [Brassica napus]
Length=531

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNMLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQKVVFD L K+AD+ FL  +K KI +L+EKAE+QPN
Sbjct  423  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITELIEKAEEQPN  465



>ref|XP_007159941.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
 gb|ESW31935.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
Length=548

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF V ++++++ E    S
Sbjct  368  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFSVEKEKQKEEENEAGS  427

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             G+ G+QK VFD LYKIAD+PFL  +K KI DL+EK ++QPN+T+G++V+++V+ ++I  
Sbjct  428  SGIAGFQKKVFDILYKIADIPFLSAYKPKIHDLIEKGQEQPNLTVGILVAILVIFVSIFF  487

Query  328  klLFGGKKQ  302
            +++FGGKKQ
Sbjct  488  RIIFGGKKQ  496



>ref|XP_010457723.1| PREDICTED: calnexin homolog 1-like [Camelina sativa]
Length=531

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQK VFD L K+ADL FL  +K KI +L+EKAE++PN+TIGV+VSV+VV  ++ 
Sbjct  422  ADGLKSYQKFVFDLLNKVADLSFLSAYKSKITELIEKAEEKPNLTIGVLVSVVVVFFSLF  481

Query  331  vklLFGGKKQIPA  293
            VKL+FGGKK   A
Sbjct  482  VKLIFGGKKAAAA  494



>gb|AGV54271.1| calnexin-like protein [Phaseolus vulgaris]
Length=546

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF V ++++++ E    S
Sbjct  366  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFSVEKEKQKEEENEAGS  425

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             G+ G+QK VFD LYKIAD+PFL  +K KI DL+EK ++QPN+T+G++V+++V+ ++I  
Sbjct  426  SGIAGFQKKVFDILYKIADIPFLSAYKPKIHDLIEKGQEQPNLTVGILVAILVIFVSIFF  485

Query  328  klLFGGKKQ  302
            +++FGGKKQ
Sbjct  486  RIIFGGKKQ  494



>gb|KJB38816.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=457

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 79/91 (87%), Gaps = 1/91 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKIL  416
              L G+Q+ VFD LYK+AD+PFL ++K +IL
Sbjct  422  ARLAGFQRKVFDVLYKVADIPFLSKYKHQIL  452



>ref|XP_009150122.1| PREDICTED: calnexin homolog 1 [Brassica rapa]
Length=531

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNMLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  422

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQKVVFD L K+AD+ FL  +K KI +++EKAE+QPN
Sbjct  423  ADGLKSYQKVVFDLLNKVADISFLSAYKSKITEVIEKAEEQPN  465



>ref|XP_010523385.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=531

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDG+LFDNILIA DEKVAE+YRQT WKPKFDV  EK+K + E+   
Sbjct  362  FEPIAAIGIEIWTMQDGVLFDNILIAKDEKVAETYRQTGWKPKFDVEKEKQKAEEEDAGG  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
              GLK YQK VFD LY++A++P LG+HK KI++ + KAE+QPN
Sbjct  422  LHGLKSYQKKVFDLLYRVAEIPSLGDHKDKIIEFIAKAEQQPN  464



>ref|XP_010483861.1| PREDICTED: calnexin homolog 1 [Camelina sativa]
Length=530

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGLK YQK VFD L K+ADL FL  +K KI +L+E+AE++PN+TIGV+VS++VV+ ++ 
Sbjct  422  ADGLKSYQKFVFDLLNKVADLSFLSAYKSKITELIEQAEQKPNLTIGVLVSIVVVIFSLF  481

Query  331  vklLFGGKKQIPARPV  284
            VKL+FGGKK   A PV
Sbjct  482  VKLIFGGKKA--AAPV  495



>gb|KJB40064.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=541

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            F+PIAA+GIEIWTMQ+GILFDNILIA DE VAESYR T WKPKF VEKEKQKAEE    S
Sbjct  363  FDPIAAIGIEIWTMQEGILFDNILIAKDENVAESYRDTTWKPKFVVEKEKQKAEEEAAGS  422

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L G+QK VFD LYK AD+PFL ++K +ILD +EKAEKQPN+TIGV+VS++VV+LT + 
Sbjct  423  DDLGGFQKTVFDVLYKFADIPFLSKYKLQILDFIEKAEKQPNLTIGVLVSIVVVILTAIF  482

Query  328  klLFGGKKQIP  296
             L+F GKKQ P
Sbjct  483  MLIFSGKKQQP  493



>ref|XP_007159940.1| hypothetical protein PHAVU_002G280200g [Phaseolus vulgaris]
 gb|ESW31934.1| hypothetical protein PHAVU_002G280200g [Phaseolus vulgaris]
Length=541

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF V ++++++ E    S
Sbjct  368  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFSVEKEKQKEEETEAGS  427

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             G+ G+QK VFD LYKIAD+PFL  +K KI DL++K ++QPN+T+G++V+++VV +++  
Sbjct  428  SGIAGFQKKVFDLLYKIADIPFLSAYKPKIHDLIQKGQEQPNLTVGILVAILVVFVSVFF  487

Query  328  klLFGGKKQIPAR  290
            K++FGGKK+ P R
Sbjct  488  KIIFGGKKK-PTR  499



>ref|XP_006844691.1| hypothetical protein AMTR_s00016p00245620 [Amborella trichopoda]
 gb|ERN06366.1| hypothetical protein AMTR_s00016p00245620 [Amborella trichopoda]
Length=535

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKF--DVEKEKQKAEEVTDS  509
            EPIAA+GIEIWTMQDGILFDNILIA D KVAE YR+ AWKPKF  + EKEK +   +  S
Sbjct  358  EPIAAIGIEIWTMQDGILFDNILIADDAKVAEQYREKAWKPKFEAEKEKEKAEEAALAAS  417

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL G+QK VFD LYKIAD+PFL  +K KI+D +EK EKQPN+TIG++V+V++V LT + 
Sbjct  418  SGLSGFQKKVFDLLYKIADVPFLDAYKIKIIDAIEKGEKQPNLTIGILVAVLLVFLTAIS  477

Query  328  klLFGGKKQIPARP  287
            ++LFGGKK  PA P
Sbjct  478  RVLFGGKKPTPAPP  491



>ref|XP_003630450.1| Calnexin-like protein [Medicago truncatula]
 gb|AET04926.1| Calnexin 2 [Medicago truncatula]
Length=540

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+A SYR+T WKPKF +EKEKQK EE  T+S
Sbjct  369  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAASYRETTWKPKFTIEKEKQKEEEKDTES  428

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL    K VFD LYKIAD+PFL  +K KI DL+EK E QPN+T+G++V+V+V+VLTI +
Sbjct  429  SGLASIHKKVFDLLYKIADIPFLSAYKFKIHDLIEKGETQPNLTVGILVAVVVIVLTIFL  488

Query  328  klLFGGKKQIPAR  290
            +++FGGKK+ PAR
Sbjct  489  RIVFGGKKK-PAR  500



>gb|KJB40065.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=540

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            F+PIAA+GIEIWTMQ+GILFDNILIA DE VAESYR T WKPKF VEKEKQKAEE    S
Sbjct  363  FDPIAAIGIEIWTMQEGILFDNILIAKDENVAESYRDTTWKPKFVVEKEKQKAEEEAAGS  422

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L G+QK VFD LYK AD+PFL ++K +ILD +EKAEKQPN+TIGV+VS++VV+LT + 
Sbjct  423  DDLGGFQKTVFDVLYKFADIPFLSKYKLQILDFIEKAEKQPNLTIGVLVSIVVVILTAIF  482

Query  328  klLFGGKKQ  302
             L+F GKKQ
Sbjct  483  MLIFSGKKQ  491



>ref|XP_007159942.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
 gb|ESW31936.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
Length=547

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+AESYR+T WKPKF V ++++++ E    S
Sbjct  368  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAESYRETTWKPKFSVEKEKQKEEENEAGS  427

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             G+ G+QK VFD LYKIAD+PFL  +K KI DL+EK ++QPN+T+G++V+++V+ ++I  
Sbjct  428  SGIAGFQK-VFDILYKIADIPFLSAYKPKIHDLIEKGQEQPNLTVGILVAILVIFVSIFF  486

Query  328  klLFGGKKQ  302
            +++FGGKKQ
Sbjct  487  RIIFGGKKQ  495



>gb|KJB40062.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=530

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            F+PIAA+GIEIWTMQ+GILFDNILIA DE VAESYR T WKPKF VEKEKQKAEE    S
Sbjct  353  FDPIAAIGIEIWTMQEGILFDNILIAKDENVAESYRDTTWKPKFVVEKEKQKAEEEAAGS  412

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L G+QK VFD LYK AD+PFL ++K +ILD +EKAEKQPN+TIGV+VS++VV+LT + 
Sbjct  413  DDLGGFQKTVFDVLYKFADIPFLSKYKLQILDFIEKAEKQPNLTIGVLVSIVVVILTAIF  472

Query  328  klLFGGKKQ  302
             L+F GKKQ
Sbjct  473  MLIFSGKKQ  481



>gb|ACJ85683.1| unknown [Medicago truncatula]
 gb|AFK41123.1| unknown [Medicago truncatula]
Length=541

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA D+K+AESYR+T WKPKF++  EK+K + E   +
Sbjct  366  FEPIAAIGIEIWTMQDGILFDNVLIAKDDKIAESYRETTWKPKFNIEKEKQKAEEEAAAE  425

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+G+ GYQK  FD LYKIAD+PFL   K KI++++EK EKQPN+TIG++ SV+VV +TI 
Sbjct  426  SEGIAGYQKKAFDLLYKIADIPFLSGQKDKIIEIIEKGEKQPNLTIGILASVVVVFVTIF  485

Query  331  vklLFGGKK  305
             +L+FGGKK
Sbjct  486  FRLIFGGKK  494



>gb|KEH35681.1| Calnexin 2 [Medicago truncatula]
Length=546

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA D+K+AESYR+T WKPKF++  EK+K + E   +
Sbjct  366  FEPIAAIGIEIWTMQDGILFDNVLIAKDDKIAESYRETTWKPKFNIEKEKQKAEEEAAAE  425

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+G+ GYQK  FD LYKIAD+PFL   K KI++++EK EKQPN+TIG++ SV+VV +TI 
Sbjct  426  SEGIAGYQKKAFDLLYKIADIPFLSGQKDKIIEIIEKGEKQPNLTIGILASVVVVFVTIF  485

Query  331  vklLFGGKK  305
             +L+FGGKK
Sbjct  486  FRLIFGGKK  494



>ref|XP_003602731.1| Calnexin-like protein [Medicago truncatula]
 gb|AES72982.1| Calnexin 2 [Medicago truncatula]
Length=541

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA D+K+AESYR+T WKPKF++  EK+K + E   +
Sbjct  366  FEPIAAIGIEIWTMQDGILFDNVLIAKDDKIAESYRETTWKPKFNIEKEKQKAEEEAAAE  425

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+G+ GYQK  FD LYKIAD+PFL   K KI++++EK EKQPN+TIG++ SV+VV +TI 
Sbjct  426  SEGIAGYQKKAFDLLYKIADIPFLSGQKDKIIEIIEKGEKQPNLTIGILASVVVVFVTIF  485

Query  331  vklLFGGKK  305
             +L+FGGKK
Sbjct  486  FRLIFGGKK  494



>ref|XP_008222288.1| PREDICTED: calnexin homolog [Prunus mume]
Length=550

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FE IAA+GIEIWTMQDGILFDNILIA DEKVAESYR T WKPKF+ EKEKQKAEE     
Sbjct  374  FEAIAAIGIEIWTMQDGILFDNILIADDEKVAESYRLTTWKPKFENEKEKQKAEEEAAGL  433

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G+QK +FD LYKIAD+P L  +K KI+DL+EK EKQPNI IG+IVS++VV+LT+L
Sbjct  434  SDGLSGFQKKIFDLLYKIADVPLLDAYKPKIIDLIEKGEKQPNIAIGIIVSIVVVLLTVL  493

