BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045N12

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                251   2e-81   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          250   6e-77   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                250   6e-77   Ipomoea batatas [batate]
gb|AFR42412.1|  catalase                                                209   2e-65   Eperua falcata
gb|AFR42410.1|  catalase                                                207   1e-64   Eperua falcata
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      209   4e-61   Nicotiana tomentosiformis
dbj|BAH20283.1|  AT1G20620                                              194   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      203   5e-59   Nicotiana sylvestris
gb|ABY19573.1|  catalase                                                197   5e-59   Manihot esculenta [manioc]
gb|AGC65520.1|  catalase                                                202   7e-59   Eriobotrya japonica [loquat]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      202   8e-59   Prunus mume [ume]
gb|AAX84671.1|  catalase CAT2                                           196   8e-59   Manihot esculenta [manioc]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             202   9e-59   Prunus persica
emb|CAD42908.1|  catalase                                               202   9e-59   Prunus persica
gb|KJB57963.1|  hypothetical protein B456_009G187600                    202   2e-58   Gossypium raimondii
emb|CAB56850.1|  catalase                                               200   2e-58   Prunus persica
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 201   2e-58   Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 201   3e-58   Elaeis guineensis
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               201   3e-58   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001289779.1|  catalase isozyme 1                                 200   6e-58   Nelumbo nucifera [Indian lotus]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 200   6e-58   Eucalyptus grandis [rose gum]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      200   7e-58   
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      200   7e-58   
ref|XP_002306976.2|  catalase family protein                            200   7e-58   
gb|AAB88173.1|  catalase                                                195   8e-58   Glycine max [soybeans]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                199   1e-57   Citrus sinensis [apfelsine]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      199   1e-57   Populus euphratica
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             199   1e-57   Citrus clementina [clementine]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 199   2e-57   Prunus mume [ume]
gb|KJB14249.1|  hypothetical protein B456_002G115900                    195   2e-57   Gossypium raimondii
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         199   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      198   4e-57   Elaeis guineensis
gb|AIS20825.1|  CAT                                                     198   5e-57   Pyrus x bretschneideri [bai li]
gb|AAM97542.1|  catalase 3                                              198   5e-57   Capsicum annuum
gb|ADC95629.1|  catalase                                                197   6e-57   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 197   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      197   7e-57   
ref|XP_010498496.1|  PREDICTED: catalase-3                              197   7e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 197   7e-57   Nicotiana sylvestris
ref|XP_009110221.1|  PREDICTED: catalase-3                              197   7e-57   Brassica rapa
ref|XP_002301920.1|  catalase family protein                            197   8e-57   Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               197   8e-57   Populus deltoides
gb|ABR15776.1|  catalase                                                192   1e-56   Litchi
ref|NP_001031072.3|  catalase 3                                         194   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      197   1e-56   Eucalyptus grandis [rose gum]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    197   1e-56   Arabis alpina [alpine rockcress]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          197   1e-56   Avicennia marina
emb|CAD42909.1|  catalase                                               197   1e-56   Prunus persica
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             197   1e-56   Prunus persica
gb|ACJ11733.1|  catalase                                                197   1e-56   Gossypium hirsutum [American cotton]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 197   1e-56   Populus euphratica
emb|CDY29519.1|  BnaA06g14510D                                          196   2e-56   Brassica napus [oilseed rape]
emb|CDY33636.1|  BnaC08g19360D                                          196   2e-56   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         196   2e-56   Brassica rapa
ref|XP_010061175.1|  PREDICTED: catalase-like                           196   2e-56   Eucalyptus grandis [rose gum]
emb|CDY31488.1|  BnaC05g15970D                                          196   2e-56   Brassica napus [oilseed rape]
gb|AAR84578.1|  catalase 1a                                             196   2e-56   Lotus japonicus
gb|AGV54297.1|  peroxisomal catalase                                    196   2e-56   Phaseolus vulgaris [French bean]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             196   3e-56   Phaseolus vulgaris [French bean]
ref|XP_009149539.1|  PREDICTED: catalase-3                              197   3e-56   Brassica rapa