Query  331  vklLFGGKK  305
             K+LFGGKK
Sbjct  494  FKILFGGKK  502



>ref|XP_010444005.1| PREDICTED: calnexin homolog 1-like [Camelina sativa]
Length=530

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 82/103 (80%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFD--VEKEKQKAEEVTD  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFD   EK+K + E    
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDDEKEKQKAEEEAAGS  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DGLK YQK VFD L K+ADL FL  +K KI +L EKAE++PN
Sbjct  422  ADGLKSYQKFVFDLLNKVADLSFLSAYKSKITELTEKAEQKPN  464



>ref|XP_010044902.1| PREDICTED: calnexin homolog [Eucalyptus grandis]
Length=541

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKP-KFDVEKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDN+LIA+DEKVAESYR+TAWKP     ++++++ ++ T S
Sbjct  361  FEPIAAIGIEIWTMQDGILFDNVLIASDEKVAESYRETAWKPKFEVEKEKQKEEDKATGS  420

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL    K VFD LYK+AD+ FL  HK KIL+L+EKAE++PNI IGV+ S++VV+LT+  
Sbjct  421  DGLSAIHKKVFDVLYKVADVSFLEPHKPKILELIEKAEEKPNIAIGVLGSIVVVILTVFF  480

Query  328  klLFGGKKQIPARP  287
            K+LFGGKK +   P
Sbjct  481  KILFGGKKPVANVP  494



>gb|EMT07009.1| Calnexin-like protein [Aegilops tauschii]
Length=529

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK--AEEVTD  512
            F+PIAA+GIEIWTMQDGILFDNILIA +EKVA S R+  WKPKFD EKEKQK        
Sbjct  357  FDPIAAIGIEIWTMQDGILFDNILIADNEKVATSVREKTWKPKFDAEKEKQKAEEAAAGA  416

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+GL   QK +FD LYK+AD+PFL  +K KI+D++EK E QPNITI ++ SVIVV++T+L
Sbjct  417  SEGLSEIQKKIFDILYKVADIPFLEPYKTKIIDVIEKGETQPNITISILASVIVVIVTVL  476

Query  331  vklLFGGKKQI-PARPV  284
             K LFGGKK + P +P 
Sbjct  477  FKALFGGKKPVAPVKPA  493



>gb|EMS59517.1| Calnexin-like protein 1 [Triticum urartu]
Length=529

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK--AEEVTD  512
            F+PIAA+GIEIWTMQDGILFDNILIA +EKVA S R+  WKPKFD EKEKQK        
Sbjct  357  FDPIAAIGIEIWTMQDGILFDNILIADNEKVATSVREKTWKPKFDAEKEKQKAEEAAAGA  416

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+GL   QK +FD LYK+AD+PFL  +K KI+D++EK E QPNITI ++ SVIVV++T+L
Sbjct  417  SEGLSEIQKKIFDILYKVADIPFLEPYKTKIIDVIEKGETQPNITISILASVIVVIVTVL  476

Query  331  vklLFGGKKQI-PARPV  284
             + LFGGKK + P +P 
Sbjct  477  FRALFGGKKPVAPVKPA  493



>gb|KDO47053.1| hypothetical protein CISIN_1g041813mg, partial [Citrus sinensis]
Length=543

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPI+AVGIEIWTMQDGILFDNILI  DE VA+ YR+T WKPKF+VEK K KAE+     
Sbjct  333  FEPISAVGIEIWTMQDGILFDNILITCDENVADLYRETTWKPKFEVEKAKHKAEKAVAAS  392

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SD     +K +F  LYKIAD+PFL  +K KI+++L++ E+QPN
Sbjct  393  SDSFTRIRKGLFGLLYKIADIPFLNAYKSKIIEVLKRGEEQPN  435



>emb|CBI35622.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = -3

Query  646  MQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDS-DGLKGYQKVVFDQ  470
            MQDGILFDNILI +DEK AESYR+T WKPKF+VEKEKQKAE+     D   G+QK VFD 
Sbjct  1    MQDGILFDNILITSDEKTAESYRETTWKPKFEVEKEKQKAEDAAAGFDVPSGFQKKVFDL  60

Query  469  LYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvklLFGGKKQI  299
            LYKIAD+ FL  +K K+LDL+EK EKQPN+TIG++VS+++V LTI+ K++FGGKK +
Sbjct  61   LYKIADISFLNAYKPKLLDLIEKGEKQPNLTIGILVSIVIVFLTIIFKIIFGGKKPV  117



>ref|XP_009373671.1| PREDICTED: calnexin homolog isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 8/136 (6%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAAVGIEIWTMQDGILFDNILIA DEKVA++YR+TAWKPK   E EK+K +E  D  
Sbjct  363  FEPIAAVGIEIWTMQDGILFDNILIAKDEKVAQAYRETAWKPK--FEVEKEKTKEEEDVQ  420

Query  505  GLKGY----QKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvlt  338
            G +G+    QK +FD LY +ADLPFL  HK KI+DL+EKAE+QPN+T+G++V+++V++ T
Sbjct  421  GAEGFLVTVQKKIFDLLYTVADLPFLSSHKSKIIDLIEKAEQQPNLTVGILVAIVVIIFT  480

Query  337  ilvklLFGGKKQIPAR  290
            +LVKLLFGGKK  PAR
Sbjct  481  VLVKLLFGGKK--PAR  494



>ref|XP_009373670.1| PREDICTED: calnexin homolog isoform X1 [Pyrus x bretschneideri]
Length=557

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 8/136 (6%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAAVGIEIWTMQDGILFDNILIA DEKVA++YR+TAWKPK   E EK+K +E  D  
Sbjct  363  FEPIAAVGIEIWTMQDGILFDNILIAKDEKVAQAYRETAWKPK--FEVEKEKTKEEEDVQ  420

Query  505  GLKGY----QKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvlt  338
            G +G+    QK +FD LY +ADLPFL  HK KI+DL+EKAE+QPN+T+G++V+++V++ T
Sbjct  421  GAEGFLVTVQKKIFDLLYTVADLPFLSSHKSKIIDLIEKAEQQPNLTVGILVAIVVIIFT  480

Query  337  ilvklLFGGKKQIPAR  290
            +LVKLLFGGKK  PAR
Sbjct  481  VLVKLLFGGKK--PAR  494



>ref|XP_006478659.1| PREDICTED: calnexin homolog [Citrus sinensis]
Length=586

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPI+AVGIEIWTMQDGILFDNILI  DE VA+ YR+T WKPKF+VEK K KAE+     
Sbjct  376  FEPISAVGIEIWTMQDGILFDNILITCDENVADLYRETTWKPKFEVEKAKHKAEKAVAAS  435

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            SD     +K +F  LYKIAD+PFL  +K KI+++L++ E+QPN
Sbjct  436  SDSFTRIRKGLFGLLYKIADIPFLNAYKSKIIEVLKRGEEQPN  478



>ref|XP_006423842.1| hypothetical protein CICLE_v10028154mg [Citrus clementina]
 gb|ESR37082.1| hypothetical protein CICLE_v10028154mg [Citrus clementina]
Length=539

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 102/134 (76%), Gaps = 2/134 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            FEPI+AVGIEIWTMQDGILFDNILI  DE VA  YR+T WKPKF+VEK K KAE+     
Sbjct  359  FEPISAVGIEIWTMQDGILFDNILITCDENVAALYRETTWKPKFEVEKAKHKAEKAVAAS  418

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SD     +K +F  LYKIAD+PFL  +K KI+++L++ ++QPNIT+G++ S+  ++LTI+
Sbjct  419  SDFFTRIRKGLFGLLYKIADIPFLNAYKSKIIEVLKRGDEQPNITVGILFSIFFIILTIV  478

Query  331  vklLFGGKKQIPAR  290
            V  LFGGK++ PA 
Sbjct  479  VTTLFGGKEKPPAN  492



>dbj|BAK00820.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK--AEEVTD  512
            F+PIAA+GIEIWTMQDGILFDNILIA +EKVA S  +  WKPKFDVEKEKQK        
Sbjct  360  FDPIAAIGIEIWTMQDGILFDNILIADNEKVATSVLEKTWKPKFDVEKEKQKAEEAAAGA  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+GL  +QK +FD LYK+AD+PFL  +K KI++++EK E QPNITI ++ SV+VV+ T+L
Sbjct  420  SEGLSEFQKKIFDILYKVADIPFLEPYKTKIIEVIEKGETQPNITISILASVVVVIATVL  479

Query  331  vklLFGGKKQI-PARPV  284
             + LFGGKK + P +P 
Sbjct  480  FRTLFGGKKPVAPVKPA  496



>ref|XP_010695743.1| PREDICTED: calnexin homolog [Beta vulgaris subsp. vulgaris]
Length=539

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFD--VEKEKQKAEEVTD  512
            FEPIAA+GIEIWTMQDGILFDNILIA DEK AESYR+T WKPKFD   EK+K +      
Sbjct  362  FEPIAAIGIEIWTMQDGILFDNILIAGDEKTAESYRKTQWKPKFDAEKEKQKAEEAAAQA  421

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            +DG+ G QK VFD LYK+AD+PFL  ++ KI +L+EKAE QPN
Sbjct  422  ADGISGIQKKVFDLLYKVADVPFLQPYQSKIHELIEKAETQPN  464



>ref|XP_004503809.1| PREDICTED: calnexin homolog isoform X1 [Cicer arietinum]
Length=577

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+A SYR+T WKPKF + ++++++ E  T+S
Sbjct  366  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAASYRETTWKPKFTIEKEKQKEEELETES  425

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL   QK VF+ LYKIAD+PFL  +K K+ DL+EK EKQPN+TIG++VSV+VV LTI +
Sbjct  426  SGLASLQKKVFELLYKIADIPFLSAYKLKLYDLIEKGEKQPNLTIGILVSVVVVFLTIFL  485

Query  328  klLFGGKKQIPAR  290
            +++FGGKK+  +R
Sbjct  486  RIVFGGKKKPVSR  498



>ref|XP_008375429.1| PREDICTED: calnexin homolog [Malus domestica]
Length=543

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKP-KFDVEKEKQKAEEVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA DEKVA++YR+T WKP     +++ ++ E+V  +
Sbjct  363  FEPIAAVGIEIWTMQDGILFDNILIAKDEKVAQTYRETGWKPKFEVEKEKSKEEEDVQGT  422

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            DG L   QK +FD LY +ADLPFL  HK KI+DL+EKAE+QPN+T+G++V+++V++ T+ 
Sbjct  423  DGFLATVQKKIFDLLYTVADLPFLSSHKPKIVDLIEKAEEQPNLTVGILVAIVVIIFTVF  482

Query  331  vklLFGGKKQIPAR  290
            VKLLFGGKK  PAR
Sbjct  483  VKLLFGGKK--PAR  494



>ref|XP_004503810.1| PREDICTED: calnexin homolog isoform X2 [Cicer arietinum]
Length=538

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILIA D+K+A SYR+T WKPKF + ++++++ E  T+S
Sbjct  366  FEPIAAIGIEIWTMQDGILFDNILIAKDDKIAASYRETTWKPKFTIEKEKQKEEELETES  425

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL   QK VF+ LYKIAD+PFL  +K K+ DL+EK EKQPN+TIG++VSV+VV LTI +
Sbjct  426  SGLASLQKKVFELLYKIADIPFLSAYKLKLYDLIEKGEKQPNLTIGILVSVVVVFLTIFL  485

Query  328  klLFGGKKQIPAR  290
            +++FGGKK+ P R
Sbjct  486  RIVFGGKKK-PTR  497



>dbj|BAJ94182.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK--AEEVTD  512
            F+PIAA+GIEIWTMQDGILFDNILIA +EKVA S  +  WKPKFDVEKEKQK        
Sbjct  360  FDPIAAIGIEIWTMQDGILFDNILIADNEKVATSVLEKTWKPKFDVEKEKQKAEEAAAGA  419

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+GL  +QK +FD LYK+AD+PFL  +K KI++++EK E QPNITI ++ SV+VV++T+L
Sbjct  420  SEGLSEFQKKIFDILYKVADIPFLEPYKTKIIEVIEKGETQPNITISILASVVVVIVTVL  479

Query  331  vklLFGGKKQI-PARPV  284
             + LFGGKK + P +P 
Sbjct  480  FRTLFGGKKPVAPVKPA  496



>ref|XP_007222238.1| hypothetical protein PRUPE_ppa003823mg [Prunus persica]
 gb|EMJ23437.1| hypothetical protein PRUPE_ppa003823mg [Prunus persica]
Length=546

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FE I A+GIEIWTMQDGILFDNILIA DEKVAESYR T WKPKF+ EKEKQKAEE     
Sbjct  370  FEAITAIGIEIWTMQDGILFDNILIADDEKVAESYRLTTWKPKFENEKEKQKAEEEAAGL  429

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL G+QK +FD L KIAD+PFL  +K KI+DL+EK EKQPNITIG+IVS++VV+LT++
Sbjct  430  SDGLSGFQKKIFDVLNKIADVPFLDVYKPKIIDLIEKGEKQPNITIGIIVSIVVVLLTVV  489

Query  331  vklLFGGKK  305
             K+LFGGKK
Sbjct  490  FKILFGGKK  498



>gb|KCW87020.1| hypothetical protein EUGRSUZ_B03570 [Eucalyptus grandis]
Length=607

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA+DEKVAE+YR+T WKPKF+VEKEKQK E+  +DS
Sbjct  428  FDPIAAIGIEIWTMQDGILFDNILIASDEKVAETYRETTWKPKFEVEKEKQKEEDKDSDS  487

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL    K  FD LY IAD+PFL  +K KILDL+EKAEKQPNITIGV+VS++V++LT+  
Sbjct  488  PGLSAVHKKAFDVLYMIADVPFLDPYKPKILDLIEKAEKQPNITIGVLVSIVVIILTLFF  547

Query  328  klLFGGKK  305
            K+LFGGKK
Sbjct  548  KILFGGKK  555



>ref|XP_010044903.1| PREDICTED: calnexin homolog [Eucalyptus grandis]
Length=542

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA+DEKVAE+YR+T WKPKF+VEKEKQK E+  +DS
Sbjct  363  FDPIAAIGIEIWTMQDGILFDNILIASDEKVAETYRETTWKPKFEVEKEKQKEEDKDSDS  422

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL    K  FD LY IAD+PFL  +K KILDL+EKAEKQPNITIGV+VS++V++LT+  
Sbjct  423  PGLSAVHKKAFDVLYMIADVPFLDPYKPKILDLIEKAEKQPNITIGVLVSIVVIILTLFF  482

Query  328  klLFGGKK  305
            K+LFGGKK
Sbjct  483  KILFGGKK  490



>ref|XP_009360274.1| PREDICTED: calnexin homolog [Pyrus x bretschneideri]
 ref|XP_009360292.1| PREDICTED: calnexin homolog [Pyrus x bretschneideri]
Length=543

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKP-KFDVEKEKQKAEEVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA DEKVA++YR+TAWKP     +++ ++ E+V  +
Sbjct  363  FEPIAAVGIEIWTMQDGILFDNILIAKDEKVAQTYRETAWKPKFEVEKEKSKEEEDVQGT  422

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            DG L   QK +FD LY +ADLPFL  HK KI+DL+EKAE+QPN
Sbjct  423  DGFLATVQKKIFDLLYTVADLPFLSSHKPKIVDLIEKAEEQPN  465



>ref|XP_008392683.1| PREDICTED: calnexin homolog [Malus domestica]
Length=544

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKP-KFDVEKEKQKAEEVTDS  509
            FE IAAVGIEIWTMQDGILFDNILIA DEKVA++YR+TAWKP     +++ ++ E+V  +
Sbjct  360  FESIAAVGIEIWTMQDGILFDNILIAKDEKVAQAYRETAWKPKFEVEKEKAKEEEDVQGA  419

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +G L  +QK +FD LY +ADLPFL  HK KI+DL+EKAE+QPN+T+G++V+++V++ T+ 
Sbjct  420  EGFLVTFQKKIFDLLYTVADLPFLSSHKSKIIDLIEKAEQQPNLTVGILVAIVVIIFTVF  479

Query  331  vklLFGGKKQIPAR  290
            VKLLFGGKK  PAR
Sbjct  480  VKLLFGGKK--PAR  491



>ref|XP_010555592.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=540

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKP-KFDVEKEKQKAEEVTDS  509
            FEP+AA+GIEIWTMQDG+LFDNILIA DEKVAES R + WKP   D ++++++ E+  D 
Sbjct  363  FEPVAAIGIEIWTMQDGLLFDNILIAKDEKVAESIRLSTWKPKFEDEKEKQKEEEDTADQ  422

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            DG LKG+QK VF+ LYKI+D+PFL ++K KILDL+EKAEKQPNITIGV V+++ V LT++
Sbjct  423  DGHLKGFQKKVFELLYKISDIPFLSDYKLKILDLIEKAEKQPNITIGVFVAIVAVFLTLV  482

Query  331  vklLFGGKK  305
            +KLLFGGKK
Sbjct  483  LKLLFGGKK  491



>gb|KDP23235.1| hypothetical protein JCGZ_23068 [Jatropha curcas]
Length=533

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 7/129 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+GIEIWTMQD ILFDNILIATDEKVA  YR+  WKPKF+VEK+           
Sbjct  367  FEPITAIGIEIWTMQDNILFDNILIATDEKVASKYRERTWKPKFEVEKKAAGG-------  419

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilvk  326
            GL   Q  VFD LYKI D+PFL  +K KI+D++++AEKQPNITIG++VS+ V+VLT   +
Sbjct  420  GLSSLQNKVFDLLYKIGDIPFLVAYKPKIIDIVDQAEKQPNITIGILVSIAVIVLTAFFR  479

Query  325  lLFGGKKQI  299
            +LFGGKK +
Sbjct  480  ILFGGKKTV  488



>gb|KJB40063.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=540

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            F+PIAA+GIEIWTMQ+GILFDNILIA DE VAESYR T WKPKF VEKEKQKAEE    S
Sbjct  363  FDPIAAIGIEIWTMQEGILFDNILIAKDENVAESYRDTTWKPKFVVEKEKQKAEEEAAGS  422

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            D L G+Q  VFD LYK AD+PFL ++K +ILD +EKAEKQPN+TIGV+VS++VV+LT + 
Sbjct  423  DDLGGFQ-TVFDVLYKFADIPFLSKYKLQILDFIEKAEKQPNLTIGVLVSIVVVILTAIF  481

Query  328  klLFGGKKQIP  296
             L+F GKKQ P
Sbjct  482  MLIFSGKKQQP  492



>ref|XP_008360201.1| PREDICTED: calnexin homolog 1-like [Malus domestica]
Length=547

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIAA+GIEIWTMQDGILFDN+LIA DEKVAES R T WKPKF+ EKEKQKAEE     
Sbjct  369  FEPIAAIGIEIWTMQDGILFDNMLIADDEKVAESVRLTTWKPKFETEKEKQKAEEEAAGL  428

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL  YQK VFD LYKIAD+ FL  +K +I++L+EK EKQPNITIGVIVSV+VV+L+I 
Sbjct  429  SDGLSSYQKKVFDLLYKIADVSFLDAYKPRIIELIEKGEKQPNITIGVIVSVVVVLLSIF  488

Query  331  vklLFGGKK  305
             K+LFGGKK
Sbjct  489  FKILFGGKK  497



>ref|XP_009353485.1| PREDICTED: calnexin homolog 1-like [Pyrus x bretschneideri]
Length=545

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIAA+GIEIWTMQDGILFDNILIA +EKVAES R T WKPKF+ EKEKQKAEE     
Sbjct  368  FEPIAAIGIEIWTMQDGILFDNILIADNEKVAESVRLTTWKPKFETEKEKQKAEEEAAGL  427

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL  YQK VFD LYKIAD+ FL  +K +I++L+EK EKQPNITIGVIVSV+VV+L+I 
Sbjct  428  SDGLSSYQKKVFDLLYKIADVSFLDAYKPRIIELIEKGEKQPNITIGVIVSVVVVLLSIF  487

Query  331  vklLFGGKK  305
             K+LFGGKK
Sbjct  488  FKILFGGKK  496



>ref|NP_001150317.1| calnexin precursor [Zea mays]
 gb|ACG38634.1| calnexin precursor [Zea mays]
 gb|ACN26095.1| unknown [Zea mays]
 tpg|DAA38019.1| TPA: calnexin [Zea mays]
Length=534

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+DVEKEK+KAEE     
Sbjct  357  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEEAAAG  416

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGL  +QK +FD LYKIAD+PFL  +K KI+D++EK EKQPNITIG++VSV+VV +T+L
Sbjct  417  ADGLSEFQKKIFDVLYKIADVPFLAPYKTKIIDVIEKGEKQPNITIGILVSVVVVFVTVL  476

Query  331  vklLFGGKKQI-PARPV  284
             K+LFGGKK + P +P 
Sbjct  477  FKILFGGKKPVAPVKPA  493



>gb|ABK95212.1| unknown [Populus trichocarpa]
Length=157

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = -3

Query  646  MQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDSDGLKGYQKVVFDQ  470
            MQDGILFDNILIA DEKVA S R T WKPKFDVEKEK+KA E    +D L G+QK VF+ 
Sbjct  1    MQDGILFDNILIAQDEKVASSIRDTTWKPKFDVEKEKEKATEAAAGTDALGGFQKKVFEI  60

Query  469  LYKIADLPFLGEHKGKILDLLEKAEKQP  386
            LY++A++ FL EHK KI++L+EKAEKQP
Sbjct  61   LYQVAEISFLSEHKDKIIELIEKAEKQP  88



>ref|XP_008663173.1| PREDICTED: calnexin homolog [Zea mays]
 gb|ACF79151.1| unknown [Zea mays]
 gb|ACF79172.1| unknown [Zea mays]
 gb|AFW58149.1| hypothetical protein ZEAMMB73_760338 [Zea mays]
Length=532

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 108/135 (80%), Gaps = 3/135 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+DV +++++  E    +
Sbjct  357  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEAAAGA  416

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL  +QK +FD LYKIAD+PFL  +K KI+D++EK EKQPNITIG++VSV++V +T+L 
Sbjct  417  DGLSDFQKKIFDVLYKIADIPFLAPYKTKIIDVIEKGEKQPNITIGILVSVVIVFVTVLF  476

Query  328  klLFGGKKQIPARPV  284
            K+LFGGKK  P  PV
Sbjct  477  KILFGGKK--PVAPV  489



>ref|XP_008369590.1| PREDICTED: calnexin homolog [Malus domestica]
Length=550

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 108/135 (80%), Gaps = 2/135 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPIAA+GIEIWTM+DGILFDNILIA DE+VAES R T WK KF+ EKEKQKAEE     
Sbjct  371  FEPIAAIGIEIWTMEDGILFDNILIADDERVAESVRLTTWKRKFETEKEKQKAEEEAAGL  430

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SDGL  YQK VFD LYKIAD+ FL  +K KI+DL+EK EKQPNITIGVIVSV+VV+L++ 
Sbjct  431  SDGLSSYQKKVFDLLYKIADVSFLDAYKPKIIDLIEKGEKQPNITIGVIVSVVVVLLSMF  490

Query  331  vklLFGGKKQIPARP  287
             KL FGGKK +   P
Sbjct  491  FKLFFGGKKPVVTVP  505



>gb|AGE09565.1| CNX1-like protein, partial [Eucalyptus cladocalyx]
Length=489

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA+DEKVA++YR+T WKPKF+VEKEKQK E+  +DS
Sbjct  321  FDPIAAIGIEIWTMQDGILFDNILIASDEKVAKTYRETTWKPKFEVEKEKQKEEDKDSDS  380

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
             GL    K  FD LY IAD+PFL  +K KILDL+EKAEKQPN
Sbjct  381  PGLSAVHKKAFDVLYMIADVPFLDPYKPKILDLIEKAEKQPN  422