dbj|BAF91369.1|  catalase                                               196   3e-56   Capsicum annuum
gb|AAG43363.1|AF151368_1  catalase                                      196   3e-56   Hevea brasiliensis [jebe]
gb|AJE26131.1|  catalase                                                196   3e-56   Salix matsudana [tortured willow]
emb|CDP07287.1|  unnamed protein product                                196   4e-56   Coffea canephora [robusta coffee]
ref|NP_001237571.1|  catalase-4                                         196   4e-56   Glycine max [soybeans]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 196   4e-56   Phoenix dactylifera
emb|CDY01364.1|  BnaA07g11370D                                          197   4e-56   
gb|AIX10947.1|  putative catalase                                       195   4e-56   Gardenia jasminoides
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      195   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG25152.1|  Catalase isozyme 1                                      195   5e-56   Gossypium arboreum [tree cotton]
ref|NP_001240021.1|  catalase                                           195   6e-56   Glycine max [soybeans]
gb|AET97564.1|  catalase                                                195   6e-56   Ziziphus jujuba [Chinese jujube]
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      195   6e-56   Nelumbo nucifera [Indian lotus]
gb|AHF27428.1|  catalase                                                191   6e-56   Cucurbita moschata [ayote]
gb|ACJ73905.1|  CAT1                                                    186   6e-56   Solanum nigrum
dbj|BAH20307.1|  AT1G20620                                              194   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           195   7e-56   Sesamum indicum [beniseed]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    195   7e-56   Gossypium raimondii
gb|AGE15298.2|  catalase 1                                              195   8e-56   Eriobotrya japonica [loquat]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             195   8e-56   Phaseolus vulgaris [French bean]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           194   8e-56   
emb|CDY31878.1|  BnaC07g15280D                                          194   8e-56   Brassica napus [oilseed rape]
ref|NP_001268098.1|  catalase                                           194   9e-56   Vitis vinifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 194   9e-56   Vitis vinifera
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     196   9e-56   Eucalyptus grandis [rose gum]
gb|AAM65021.1|  unknown                                                 194   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530333.1|  PREDICTED: catalase-2                              194   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      194   1e-55   Phoenix dactylifera
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      194   1e-55   Vitis vinifera
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          194   1e-55   Soldanella alpina
ref|NP_564120.1|  catalase 3                                            194   1e-55   Arabidopsis thaliana [mouse-ear cress]
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    194   1e-55   Capsicum annuum
dbj|BAC79443.1|  catalase                                               194   1e-55   Acacia ampliceps
emb|CCP37650.1|  catalase-1                                             194   2e-55   Nicotiana tabacum [American tobacco]
gb|AFU48609.1|  catalase 1                                              194   2e-55   Nicotiana benthamiana
gb|ACL27272.1|  catalase                                                194   2e-55   Nicotiana benthamiana
emb|CAC04509.1|  catalase                                               187   2e-55   Digitalis lanata [Grecian foxglove]
gb|AAA57551.1|  catalase                                                191   2e-55   Nicotiana sylvestris
emb|CAA10286.1|  catalase                                               183   2e-55   Cicer arietinum [garbanzo]
gb|AIA61608.1|  catalase                                                193   3e-55   Gynostemma pentaphyllum [jiaogulan]
ref|XP_010094556.1|  Catalase isozyme 1                                 193   3e-55   Morus notabilis
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      193   3e-55   Cucumis melo [Oriental melon]
gb|AAB62892.1|  catalase-1                                              193   3e-55   Nicotiana glutinosa
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             193   4e-55   Eutrema salsugineum [saltwater cress]
gb|AAB71764.1|  catalase 1                                              193   4e-55   Nicotiana tabacum [American tobacco]
gb|ACV30589.1|  catalase                                                184   4e-55   Carica papaya [mamon]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         193   4e-55   Tarenaya hassleriana [spider flower]
dbj|BAJ33995.1|  unnamed protein product                                193   4e-55   Eutrema halophilum
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             192   5e-55   Capsella rubella
emb|CDP07288.1|  unnamed protein product                                192   5e-55   Coffea canephora [robusta coffee]
gb|AFU90822.1|  catalase                                                192   5e-55   Populus tomentosa [Chinese white poplar]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          192   6e-55   Amborella trichopoda
ref|XP_007018034.1|  Catalase 2                                         192   6e-55   
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               192   6e-55   Ricinus communis
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               192   6e-55   Gossypium hirsutum [American cotton]