>emb|CAA54678.1| calnexin [Zea mays]
Length=428

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+DV +++++  E    +
Sbjct  251  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEAAAGA  310

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            DGL  +QK +FD LYKIAD+PFL  +K KI+D++EK EKQPN
Sbjct  311  DGLSDFQKKIFDVLYKIADIPFLAPYKTKIIDVIEKGEKQPN  352



>gb|ACN41018.1| unknown [Picea sitchensis]
Length=549

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 102/130 (78%), Gaps = 2/130 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
             EPIAA+GIEIWTMQDGILFDNILI  DEKVAE YR   WK KF +EKE++ +E+V    
Sbjct  364  LEPIAAIGIEIWTMQDGILFDNILITGDEKVAEEYRVKTWKEKFTIEKEREPSEDVDVPL  423

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
               L G QK +FD LY+IA++PFL  +K KI+DL+E+ EK+PN+TIG++V+V++V+LT +
Sbjct  424  PGELSGLQKKIFDVLYRIANIPFLDAYKLKIIDLIEQGEKKPNLTIGILVAVLLVILTAV  483

Query  331  vklLFGGKKQ  302
             ++LFG KKQ
Sbjct  484  YRVLFGSKKQ  493



>gb|KCW87019.1| hypothetical protein EUGRSUZ_B03570 [Eucalyptus grandis]
Length=608

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV-TDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA+DEKVAE+YR+T WKPKF+VEKEKQK E+  +DS
Sbjct  428  FDPIAAIGIEIWTMQDGILFDNILIASDEKVAETYRETTWKPKFEVEKEKQKEEDKDSDS  487

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
             GL    K  FD LY IAD+PFL  +K KIL+L+EKAE++PNI IGV+ S++VV+LT+  
Sbjct  488  PGLSAVHKKAFDVLYMIADVPFLDPYKPKILELIEKAEEKPNIAIGVLGSIVVVILTVFF  547

Query  328  klLFGGKKQIPARP  287
            K+LFGGKK +   P
Sbjct  548  KILFGGKKPVANVP  561



>ref|XP_006652238.1| PREDICTED: calnexin homolog [Oryza brachyantha]
Length=538

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 113/137 (82%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK++VEKEK+KAEE     
Sbjct  359  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYEVEKEKEKAEEAAAAG  418

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +DGL  +QK +FD LYKIAD+PFL  +K KI+D++EK EKQPNITIG++VS++VV++T+L
Sbjct  419  ADGLSEFQKKIFDVLYKIADIPFLEPYKTKIIDVIEKGEKQPNITIGIVVSIVVVLVTVL  478

Query  331  vklLFGGKKQI-PARPV  284
             K+LFG KK + P +PV
Sbjct  479  FKILFGSKKPVAPVKPV  495



>gb|AGF69181.1| calnexin precursor, partial [Triticum aestivum]
Length=335

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA +  +  WKPKFDV  EK+K +     D
Sbjct  230  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATAILEKTWKPKFDVEKEKQKAEEAAAAD  289

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
            S+ L  +QK +F  LYKIAD+PFL  +K KI+D++EK EKQPN
Sbjct  290  SEDLSEFQKKIFSVLYKIADIPFLEPYKIKIIDVIEKGEKQPN  332



>ref|XP_010536572.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=545

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 6/133 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPIAA+GIEIWTMQDG+LFDNILIA DEKVAES R T WKPKF+VEKEKQK EE   + 
Sbjct  364  FEPIAAIGIEIWTMQDGLLFDNILIAKDEKVAESIRLTTWKPKFEVEKEKQKEEEDAAAA  423

Query  505  ------GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvv  344
                   LKG QK VF+ LYKIAD+PFL ++K KILDL+EKAEKQPN+TIGV+V ++VV+
Sbjct  424  SADQDGHLKGIQKKVFEFLYKIADIPFLSDYKLKILDLIEKAEKQPNLTIGVVVGIVVVL  483

Query  343  ltilvklLFGGKK  305
            LT+++KLLFGGKK
Sbjct  484  LTLVLKLLFGGKK  496



>emb|CDY00229.1| BnaA06g21300D [Brassica napus]
Length=538

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 109/136 (80%), Gaps = 9/136 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  363  YEPIAAIGIEIWTMQDGILFDNMLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  422

Query  511  SDGLKGY-------QKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvi  353
            +D +  +       QKVVFD L K+AD+ FL  +K KI +++EKAE+QPN+TIGV+VS++
Sbjct  423  ADDIHLFISVHDCLQKVVFDLLNKVADISFLSAYKSKITEVIEKAEEQPNLTIGVLVSIV  482

Query  352  vvvltilvklLFGGKK  305
            +V  ++ +KL+FGGKK
Sbjct  483  IVFFSLFIKLIFGGKK  498



>dbj|BAJ89767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 102/137 (74%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            F+PIAA GIEIWTMQDGILFDNILIA DEKVA S  +  WKPKF V  EK+K +     +
Sbjct  361  FDPIAATGIEIWTMQDGILFDNILIADDEKVAMSILEKTWKPKFVVEKEKQKAEEAAAAE  420

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+ L  +QK +F  LYKIAD+PFL  +K KI+DL+EK EKQPNITI ++ SV V+++T+L
Sbjct  421  SEDLSEFQKKIFSVLYKIADIPFLEPYKIKIIDLIEKGEKQPNITISILASVAVILVTVL  480

Query  331  vklLFGGKKQI-PARPV  284
             + +FGGKK + P +P 
Sbjct  481  FRTIFGGKKAVAPVKPA  497



>ref|NP_001052692.1| Os04g0402100 [Oryza sativa Japonica Group]
 emb|CAD40786.1| OSJNBb0012E08.10 [Oryza sativa Japonica Group]
 dbj|BAF14606.1| Os04g0402100 [Oryza sativa Japonica Group]
 dbj|BAG91264.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACS13098.1| calnexin [Oryza sativa Indica Group]
 gb|AGT42319.1| calnexin [Oryza sativa Japonica Group]
Length=537

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKF--DVEKEKQKAEEVTDS  509
            +PIAA+GIEIWTMQDGILFDNILIA DEKVA S  + +WKPK+  + EKEK +       
Sbjct  359  DPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKSWKPKYEVEKEKEKAEEAAAAAG  418

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL  +QK +FD LYK+AD+PFL  +K KI+D++EK EKQPNITIG++VS++VV +T+L 
Sbjct  419  DGLSEFQKKIFDVLYKLADIPFLEPYKTKIIDVIEKGEKQPNITIGILVSIVVVFVTVLF  478

Query  328  klLFGGKKQIPARPV  284
            ++LFGGKK  PA PV
Sbjct  479  RILFGGKK--PAAPV  491



>gb|EAZ30613.1| hypothetical protein OsJ_14665 [Oryza sativa Japonica Group]
Length=569

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKF--DVEKEKQKAEEVTDS  509
            +PIAA+GIEIWTMQDGILFDNILIA DEKVA S  + +WKPK+  + EKEK +       
Sbjct  391  DPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKSWKPKYEVEKEKEKAEEAAAAAG  450

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL  +QK +FD LYK+AD+PFL  +K KI+D++EK EKQPNITIG++VS++VV +T+L 
Sbjct  451  DGLSEFQKKIFDVLYKLADIPFLEPYKTKIIDVIEKGEKQPNITIGILVSIVVVFVTVLF  510

Query  328  klLFGGKKQIPARPV  284
            ++LFGGKK  PA PV
Sbjct  511  RILFGGKK--PAAPV  523



>ref|XP_003567632.1| PREDICTED: calnexin homolog [Brachypodium distachyon]
Length=538

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 107/138 (78%), Gaps = 4/138 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            F+PI A+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+D+EKEK+KAEE     
Sbjct  358  FDPIGAIGIEIWTMQDGILFDNILIADDEKVANSILEKTWKPKYDLEKEKEKAEEEAAAG  417

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
               L   QK VFD LYKIAD+PFL  +K KI+D++EK EKQPNITIGV+VS++VV +T+L
Sbjct  418  PSTLSDLQKKVFDVLYKIADIPFLEPYKSKIIDVIEKGEKQPNITIGVLVSIVVVFVTVL  477

Query  331  vklLFGGKK--QIPARPV  284
             K+LFGGKK   +P +P 
Sbjct  478  FKILFGGKKPAAVPVKPA  495



>gb|EAY93972.1| hypothetical protein OsI_15749 [Oryza sativa Indica Group]
Length=537

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 4/135 (3%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKF--DVEKEKQKAEEVTDS  509
            +PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+  + EKEK +       
Sbjct  359  DPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYEVEKEKEKAEEAAAAAG  418

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL  +QK +FD LYK+AD+PFL  +K KI+D++EK EKQPNITIG++VS++VV +T+L 
Sbjct  419  DGLSEFQKKIFDVLYKLADIPFLEPYKTKIIDVIEKGEKQPNITIGILVSIVVVFVTVLF  478

Query  328  klLFGGKKQIPARPV  284
            ++LFGGKK  PA PV
Sbjct  479  RILFGGKK--PAAPV  491



>ref|XP_004309487.1| PREDICTED: calnexin homolog [Fragaria vesca subsp. vesca]
Length=543

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAW-KPKFDVEKEKQKAEEVTDS  509
            FEPIAA+GIEIWTMQDGILFDNILI  DEKVA SYR T W       +++++  E+V  S
Sbjct  363  FEPIAAIGIEIWTMQDGILFDNILITKDEKVASSYRDTLWKPKYEVEKEKEKAEEDVPSS  422

Query  508  DG-LKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            +G L   QK +FD LYK+AD+PFL  +K KI+DL+EKAE+QPNIT+GVI S+ V++LT L
Sbjct  423  EGLLATVQKKIFDILYKVADVPFLAAYKTKIVDLIEKAEEQPNITLGVIGSIGVIILTAL  482

Query  331  vklLFGGKK  305
              +LFGGKK
Sbjct  483  FMILFGGKK  491



>gb|KJB07903.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=447

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            FEPIAAVGIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E TDS
Sbjct  359  FEPIAAVGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDESTDS  418

Query  508  DGLKGYQKVVFDQLYKIADL  449
            DGL G Q + +   + I  +
Sbjct  419  DGLSGVQVMHWQDYFVIVGM  438



>ref|XP_004975494.1| PREDICTED: calnexin homolog [Setaria italica]
Length=533

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAW-KPKFDVEKEKQKAEEVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  W       +++++  E    +
Sbjct  357  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYEVEKEKEKAEEAAAGA  416

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            DGL  +QK VFD LYKIAD+PFL  +K KI+D++EK EKQPNITIG++VSV+VV +T+L 
Sbjct  417  DGLSEFQKKVFDILYKIADVPFLAPYKTKIIDVIEKGEKQPNITIGILVSVVVVFVTVLF  476

Query  328  klLFGGKKQI-PARPV  284
            ++LFGGKK + P +P 
Sbjct  477  RILFGGKKPVAPVKPA  492



>ref|XP_006287793.1| hypothetical protein CARUB_v10001009mg [Capsella rubella]
 gb|EOA20691.1| hypothetical protein CARUB_v10001009mg [Capsella rubella]
Length=431

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 2/68 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
            +EPIAA+GIEIWTMQDGI+FDN+LIA DEKVAE+YRQT WKPKFDVEKEKQKAE+    +
Sbjct  362  YEPIAAIGIEIWTMQDGIIFDNVLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEDEAAGE  421

Query  511  SDGLKGYQ  488
            +DGLK YQ
Sbjct  422  TDGLKSYQ  429



>gb|KDO57649.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=434

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-VTDS  509
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK KAEE    S
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLKAEEAAAGS  424

Query  508  DGLKGYQ  488
            DGL G+Q
Sbjct  425  DGLAGFQ  431



>sp|Q39994.1|CALX_HELTU RecName: Full=Calnexin homolog; Flags: Precursor [Helianthus 
tuberosus]
 emb|CAA84491.1| calnexin [Helianthus tuberosus]
Length=540

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 97/136 (71%), Gaps = 11/136 (8%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAE------SYRQTAWKPKFDVEKEKQKAE  524
            FEPIAA+GIE    QDGILFDNILIA+DEK A         R   WK +    K+ Q   
Sbjct  366  FEPIAAIGIEDLDQQDGILFDNILIASDEKTAAKSGILLGSRSLRWKKRNRRLKKNQPL-  424

Query  523  EVTDSDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvv  344
                 DGLKG QK VFD LYKIADLPFLG+HK K+L+L+EKAE QPNITIGVIVS+IVV+
Sbjct  425  ----LDGLKGIQKAVFDVLYKIADLPFLGDHKVKVLELIEKAETQPNITIGVIVSIIVVI  480

Query  343  ltilvklLFGGKKQIP  296
             +IL+KLLFGGKK  P
Sbjct  481  FSILLKLLFGGKKAAP  496



>gb|EMT03767.1| Calnexin-like protein [Aegilops tauschii]
Length=535

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 105/137 (77%), Gaps = 3/137 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--EKEKQKAEEVTD  512
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA +  +  WKPKFDV  EK+K +     D
Sbjct  361  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATAILEKTWKPKFDVEKEKQKAEEAAAAD  420

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            S+ L  +QK +F  LYKIAD+PFL  +K KI+D++EK EKQPNITI ++ SV V+++T+L
Sbjct  421  SEDLSEFQKKIFSVLYKIADIPFLEPYKIKIIDIIEKGEKQPNITISILASVAVILVTVL  480

Query  331  vklLFGGKKQI-PARPV  284
             + +FGGKK + P +PV
Sbjct  481  FRTIFGGKKPVAPVKPV  497



>ref|XP_009380018.1| PREDICTED: calnexin homolog 1-like [Musa acuminata subsp. malaccensis]
Length=556

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 2/129 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            FEPI A+GIEI TMQDGILFDNILI+ DEKVAESYR   WKPK++VEKEK+KAE+     
Sbjct  355  FEPIIAIGIEILTMQDGILFDNILISRDEKVAESYRAETWKPKYEVEKEKEKAEDGAAGF  414

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltil  332
            SD L G+QK VFD LYKIAD+PFL  +K KI+D +E  EKQPN+TIG++VS++V+++T++
Sbjct  415  SDMLSGFQKKVFDVLYKIADIPFLEAYKNKIIDAIEMGEKQPNLTIGILVSIVVIIVTVI  474

Query  331  vklLFGGKK  305
             ++LFGG+K
Sbjct  475  SRVLFGGEK  483



>ref|XP_010230383.1| PREDICTED: calnexin homolog isoform X2 [Brachypodium distachyon]
Length=531

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDS-  509
            F+PI A+GIEIWTMQDGILFDNILIA  EKVA S  +  WKPK++VEKEK+KAEE     
Sbjct  362  FDPIGAIGIEIWTMQDGILFDNILIADSEKVANSILEKTWKPKYEVEKEKEKAEEAAAGP  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            + L   QK +FD LYKIAD+PFL  +K KI+D++EK E QPN+TIG++VS++VV++T+L 
Sbjct  422  NSLSELQKKIFDVLYKIADIPFLEPYKSKIIDVIEKGETQPNVTIGILVSIVVVIVTVLF  481

Query  328  klLFGGKKQIPA  293
            K+LFGGKK  PA
Sbjct  482  KILFGGKKPPPA  493



>ref|XP_010230382.1| PREDICTED: calnexin homolog isoform X1 [Brachypodium distachyon]
Length=535

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD-S  509
            F+PI A+GIEIWTMQDGILFDNILIA  EKVA S  +  WKPK++VEKEK+KAEE     
Sbjct  362  FDPIGAIGIEIWTMQDGILFDNILIADSEKVANSILEKTWKPKYEVEKEKEKAEEAAAGP  421

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsvivvvltilv  329
            + L   QK +FD LYKIAD+PFL  +K KI+D++EK E QPN+TIG++VS++VV++T+L 
Sbjct  422  NSLSELQKKIFDVLYKIADIPFLEPYKSKIIDVIEKGETQPNVTIGILVSIVVVIVTVLF  481

Query  328  klLFGGKK-QIPARPV  284
            K+LFGGKK  +P +P 
Sbjct  482  KILFGGKKPPVPVKPA  497



>gb|KJB38820.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=431

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 1/68 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQK  485
              L G+Q+
Sbjct  422  ARLAGFQE  429



>gb|KJB38814.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
 gb|KJB38821.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=440

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE-EVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA ++KVAESYR+T WKPKF+VEKEKQKAE E  DS
Sbjct  362  FDPIAAIGIEIWTMQDGILFDNILIAKNDKVAESYRETTWKPKFEVEKEKQKAEDEAADS  421

Query  508  DGLKGYQKV  482
              L G+Q +
Sbjct  422  ARLAGFQVI  430



>ref|XP_006399216.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
 gb|ESQ40669.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
Length=441

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 2/68 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK--AEEVTD  512
            FEPIAA+GIEIWTMQDGILFDN+LIA DEKVAE+YRQT WKPKFDVEKEKQK   E   +
Sbjct  362  FEPIAAIGIEIWTMQDGILFDNVLIAKDEKVAETYRQTTWKPKFDVEKEKQKAEDEAAAE  421

Query  511  SDGLKGYQ  488
            +DGLK YQ
Sbjct  422  ADGLKSYQ  429



>sp|O82709.1|CALX_PEA RecName: Full=Calnexin homolog; Flags: Precursor [Pisum sativum]
 emb|CAA76741.1| calnexin [Pisum sativum]
Length=551

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 8/135 (6%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV--------EKEKQK  530
            FEPIAA+GIEIWTMQDGILFDN+LIA D+K+AESYR+T WKPKF++        E+    
Sbjct  370  FEPIAAIGIEIWTMQDGILFDNVLIAKDDKIAESYRETTWKPKFNIEKEKQKHEEEAAAA  429

Query  529  AEEVTDSDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPNitigvivsviv  350
            A   ++S+G+ G QK  FD LYKIAD+ FL   K KI++++EK EKQPN+TIG+IVSV++
Sbjct  430  AAARSESEGIAGIQKKAFDLLYKIADIAFLSGQKEKIIEIIEKGEKQPNLTIGIIVSVVI  489

Query  349  vvltilvklLFGGKK  305
            V ++I  +L+FGGKK
Sbjct  490  VFVSIFFRLIFGGKK  504



>ref|XP_001773069.1| predicted protein [Physcomitrella patens]
 gb|EDQ62109.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
             E +AA+GIEIWTMQDGI FDNIL+A DE VAE YR+T W+PK  VEKEK+ AE     D
Sbjct  341  LEAVAAIGIEIWTMQDGIFFDNILVAHDEAVAEEYRKTTWEPKHTVEKEKEAAEAKKSDD  400

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
                  + VF+ L KIA++PFL ++K +I  +L+KAE  PN
Sbjct  401  KADKTSEKVFEALNKIAEVPFLAKYKEQIDAVLDKAESNPN  441



>gb|KDO57646.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=470

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK  530
            FEPIAAVGIEIWTMQDGILFDNILI+ DEKVAESYR +AWKPKFDVEKEK K
Sbjct  365  FEPIAAVGIEIWTMQDGILFDNILISKDEKVAESYRASAWKPKFDVEKEKLK  416



>ref|XP_001773029.1| predicted protein [Physcomitrella patens]
 gb|EDQ62069.1| predicted protein [Physcomitrella patens]
Length=545

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-----EKEKQKAEE  521
             E +AA+GIEIWTMQDGI FDNIL+A DE VAE YR+T W+PK  V       E +K+++
Sbjct  359  LEAVAAIGIEIWTMQDGIFFDNILVAHDEAVAEEYRKTTWEPKHTVEKEKEAAEAKKSDD  418

Query  520  VTDSDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
              D   +   ++ VF+ L KIA++PFL ++K +I  +L+KAE  PN
Sbjct  419  KADKTSVDNIKEKVFEALNKIAEVPFLAKYKEQIDAVLDKAESNPN  464



>ref|XP_006280507.1| hypothetical protein CARUB_v10026443mg [Capsella rubella]
 gb|EOA13405.1| hypothetical protein CARUB_v10026443mg [Capsella rubella]
Length=431

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 2/68 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT--D  512
            +EPIAA+GIEIWTMQDGILFDNILIA DEKVAE+YRQT WKPKFDVEKEKQKAEE     
Sbjct  362  YEPIAAIGIEIWTMQDGILFDNILIAKDEKVAETYRQTTWKPKFDVEKEKQKAEEEAAGS  421

Query  511  SDGLKGYQ  488
            +DGLK YQ
Sbjct  422  ADGLKSYQ  429



>ref|XP_001756944.1| predicted protein [Physcomitrella patens]
 gb|EDQ78175.1| predicted protein [Physcomitrella patens]
Length=499

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-----EKEKQKAEE  521
             E +AA+GIEIWTMQDGILFDNIL+A DE  AE YR+  W+PK  V       E +K+E+
Sbjct  335  LEAVAAIGIEIWTMQDGILFDNILVAHDEANAEEYRKKTWEPKHAVEEEKEAAEAKKSED  394

Query  520  VTDSDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEKAEKQPN  383
              +  GL   +  VF+ L K++++PFL ++K +I D+L+KAEK  N
Sbjct  395  KPEKAGLDSIKGKVFEALNKVSEIPFLAKYKEQIDDVLDKAEKNSN  440



>gb|ABC42907.1| calnexin-like protein [Dendrobium hybrid cultivar]
Length=123

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 27/106 (25%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE-----  521
            FEPIAA+GIEIWTMQD ILFDNILI  DEKVAESYR+ A KPK+++EK K+K ++     
Sbjct  18   FEPIAAIGIEIWTMQDEILFDNILIVNDEKVAESYREKASKPKYELEKAKEKVQDAPVGL  77

Query  520  ----------------------VTDSDGLKGYQKVVFDQLYKIADL  449
                                  +T S  +   QK +FD LY++AD+
Sbjct  78   SGIQVIFQCSFPYTRLFIFFIFLTSSLIILNMQKKIFDVLYQVADV  123



>gb|ABA27008.1| TO49-2 [Taraxacum officinale]
Length=138

 Score = 84.3 bits (207),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKF  554
            FEPIAA+GIEIWTMQDGILFDNILIA+DEK AES R+T WKPKF
Sbjct  95   FEPIAAIGIEIWTMQDGILFDNILIASDEKTAESIRETTWKPKF  138



>gb|AFG48475.1| hypothetical protein CL130Contig1_06, partial [Pinus taeda]
 gb|AFG48476.1| hypothetical protein CL130Contig1_06, partial [Pinus taeda]
 gb|AFG48477.1| hypothetical protein CL130Contig1_06, partial [Pinus taeda]
Length=69

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQ  533
             EPIAA+GIEIWTMQDGILFDNILI  DEKVAE YR+  WK KF  EKE++
Sbjct  17   LEPIAAIGIEIWTMQDGILFDNILITHDEKVAEEYRKNTWKAKFSNEKEEE  67



>gb|AFW58148.1| hypothetical protein ZEAMMB73_760338 [Zea mays]
Length=299

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDV-EKEKQKAEEVTDS  509
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+DV +++++  E    +
Sbjct  226  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEAAAGA  285

Query  508  DGLKGYQKVVFDQL  467
            DGL  +Q + F  L
Sbjct  286  DGLSDFQVIHFTNL  299



>tpg|DAA38018.1| TPA: hypothetical protein ZEAMMB73_672981 [Zea mays]
Length=303

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD--  512
            F+PIAA+GIEIWTMQDGILFDNILIA DEKVA S  +  WKPK+DVEKEK+KAEE     
Sbjct  226  FDPIAAIGIEIWTMQDGILFDNILIADDEKVATSILEKTWKPKYDVEKEKEKAEEEAAAG  285

Query  511  SDGLKGYQKVVFDQL  467
            +DGL  +Q + F  L
Sbjct  286  ADGLSEFQVIHFSDL  300



>ref|XP_001765831.1| predicted protein [Physcomitrella patens]
 gb|EDQ69422.1| predicted protein, partial [Physcomitrella patens]
Length=412