gb|AAF19965.1|AF207906_1  catalase 1                                    192   6e-55   Zantedeschia aethiopica [arum-lily]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               192   7e-55   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             192   7e-55   Citrus clementina [clementine]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 192   7e-55   Manihot esculenta [manioc]
gb|AFU90823.1|  catalase                                                191   7e-55   Populus x beijingensis
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               192   7e-55   Ricinus communis
gb|AEQ30070.1|  catalase                                                192   8e-55   Litchi chinensis [litchi]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      192   8e-55   Citrus sinensis [apfelsine]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          192   8e-55   Amborella trichopoda
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      192   8e-55   Solanum lycopersicum
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      192   9e-55   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      192   9e-55   Nicotiana tomentosiformis
gb|ACV92695.1|  catalase                                                192   9e-55   Brassica oleracea
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             192   1e-54   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          192   1e-54   Solanum melongena [aubergine]
dbj|BAQ21275.1|  catalase                                               191   1e-54   Citrus tamurana
emb|CAA64220.1|  catalase                                               192   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      192   1e-54   Nicotiana sylvestris
emb|CDX76313.1|  BnaA08g10870D                                          191   1e-54   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    191   1e-54   Nicotiana tabacum [American tobacco]
gb|AAB86582.2|  catalase                                                191   1e-54   Raphanus sativus
gb|AAD37788.1|AF149283_1  catalase 1                                    190   1e-54   Phaseolus vulgaris [French bean]
gb|AAF71742.1|AF248491_1  catalase                                      191   1e-54   Raphanus sativus
ref|NP_001291326.1|  catalase isozyme 1                                 191   1e-54   Sesamum indicum [beniseed]
gb|AAD30292.1|AF139539_1  catalase 3                                    191   1e-54   Raphanus sativus
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             191   1e-54   Capsella rubella
emb|CAA45564.1|  catalase                                               191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         191   2e-54   Tarenaya hassleriana [spider flower]
gb|ACA50528.1|  putative catalase 2                                     191   2e-54   Brassica napus [oilseed rape]
gb|AAK96854.1|  catalase                                                191   2e-54   Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 191   2e-54
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              191   2e-54   
ref|NP_195235.1|  catalase 2                                            191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              191   2e-54   Cicer arietinum [garbanzo]
ref|NP_001237556.1|  catalase-1/2                                       191   2e-54   Glycine max [soybeans]
gb|AAD30291.2|AF139538_1  catalase 2                                    191   2e-54   Raphanus sativus
gb|ACJ76836.3|  catalase                                                191   2e-54   Dimocarpus longan [longan]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      191   2e-54   Nicotiana sylvestris
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       191   2e-54   Cucumis sativus [cucumbers]
gb|AAD17935.1|  catalase                                                191   2e-54   Brassica juncea [brown mustard]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               191   2e-54   Cucurbita pepo
gb|ACB11496.1|  catalase                                                191   2e-54   Pinus sylvestris [Scotch pine]
ref|XP_009138342.1|  PREDICTED: catalase-2                              191   3e-54   Brassica rapa
prf||2104177A  catalase                                                 191   3e-54
gb|KFK30147.1|  catalase                                                191   3e-54   Arabis alpina [alpine rockcress]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          191   3e-54   Helianthus annuus
emb|CDY40645.1|  BnaA03g53180D                                          191   3e-54   Brassica napus [oilseed rape]
gb|AAD17936.1|  catalase                                                191   3e-54   Brassica juncea [brown mustard]
gb|AAC48918.1|  salicylic acid binding catalase                         190   3e-54   Nicotiana tabacum [American tobacco]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      190   4e-54   Nicotiana tomentosiformis
gb|AAC49807.1|  catalase 3                                              190   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             190   4e-54   
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               190   5e-54   Gossypium hirsutum [American cotton]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             190   5e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 190   5e-54   Solanum tuberosum [potatoes]
gb|KHG12976.1|  Catalase isozyme 2                                      190   6e-54   Gossypium arboreum [tree cotton]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                190   6e-54   Erythranthe guttata [common monkey flower]
gb|AAR14052.2|  catalase                                                189   6e-54   Solanum tuberosum [potatoes]
emb|CDY17510.1|  BnaC03g65530D                                          189   6e-54   Brassica napus [oilseed rape]