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDS  509
            FE I  +GIEIWTM DGI+FDNILI  +E  A+  R   W  K  VEK+ +  E+ T S
Sbjct  330  FEKIGKIGIEIWTMDDGIIFDNILITNNETFAQQLRTQTWSEKIKVEKQSEPIEDSTLS  388



>ref|XP_005777632.1| Calnexin [Emiliania huxleyi CCMP1516]
 gb|EOD25203.1| Calnexin [Emiliania huxleyi CCMP1516]
Length=539

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAE  587
            PI  VGIE+WTMQDGILFDNIL+ATD +VAE
Sbjct  377  PIGGVGIELWTMQDGILFDNILVATDPRVAE  407



>ref|XP_005781424.1| hypothetical protein EMIHUDRAFT_442861 [Emiliania huxleyi CCMP1516]
 gb|EOD28995.1| hypothetical protein EMIHUDRAFT_442861 [Emiliania huxleyi CCMP1516]
Length=539

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAE  587
            PI  VGIE+WTMQDGILFDNIL+ATD +VAE
Sbjct  377  PIGGVGIELWTMQDGILFDNILVATDPRVAE  407



>ref|XP_002735033.1| PREDICTED: calnexin-like [Saccoglossus kowalevskii]
Length=569

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVT  515
            P +AVG+E+W+M DGI+FDN +I  D+ +A+ + +  W PK   E+ K+ AE V 
Sbjct  372  PFSAVGLELWSMSDGIIFDNFIITNDKAIADDWVEQTWVPKNYQEENKESAESVV  426



>gb|EMS52697.1| hypothetical protein TRIUR3_31072 [Triticum urartu]
Length=185

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -3

Query  646  MQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQK  530
            MQDGIL+ NILI  D KVA S  +  WKPKFDVEKEK +
Sbjct  1    MQDGILYGNILITNDYKVATSILEKTWKPKFDVEKEKSR  39



>gb|KEZ43169.1| Calnexin-like protein [Scedosporium apiospermum]
Length=561

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEK---EKQKAEE  521
            FEP+ A+G EIWTMQ  ILFDNI I    + A+     AWKPK D EK   E QK +E
Sbjct  393  FEPMGAIGFEIWTMQKDILFDNIYIGHSVEDAQKLADEAWKPKRDAEKLVEEAQKPKE  450



>ref|XP_003853151.1| calnexin protein [Zymoseptoria tritici IPO323]
 gb|EGP88127.1| calnexin protein [Zymoseptoria tritici IPO323]
Length=566

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 5/96 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEK-EKQKAEEVTDS  509
            FEP+ A+G E+WTM + ILFDNI I  DE  A+ +R       FD++K  ++KAE+ +  
Sbjct  390  FEPMGAIGFELWTMNENILFDNIYIGHDEAAAKEFRAAT----FDIKKPAEEKAEKASKP  445

Query  508  DGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEK  401
               K  +K   D ++    + ++ E     ++L +K
Sbjct  446  VEDKAEKKSPMDLVFTEDPVTYIKEKSALFIELFQK  481



>ref|XP_007805590.1| Calnexin [Endocarpon pusillum Z07020]
 gb|ERF68760.1| Calnexin [Endocarpon pusillum Z07020]
Length=572

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 4/75 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEP+ A+G EIWTMQ  ILFDNI I    + A ++R+  W    DV++  + AEE     
Sbjct  392  FEPMGAIGFEIWTMQKDILFDNIYIGHSVEDAAAFRKETW----DVKRPAEDAEEAASKP  447

Query  505  GLKGYQKVVFDQLYK  461
             L+   K   D ++K
Sbjct  448  KLEDKPKSPMDLVFK  462



>ref|XP_007413029.1| hypothetical protein MELLADRAFT_72534 [Melampsora larici-populina 
98AG31]
 gb|EGG03582.1| hypothetical protein MELLADRAFT_72534 [Melampsora larici-populina 
98AG31]
Length=560

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTD  512
            FEPIA +GIE+WTMQ+ ILFDNI I   E+ A ++ +  +  K  +EK+ + AE+  D
Sbjct  386  FEPIAGIGIELWTMQENILFDNIYIGHSEEDATAFAKETFHVKSAIEKKLEDAEKPAD  443



>ref|XP_011111038.1| hypothetical protein H072_5152 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40966.1| hypothetical protein H072_5152 [Dactylellina haptotyla CBS 200.50]
Length=594

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVE  545
            FEP+ A+G E+WTM +GILFDNI I  D K AE+ +   + PK +VE
Sbjct  411  FEPMGAIGFELWTMTEGILFDNIYIGHDPKEAEAIKVATFDPKKEVE  457



>ref|XP_008710607.1| hypothetical protein HMPREF1541_00076 [Cyphellophora europaea 
CBS 101466]
 gb|ETN45895.1| hypothetical protein HMPREF1541_00076 [Cyphellophora europaea 
CBS 101466]
Length=571

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
             EP+ A+G EIWTMQ  ILFDNI I   E+ A++ R+  W  K  +E+E++   +   SD
Sbjct  394  LEPMGAIGFEIWTMQSDILFDNIYIGHSEEDAKALREQTWAIKRPIEEEEESKTKPKPSD  453

Query  505  GLKGYQKVVFDQ  470
              K    + F +
Sbjct  454  IPKTPSGLTFQE  465



>ref|XP_007929717.1| hypothetical protein MYCFIDRAFT_50886 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME79270.1| hypothetical protein MYCFIDRAFT_50886 [Pseudocercospora fijiensis 
CIRAD86]
Length=561

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
            FEP+ A+G E+WTM + ILFDNI I  DE  A+++++  W  K   E E ++A
Sbjct  388  FEPMGAIGFELWTMNEDILFDNIYIGHDEAQAKAFKKETWDIKHPSELEAERA  440



>ref|XP_002674608.1| predicted protein [Naegleria gruberi]
 gb|EFC41864.1| predicted protein [Naegleria gruberi]
Length=1118

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = -3

Query  676   IAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA---EEVTDSD  506
             I AV IEIWTMQ    FDN +IA DE+VA  Y +  W  K  +E EK K    E   DSD
Sbjct  973   IGAVFIEIWTMQQNTFFDNFIIAHDEEVAADYAEKTWAKKHAIETEKLKKIQEENKPDSD  1032

Query  505   GLK  497
               K
Sbjct  1033  FFK  1035



>gb|EKV07146.1| hypothetical protein PDIG_74200 [Penicillium digitatum PHI26]
 gb|EKV14291.1| hypothetical protein PDIP_44680 [Penicillium digitatum Pd1]
Length=558

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
            FEP+ A+G EIWTMQ+ ILFDN+ I    + AE  RQ  +  KF +E+ +++A
Sbjct  389  FEPMGAIGFEIWTMQNDILFDNVYIGHSVEDAEKLRQETFDVKFPIEEAEEEA  441



>gb|EFA78842.1| calnexin [Polysphondylium pallidum PN500]
Length=525

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQ  533
            E I A+G+EIWTM   I FDN +I  D+  A+      W PKF +EKE+Q
Sbjct  358  EKIGAIGVEIWTMSPNIYFDNFIITHDKSEADRLAAETWAPKFKLEKERQ  407



>emb|CCG81941.1| Calnexin [Taphrina deformans PYCC 5710]
Length=564

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI+ +G E+WTMQ  ILFDNILI+ D   AE+  +  W+ KF +E+ +  A     S+
Sbjct  384  FEPISGIGFELWTMQGDILFDNILISHDVSDAETLAKD-WQTKFTIEEAEDNANAPKASE  442

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLE  404
              K  +K      +    + F+ E   + ++L++
Sbjct  443  EAK--KKYPGAPSFTTDPIGFVTEKAARFINLVQ  474



>gb|ESA03120.1| hypothetical protein GLOINDRAFT_336953 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX56726.1| Cne1p [Rhizophagus irregularis DAOM 197198w]
Length=568

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQ  533
            FE IAA+G E+WTMQ+ ILFDNI I   E+ A+ + +  W  K+ +EK+ +
Sbjct  388  FEKIAAIGFELWTMQNNILFDNIYIGHSEEDAKKFAEETWVIKYKIEKDAE  438



>ref|XP_009648869.1| calnexin [Verticillium dahliae VdLs.17]
 gb|EGY22689.1| calnexin [Verticillium dahliae VdLs.17]
Length=619

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
            FEPI A+G EIWTMQ  ILFDNI +    + AE   +  +KPK  VEK  ++A
Sbjct  367  FEPIGAIGFEIWTMQSDILFDNIYVGHSIEDAEKLAEETFKPKHAVEKSLEEA  419



>emb|CCI42590.1| unnamed protein product [Albugo candida]
Length=263

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 2/95 (2%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE--VTD  512
             +PI+AVG+EIWTM +GI FDN  IA +   A  + +  W PKF +E    K  E  + D
Sbjct  107  MDPISAVGLEIWTMSEGITFDNFYIAHNVDKAFEFGKLTWAPKFKLESAAAKESEPKLED  166

Query  511  SDGLKGYQKVVFDQLYKIADLPFLGEHKGKILDLL  407
            +  L    +V+F  +  ++  P        ++ LL
Sbjct  167  NYYLGRALEVLFHLIGLVSSDPLYAVIGAGLISLL  201



>ref|XP_004355969.1| hypothetical protein DFA_08481 [Dictyostelium fasciculatum]
 gb|EGG17485.1| hypothetical protein DFA_08481 [Dictyostelium fasciculatum]
Length=1847

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = -3

Query  682   EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSDG  503
             E I A+G+EIWT  D I FDN +I  D   A+   Q  W+PK++ EK  Q   E  ++  
Sbjct  1680  EKIGAIGLEIWTTTDQIAFDNFIITHDRDEADRIAQENWEPKYNKEKALQAEFEAEEAKK  1739

Query  502   LK  497
             L+
Sbjct  1740  LQ  1741



>gb|KIW07741.1| hypothetical protein PV09_01671 [Verruconis gallopava]
Length=574

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQ  533
            FEP+ A+G E+WTMQ+ ILFDNI +    + AE+ ++  W  K   EKE+Q
Sbjct  402  FEPMGALGFELWTMQNNILFDNIYVGHSLEDAEALKKETWDLKIAAEKEEQ  452



>ref|XP_009859719.1| PREDICTED: calnexin isoform X2 [Ciona intestinalis]
Length=571

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
              PI AVG E+W+M + I FDNILI  D +VA+ Y +  WK K  +  EK+ +
Sbjct  381  MSPIGAVGFELWSMSEDIYFDNILITDDREVADDYAEKTWKLKKQIRAEKEPS  433



>ref|XP_002127428.1| PREDICTED: calnexin isoform X3 [Ciona intestinalis]
Length=571

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
              PI AVG E+W+M + I FDNILI  D +VA+ Y +  WK K  +  EK+ +
Sbjct  381  MSPIGAVGFELWSMSEDIYFDNILITDDREVADDYAEKTWKLKKQIRAEKEPS  433



>ref|XP_009859718.1| PREDICTED: calnexin isoform X1 [Ciona intestinalis]
Length=572

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
              PI AVG E+W+M + I FDNILI  D +VA+ Y +  WK K  +  EK+ +
Sbjct  381  MSPIGAVGFELWSMSEDIYFDNILITDDREVADDYAEKTWKLKKQIRAEKEPS  433



>ref|XP_008023635.1| hypothetical protein SETTUDRAFT_168222 [Setosphaeria turcica 
Et28A]
 gb|EOA89024.1| hypothetical protein SETTUDRAFT_168222 [Setosphaeria turcica 
Et28A]
Length=567

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+G EIWTM + ILFDNI I    + AE ++   +  K  VEK +++A      D
Sbjct  391  FEPIGAIGFEIWTMSNDILFDNIYIGHSVEDAEKFKAETFDLKSPVEKAEEEASRPKPED  450

Query  505  GLKGYQKVVF  476
              K    +VF
Sbjct  451  TPKSPSDLVF  460



>ref|XP_003055258.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH60510.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=358