emb|CDX72514.1|  BnaC07g45360D                                          189   6e-54   
ref|XP_011022275.1|  PREDICTED: catalase-like                           189   7e-54   Populus euphratica
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               189   7e-54   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001234186.1|  catalase isozyme 2                                 189   8e-54   
gb|AAF79625.1|AC027665_26  F5M15.5                                      194   9e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              189   1e-53   Populus euphratica
ref|NP_001235974.1|  catalase-3                                         189   1e-53   Glycine max [soybeans]
gb|ABM47415.1|  catalase                                                189   1e-53   Prunus avium [gean]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 189   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              189   2e-53   Populus euphratica
ref|XP_009106100.1|  PREDICTED: catalase-2                              189   2e-53   Brassica rapa
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          189   2e-53   Vigna radiata var. radiata [golden gram]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      189   2e-53   
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      189   2e-53   Phoenix dactylifera
gb|ABK24453.1|  unknown                                                 189   2e-53   Picea sitchensis
gb|AHF27430.1|  catalase                                                188   2e-53   Cucurbita moschata [ayote]
gb|AHF27433.1|  catalase                                                188   2e-53   Cucurbita maxima [Boston marrow]
emb|CDP01803.1|  unnamed protein product                                188   2e-53   Coffea canephora [robusta coffee]
ref|XP_007046520.1|  Catalase 2                                         188   2e-53   Theobroma cacao [chocolate]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      188   2e-53   Solanum tuberosum [potatoes]
gb|AHF21552.1|  catalase                                                188   2e-53   Hylocereus undatus [dragon fruit]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      188   3e-53   Elaeis guineensis
gb|ACJ73906.1|  CAT2                                                    183   3e-53   Solanum nigrum
ref|XP_002890395.1|  F5M15.5                                            192   5e-53   
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         187   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010437527.1|  PREDICTED: catalase-2                              187   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_002510677.1|  catalase, putative                                 192   5e-53   
gb|ABQ44283.1|  catalase                                                183   6e-53   Saccharum hybrid cultivar NCo 376
emb|CDY52649.1|  BnaAnng11640D                                          186   6e-53   Brassica napus [oilseed rape]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     187   7e-53   Sesamum indicum [beniseed]
gb|AAO17721.1|  catalase                                                187   8e-53   Hypericum perforatum
dbj|BAJ87148.1|  predicted protein                                      182   8e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM97541.1|  catalase 2                                              186   8e-53   Capsicum annuum
gb|ACJ22771.1|  catalase 1                                              186   9e-53   Jatropha curcas
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 186   1e-52   Cucumis melo [Oriental melon]
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          186   1e-52
gb|AFR53082.1|  CAT                                                     186   1e-52   Anthurium andraeanum [flamingo-lily]
gb|ACL35349.1|  catalase                                                186   1e-52   Picea glauca
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         186   1e-52   Jatropha curcas
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              186   2e-52   
gb|KJB17473.1|  hypothetical protein B456_003G002800                    186   2e-52   Gossypium raimondii
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      186   3e-52   Cucumis melo [Oriental melon]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         185   3e-52   Camelina sativa [gold-of-pleasure]
gb|AAZ29552.1|  catalase-C                                              185   3e-52   Oryza sativa Indica Group [Indian rice]
gb|AAD17933.1|  catalase                                                185   3e-52   Brassica juncea [brown mustard]
dbj|BAA34205.1|  catalase                                               185   3e-52   Oryza sativa Japonica Group [Japonica rice]
gb|ADZ45556.1|  catalase                                                185   3e-52   Vigna radiata [mung bean]
ref|NP_001048861.1|  Os03g0131200                                       185   3e-52   
gb|ADZ45555.1|  catalase                                                185   4e-52   Vigna radiata [mung bean]
gb|AAC19397.1|  leaf catalase                                           185   4e-52   Mesembryanthemum crystallinum
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               185   4e-52   Cucurbita pepo
gb|AFW69584.1|  catalase1                                               182   4e-52   
ref|NP_001234827.1|  catalase isozyme 1                                 185   4e-52   Solanum lycopersicum
gb|AFN81243.1|  catalase 1                                              185   5e-52   Brassica rapa subsp. pekinensis [bai cai]
dbj|BAA34714.1|  catalase                                               185   5e-52   Oryza sativa [red rice]
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 184   6e-52   