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -3

Query  676  IAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFD  551
            I  VG+EIWTM  G++ DN+L+A D+  A   R  AWKPK D
Sbjct  301  IGGVGLEIWTMTSGLVVDNVLVAGDDVAAGELRANAWKPKMD  342



>emb|CCI42589.1| unnamed protein product [Albugo candida]
Length=539

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
             +PI+AVG+EIWTM +GI FDN  IA +   A  + +  W PKF +E    K  E
Sbjct  383  MDPISAVGLEIWTMSEGITFDNFYIAHNVDKAFEFGKLTWAPKFKLESAAAKESE  437



>emb|CCA18171.1| calciumdependent protein 2 putative [Albugo laibachii Nc14]
Length=539

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
             +PI+AVG+EIWTM +GI FDN  IA +   A  + +  W+PKF  E+   K  E
Sbjct  383  MDPISAVGLEIWTMSEGITFDNFYIAHNVDKAFEFAKLTWEPKFKAEEAVAKESE  437



>ref|XP_008910920.1| hypothetical protein PPTG_15911 [Phytophthora parasitica INRA-310]
 gb|ETL32858.1| hypothetical protein L916_14641 [Phytophthora parasitica]
 gb|ETL86118.1| hypothetical protein L917_14444 [Phytophthora parasitica]
 gb|ETM39267.1| hypothetical protein L914_14585 [Phytophthora parasitica]
 gb|ETN03693.1| hypothetical protein PPTG_15911 [Phytophthora parasitica INRA-310]
 gb|ETO67980.1| hypothetical protein F444_15164 [Phytophthora parasitica P1976]
 gb|ETP09151.1| hypothetical protein F441_14995 [Phytophthora parasitica CJ01A1]
Length=557

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKE  539
             +PI A+ +E+WTM DGI FDN  +  D K A+ + +  W PK  VE E
Sbjct  402  LDPIGALAVEVWTMTDGITFDNFWLGNDLKKAQEFAELTWAPKHAVEVE  450



>gb|ETI39239.1| hypothetical protein F443_15186 [Phytophthora parasitica P1569]
 gb|ETK79446.1| hypothetical protein L915_14727 [Phytophthora parasitica]
 gb|ETP37183.1| hypothetical protein F442_15019 [Phytophthora parasitica P10297]
Length=557

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKE  539
             +PI A+ +E+WTM DGI FDN  +  D K A+ + +  W PK  VE E
Sbjct  402  LDPIGALAVEVWTMTDGITFDNFWLGNDLKKAQEFAELTWAPKHAVEVE  450



>gb|KEQ88681.1| calnexin-like protein [Aureobasidium pullulans EXF-150]
Length=582

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEP+ A+G E+WTMQ+ ILFDNI I   EK A +  +  ++ K  VEK++++A +    D
Sbjct  402  FEPMGAIGFELWTMQNDILFDNIYIGHSEKDAAALAKETFEVKSAVEKQEEEATK-PKKD  460

Query  505  GLKGYQKVVFDQLYKIADLPFL  440
              K   K   D   K AD P L
Sbjct  461  ETKDTPKSPMD--LKFADDPVL  480



>ref|XP_011121725.1| hypothetical protein AOL_s00078g160 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX49671.1| hypothetical protein AOL_s00078g160 [Arthrobotrys oligospora 
ATCC 24927]
Length=586

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE---VT  515
            FEPI A+G E+WTM +GILFDNI I    + AE+ ++  +  K  +EKE+ +A +    T
Sbjct  403  FEPIGAIGFELWTMSNGILFDNIYIGHSVEEAEALQKATFDVKKAIEKEEDEATQPKPPT  462

Query  514  DSDGLK  497
            D D  K
Sbjct  463  DEDDAK  468



>dbj|GAE00076.1| calnexin precursor [Byssochlamys spectabilis No. 5]
Length=562

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE +RQ      FD++   + AEE
Sbjct  394  FEPMGAIGFEIWTMQNDILFDNIYIGHSIEDAEKFRQET----FDIKHPIEVAEE  444



>gb|EEQ88189.1| calnexin [Blastomyces dermatitidis ER-3]
 gb|EGE86508.1| calnexin [Blastomyces dermatitidis ATCC 18188]
 gb|EQL28292.1| calnexin [Blastomyces dermatitidis ATCC 26199]
Length=560

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  +   W  K  VE  +++A    D +
Sbjct  395  FEPMGAIGFEIWTMQNDILFDNIYIGHSVEDAEKLKAETWDLKHPVEVAEEEAARPKDEE  454

Query  505  GLKG  494
              +G
Sbjct  455  KKEG  458



>ref|XP_002627579.1| calnexin [Blastomyces dermatitidis SLH14081]
 gb|EEQ75219.1| calnexin [Blastomyces dermatitidis SLH14081]
Length=560

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  +   W  K  VE  +++A    D +
Sbjct  395  FEPMGAIGFEIWTMQNDILFDNIYIGHSVEDAEKLKAETWDLKHPVEVAEEEAARPKDEE  454

Query  505  GLKG  494
              +G
Sbjct  455  KKEG  458



>gb|EFX05243.1| calnexin precursor [Grosmannia clavigera kw1407]
Length=561

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+G EIWTMQ+ ILFDNI I    + A  + +  +  K  VEK  ++AE+    D
Sbjct  394  FEPIGAIGFEIWTMQNDILFDNIYIGHSVEDARKFAEETYFQKITVEKAVEQAEKPKAED  453

Query  505  GLKGYQKVVFDQ  470
              K    + F +
Sbjct  454  KPKSLADLKFTE  465



>dbj|GAM18605.1| hypothetical protein SAMD00019534_017800 [Acytostelium subglobosum 
LB1]
Length=521

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQ  533
            E I AVGIE+WTM  GILFDN +I  D++ A+      + PK +VEK++Q
Sbjct  359  EKIGAVGIEVWTMSSGILFDNFIITYDDEEAKRLADETFFPKSEVEKQRQ  408



>ref|XP_005792888.1| hypothetical protein EMIHUDRAFT_49942, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD40459.1| hypothetical protein EMIHUDRAFT_49942, partial [Emiliania huxleyi 
CCMP1516]
Length=77

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATD  602
            PI  +GIE+WTMQDG LFDNILI+TD
Sbjct  52   PIGGIGIELWTMQDGALFDNILISTD  77



>gb|EKG22397.1| Calreticulin/calnexin [Macrophomina phaseolina MS6]
Length=563

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+G EIWTMQ  ILFDNI I    + AE+ +    K  +DV+   +KAEE     
Sbjct  389  FEPIGAIGFEIWTMQKDILFDNIYIGHSVEDAETLK----KETYDVKITAEKAEEEASKP  444

Query  505  GLKGYQKVVFDQLYKIADLPFLGEHKGKILDLLEK  401
                  K   D  +K     ++ E      +LL K
Sbjct  445  KSDDKAKSPLDLSFKDDPAKYVKERTALFFELLPK  479



>gb|KGO73367.1| Concanavalin A-like lectin/glucanases superfamily [Penicillium 
italicum]
Length=545

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
             EP+ A+G EIWTMQ+ ILFDN+ I    + AE  RQ  +  KF +E+ +++A
Sbjct  376  LEPMGAIGFEIWTMQNDILFDNVYIGHSVEDAEKLRQETFDVKFPIEEAEEEA  428



>ref|XP_004455355.1| PREDICTED: calreticulin-3 [Dasypus novemcinctus]
Length=265

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKE  539
            FE I A+G+E+W ++ G +FDN LI  DE+ AES+ +  W    D E+E
Sbjct  175  FENIGAIGLELWQVRSGTIFDNFLITDDEEYAESFGKATWGQTKDPERE  223



>dbj|GAA81928.1| calnexin precursor [Aspergillus kawachii IFO 4308]
Length=562

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI +    + AE  RQ      FDV+   + AEE
Sbjct  393  FEPMGAIGFEIWTMQNDILFDNIYVGHSAEDAEKLRQET----FDVKHPVELAEE  443



>gb|EPS33667.1| hypothetical protein PDE_08629 [Penicillium oxalicum 114-2]
Length=561

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 0/72 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
             EP+ A+G EIWTMQ+ ILFDNI I    + AE  R+  +  KF +E+ +++A +    D
Sbjct  392  LEPMGAIGFEIWTMQNDILFDNIYIGHSVEEAEQLRKETFDVKFPIEEAEEEASKPKPED  451

Query  505  GLKGYQKVVFDQ  470
                   V F +
Sbjct  452  AAPEGPTVSFKE  463



>ref|XP_005536371.1| calnexin [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80085.1| calnexin [Cyanidioschyzon merolae strain 10D]
Length=660

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 3/63 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDE---KVAESYRQTAWKPKFDVEKEKQKAEEVT  515
             +P+ AVGIEIWTM  GI FDNIL  +     +VA+ +    W  K  VEKE++++ +  
Sbjct  429  LQPVTAVGIEIWTMDQGIAFDNILFLSGSEAAQVADEFAVQTWAKKVKVEKEREESRKPK  488

Query  514  DSD  506
             +D
Sbjct  489  ATD  491



>gb|KGO37689.1| Concanavalin A-like lectin/glucanase, subgroup [Penicillium expansum]
 gb|KGO49960.1| Concanavalin A-like lectin/glucanase, subgroup [Penicillium expansum]
 gb|KGO73547.1| Concanavalin A-like lectin/glucanase, subgroup [Penicillium expansum]
Length=558

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
             EP+ A+G EIWTMQ+ ILFDN+ I    + AE  RQ  +  KF +E+ +++A
Sbjct  389  LEPMGAIGFEIWTMQNDILFDNVYIGHSVEDAEKLRQETFDVKFPIEEAEEEA  441



>ref|XP_003324724.1| calnexin [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP80305.1| calnexin [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=556

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
            FEP+A +G E+WTMQ+ ILFDNI I   EK A  + +  +  K  VEK+ + A
Sbjct  385  FEPMAGIGFELWTMQENILFDNIYIGHSEKDAADFAKETFHVKVAVEKKLEDA  437



>ref|XP_009060914.1| hypothetical protein LOTGIDRAFT_219285 [Lottia gigantea]
 gb|ESO88512.1| hypothetical protein LOTGIDRAFT_219285 [Lottia gigantea]
Length=582

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 8/69 (12%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSDGL  500
            PI+A+G+E+W+M D I+FDN LI  D  VA+++ Q++W  K          EE   S GL
Sbjct  415  PISALGLELWSMTDDIVFDNFLITDDLDVAQTWSQSSWVIK--------NMEEKASSGGL  466

Query  499  KGYQKVVFD  473
                  + D
Sbjct  467  SSIYNSIMD  475



>ref|XP_661196.1| hypothetical protein AN3592.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59800.1| hypothetical protein AN3592.2 [Aspergillus nidulans FGSC A4]
Length=565

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  R    K  FD+++  ++AEE
Sbjct  396  FEPMGAIGFEIWTMQNDILFDNIYIGHSVEDAEKLR----KETFDIKRPIEEAEE  446



>ref|XP_001389264.1| calnexin protein [Aspergillus niger CBS 513.88]
 emb|CAC82717.1| calnexin [Aspergillus niger]
 emb|CAK43931.1| unnamed protein product [Aspergillus niger]
 gb|EHA26696.1| hypothetical protein ASPNIDRAFT_205810 [Aspergillus niger ATCC 
1015]
Length=562

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI +    + AE  RQ      FDV+   + AEE
Sbjct  393  FEPMGAIGFEIWTMQNDILFDNIYVGHSAEDAEKLRQET----FDVKHPIELAEE  443



>tpe|CBF75819.1| TPA: calnexin, putative (Eurofung) [Aspergillus nidulans FGSC 
A4]
Length=561

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  R    K  FD+++  ++AEE
Sbjct  392  FEPMGAIGFEIWTMQNDILFDNIYIGHSVEDAEKLR----KETFDIKRPIEEAEE  442



>dbj|GAM85986.1| hypothetical protein ANO11243_039960 [fungal sp. No.11243]
Length=583

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 4/56 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEV  518
            FEP+ A+G E+WTMQ+ ILFDNI I    + AE  +    K  FDV+KE +K EE 
Sbjct  405  FEPMGAIGFELWTMQNDILFDNIYIGHSVEEAEKLQ----KETFDVKKEIEKQEEA  456



>ref|XP_009019390.1| hypothetical protein HELRODRAFT_184962 [Helobdella robusta]
 gb|ESO01982.1| hypothetical protein HELRODRAFT_184962 [Helobdella robusta]
Length=574

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 10/75 (13%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
              PI A+G+E+W+M + I+FDN +I T ++ A+ Y +  W  K         +EE +DS 
Sbjct  412  MSPIGAIGLELWSMSNDIVFDNFIITTSKQTADEYAKQTWSIKH--------SEEASDSA  463

Query  505  GLKGYQKVVFDQLYK  461
            G  G+ + V D  ++
Sbjct  464  G--GFMQSVVDATHE  476



>ref|XP_645704.1| hypothetical protein DDB_G0271144 [Dictyostelium discoideum AX4]
 gb|EAL71702.1| hypothetical protein DDB_G0271144 [Dictyostelium discoideum AX4]
Length=536

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -3

Query  682  EPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSDG  503
            EPI AVGIE+ +    ILFDN +I   ++ A+   Q  WK K  ++KE+Q A+   D+  
Sbjct  362  EPIIAVGIEVLSNTRDILFDNFIITHSQEEAQQLLQENWKEKHTIQKERQAAKNAEDAKK  421

Query  502  LKGYQKVVFDQL  467
            L   Q  +F+ +
Sbjct  422  LDPSQGDIFETI  433



>gb|EYE92779.1| calnexin precursor [Aspergillus ruber CBS 135680]
Length=557

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  R    K  FDV++  + A+E
Sbjct  393  FEPMGAIGFEIWTMQNDILFDNIYIGHSAEDAEKLR----KETFDVKRPVEAAQE  443



>gb|KEQ65971.1| Calreticulin-domain-containing protein, partial [Aureobasidium 
melanogenum CBS 110374]
Length=537

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 3/82 (4%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEP+ A+G E+WTMQ+ ILFDNI I   EK A +  +  ++ K  VEK +++A +    D
Sbjct  363  FEPMGAIGFELWTMQNDILFDNIYIGHSEKDAAALAKETFEVKNAVEKAEEEATK-PKKD  421

Query  505  GLKGYQKVVFDQLYKIADLPFL  440
              K   K   D   K AD P L
Sbjct  422  ETKDTPKSPMD--LKFADDPVL  441



>gb|KFH63342.1| calnexin [Mortierella verticillata NRRL 6337]
Length=580

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 1/68 (1%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKE-KQKAEEVTDS  509
            F+ I AVG EIWTMQ  ILFDNI I   EK AE+     W+ K   EK+ ++KA    D 
Sbjct  405  FDKIGAVGFEIWTMQKDILFDNIYIGHSEKDAEALAAETWEIKHATEKKLEEKANPRPDE  464

Query  508  DGLKGYQK  485
                 +QK
Sbjct  465  PEALSFQK  472



>ref|XP_007582295.1| putative calnexin protein [Neofusicoccum parvum UCRNP2]
 gb|EOD50245.1| putative calnexin protein [Neofusicoccum parvum UCRNP2]
Length=560

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
            FEPI A+G EIWTMQ  ILFDNI +    + AE+ ++ A+  K  VEK +++A
Sbjct  386  FEPIGAIGFEIWTMQKDILFDNIYVGHSIEDAETLQKEAFDVKIAVEKAEEEA  438



>gb|KGK40585.1| hypothetical protein JL09_g184 [Pichia kudriavzevii]
Length=565

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSDGL  500
            PI  +G E+WTM   ILFDNI +    + AE      + PK +VE E   ++  TDSDG+
Sbjct  379  PIGGIGFELWTMDKNILFDNIYLGHSIEEAEKIGNDTFIPKIEVEYELLGSKS-TDSDGM  437

Query  499  KGYQKVVFDQLYK  461
                K ++  LY 
Sbjct  438  VPADKPIYSDLYN  450



>gb|EMS65078.1| Calnexin-like protein 1 [Triticum urartu]
Length=111

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATD  602
            F+PIAA+GIEIWTM DGI++ NIL A D
Sbjct  84   FDPIAAIGIEIWTMHDGIVYGNILFADD  111



>ref|XP_001816793.1| calnexin protein [Aspergillus oryzae RIB40]
 dbj|BAE54791.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=562

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  R    K  FDV+   + AEE
Sbjct  393  FEPMGAIGFEIWTMQNDILFDNIYIGHSPEDAEQLR----KETFDVKHPVEVAEE  443



>ref|XP_007872324.1| hypothetical protein PNEG_00446 [Pneumocystis murina B123]
 ref|XP_007872325.1| hypothetical protein, variant [Pneumocystis murina B123]
 gb|EMR11423.1| hypothetical protein PNEG_00446 [Pneumocystis murina B123]
 gb|EMR11424.1| hypothetical protein, variant [Pneumocystis murina B123]
Length=562

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 5/84 (6%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA-----EE  521
            FE I  VG E+WTMQ  ILFDNI I    + AE + +T ++ K++ E++++K      E 
Sbjct  393  FETIIGVGFELWTMQSDILFDNIYIGHSVEEAEQFAKTTFQVKYEYERKQEKGITPEPEV  452

Query  520  VTDSDGLKGYQKVVFDQLYKIADL  449
            V D    + Y  V   ++    DL
Sbjct  453  VLDDVAKESYFDVAVKKVTTFVDL  476



>gb|KHO00046.1| calreticulin [Metarhizium album ARSEF 1941]
Length=562

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE     ++K K  VEK   +A++  + D
Sbjct  390  FEPMGAIGFEIWTMQNDILFDNIYIGHSIEDAEKLAAESFKLKHPVEKALAEADKPKEDD  449

Query  505  GLKGYQKVVF  476
              K    + F
Sbjct  450  KPKSPSDLKF  459



>ref|XP_002383280.1| calnexin [Aspergillus flavus NRRL3357]
 gb|EED47100.1| calnexin [Aspergillus flavus NRRL3357]
 gb|EIT72779.1| calnexin [Aspergillus oryzae 3.042]
Length=562

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 34/55 (62%), Gaps = 4/55 (7%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEE  521
            FEP+ A+G EIWTMQ+ ILFDNI I    + AE  R    K  FDV+   + AEE
Sbjct  393  FEPMGAIGFEIWTMQNDILFDNIYIGHSPEDAEQLR----KETFDVKHPVEVAEE  443



>ref|XP_005710568.1| Calnexin [Chondrus crispus]
 emb|CDF40274.1| Calnexin [Chondrus crispus]
Length=583

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (54%), Gaps = 7/84 (8%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAW--KPKFDVEKE-----KQKAEE  521
            P+  +G EIWTM  G+LFDN+ + +D   AE +R+  +  K K ++E+E     K +AEE
Sbjct  389  PVHGLGFEIWTMDQGVLFDNVWLGSDISAAEKFRKATFVEKQKTELEREEEANKKAEAEE  448

Query  520  VTDSDGLKGYQKVVFDQLYKIADL  449
                 G  G    + D++    D+
Sbjct  449  KVSRGGRDGKVGAILDKMEDAVDM  472



>emb|CDR42027.1| CYFA0S08e02762g1_1 [Cyberlindnera fabianii]
Length=553

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKE  539
             EPI  +G E+W+M   ILFDNI +      AE      WKPK+D+E+E
Sbjct  384  LEPIGGIGFELWSMDGDILFDNIYLGHSVDEAELLGNATWKPKYDLEQE  432



>ref|XP_004688704.1| PREDICTED: calreticulin-3 [Condylura cristata]
Length=385

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEK---QKAEEV  518
            FE I A+G+E+W ++ G +FDN LI  DE+ AE++ +  W    D E+E    Q  EEV
Sbjct  295  FENIGAIGLELWQVRSGTIFDNFLITDDEEYAENFGRATWGETKDPEREMDAIQAKEEV  353



>ref|XP_007709681.1| hypothetical protein COCCADRAFT_24118 [Bipolaris zeicola 26-R-13]
 gb|EUC35957.1| hypothetical protein COCCADRAFT_24118 [Bipolaris zeicola 26-R-13]
 gb|EUN23242.1| hypothetical protein COCVIDRAFT_109339 [Bipolaris victoriae FI3]
Length=566

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+G EIWTM   ILFDNI I    + AE ++   +  K   EK +++A +    D
Sbjct  390  FEPIGAIGFEIWTMSKDILFDNIYIGHSIEDAEKFKADTFDIKHPAEKAEEEATKPKSED  449

Query  505  GLKGYQKVVF  476
              K    +VF
Sbjct  450  KPKSPSDLVF  459



>gb|EMD94330.1| hypothetical protein COCHEDRAFT_1130883 [Bipolaris maydis C5]
 gb|ENI07372.1| hypothetical protein COCC4DRAFT_132061 [Bipolaris maydis ATCC 
48331]
Length=566

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+G EIWTM   ILFDNI I    + AE ++   +  K   EK +++A +    D
Sbjct  390  FEPIGAIGFEIWTMSKDILFDNIYIGHSIEDAEKFKAETFDIKHPAEKAEEEATKPKSED  449

Query  505  GLKGYQKVVF  476
              K    +VF
Sbjct  450  KPKSPSDLVF  459



>ref|XP_007701102.1| hypothetical protein COCSADRAFT_38208 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63354.1| hypothetical protein COCSADRAFT_38208 [Bipolaris sorokiniana 
ND90Pr]
Length=566

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSD  506
            FEPI A+G EIWTM   ILFDNI I    + AE ++   +  K   EK +++A +    D
Sbjct  390  FEPIGAIGFEIWTMSKDILFDNIYIGHSIEDAEKFKAETFDIKHPAEKAEEEATKPKSED  449

Query  505  GLKGYQKVVF  476
              K    +VF
Sbjct  450  KPKSPSDLVF  459



>ref|XP_003701110.1| PREDICTED: calreticulin-like [Megachile rotundata]
Length=403

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  676  IAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAE  524
            I A+G ++W ++ G +FDN+LI  D +VA  + +  WKP F+ EK+ ++A+
Sbjct  310  ICAIGFDLWQVKSGTIFDNVLITDDPEVARKFGEDVWKPTFEGEKKMKEAQ  360



>gb|KEQ92935.1| hypothetical protein AUEXF2481DRAFT_42635 [Aureobasidium subglaciale 
EXF-2481]
Length=583

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKA  527
            FEP+ A+G E+WTMQ+ ILFDNI I   EK A +  +  ++ K  VEK +++A
Sbjct  403  FEPMGAIGFELWTMQNDILFDNIYIGHSEKDAAALAKETFEVKNAVEKAEEEA  455



>ref|XP_002598323.1| hypothetical protein BRAFLDRAFT_204584 [Branchiostoma floridae]
 gb|EEN54335.1| hypothetical protein BRAFLDRAFT_204584, partial [Branchiostoma 
floridae]
Length=485

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = -3

Query  679  PIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEKQKAEEVTDSDGL  500
            PIAAVG+E+W M + +LFDN +I  ++ VA+ + + +WK K   E+ ++KA    +S   
Sbjct  338  PIAAVGLELWAMTEDVLFDNFIITNEKTVADEWAKASWKLK-SHEEAREKAASFIESIVF  396

Query  499  KGYQK  485
              Y++
Sbjct  397  AAYER  401



>ref|XP_003123521.1| PREDICTED: calreticulin-3 [Sus scrofa]
Length=384

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = -3

Query  685  FEPIAAVGIEIWTMQDGILFDNILIATDEKVAESYRQTAWKPKFDVEKEK---QKAEEV  518
            FE I A+G+E+W ++ G +FDN LI  DE+ AE++ +  W    D E+E    Q  EEV
Sbjct  294  FENIGAIGLELWQVRSGTIFDNFLITDDEEYAENFGKATWGETKDPEREMDAIQAKEEV  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700