gb|AIU99481.1|  catalase                                                184   6e-52   Saccharum spontaneum [fodder cane]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 184   6e-52   Oryza brachyantha
gb|ADM96039.1|  catalase                                                184   6e-52   Cucumis sativus [cucumbers]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       182   7e-52   Cucumis sativus [cucumbers]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 184   7e-52   
gb|AIM43584.1|  catalase                                                184   7e-52   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99488.1|  catalase                                                184   7e-52   Saccharum hybrid cultivar ROC22
gb|AIU99484.1|  catalase                                                184   7e-52   Saccharum arundinaceum
gb|AIU99485.1|  catalase                                                184   8e-52   Saccharum spontaneum [fodder cane]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    184   8e-52   Oryza sativa Indica Group [Indian rice]
gb|AAY59707.1|  catalase                                                184   9e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          184   9e-52   
gb|ACN36234.1|  unknown                                                 180   1e-51   Zea mays [maize]
gb|AIU99479.1|  catalase                                                184   1e-51   Saccharum arundinaceum
gb|AAC17729.1|  catalase 1                                              181   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH36312.1|  catalase heme-binding enzyme                            184   1e-51   Medicago truncatula
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    184   1e-51   Arabis alpina [alpine rockcress]
emb|CDX69111.1|  BnaC01g03420D                                          183   1e-51   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      183   2e-51   Brachypodium distachyon [annual false brome]
dbj|BAA34204.1|  catalase                                               183   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|AHF27429.1|  catalase                                                182   2e-51   Cucurbita moschata [ayote]
dbj|BAA05494.1|  catalase                                               183   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|AHF27432.1|  catalase                                                182   2e-51   Cucurbita maxima [Boston marrow]
gb|AAC17731.1|  catalase 1                                              183   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AIU99480.1|  catalase                                                183   2e-51   Saccharum spontaneum [fodder cane]
ref|NP_001058635.1|  Os06g0727200                                       183   2e-51   
ref|NP_564121.1|  catalase 1                                            182   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AHA50082.1|  catalase                                                182   3e-51   Eleutherococcus senticosus
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         182   3e-51   Oryza brachyantha
gb|ABC01913.1|  catalase isozyme 1-like protein                         182   4e-51   Solanum tuberosum [potatoes]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    182   4e-51   
gb|AAF61732.1|AF243517_1  catalase 2                                    182   4e-51   Helianthus annuus
emb|CDY01363.1|  BnaA07g11360D                                          182   4e-51   
ref|XP_009103333.1|  PREDICTED: catalase-1                              182   4e-51   Brassica rapa
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               182   4e-51   Cucurbita pepo
emb|CDY31877.1|  BnaC07g15270D                                          182   5e-51   Brassica napus [oilseed rape]
emb|CAG23920.1|  catalase                                               182   5e-51   Festuca arundinacea [tall fescue]
ref|XP_010692544.1|  PREDICTED: catalase-like                           182   5e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001241808.1|  catalase isozyme B                                 182   5e-51   Zea mays [maize]
emb|CAA42720.1|  catalase-1                                             182   6e-51   Zea mays [maize]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               182   7e-51   Hordeum vulgare [barley]
emb|CDP01802.1|  unnamed protein product                                181   8e-51   Coffea canephora [robusta coffee]
ref|XP_003558892.1|  PREDICTED: catalase-1                              181   8e-51   Brachypodium distachyon [annual false brome]
gb|AIU99482.1|  catalase                                                181   9e-51   Saccharum hybrid cultivar ROC22
gb|AIU99486.1|  catalase                                                181   9e-51   Saccharum spontaneum [fodder cane]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       181   9e-51   Triticum aestivum [Canadian hard winter wheat]
gb|EMT05040.1|  Catalase-1                                              182   1e-50   
gb|EPS69543.1|  catalase                                                181   1e-50   Genlisea aurea
gb|AIP93616.1|  CAT1                                                    181   1e-50   Bassia scoparia [burning bush]
ref|NP_001274863.1|  catalase isozyme 1                                 181   1e-50   
gb|AIU99487.1|  catalase                                                181   1e-50   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               181   1e-50   
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 185   2e-50   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         181   2e-50   
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                181   2e-50   
gb|AIZ77475.1|  catalase                                                180   2e-50   
gb|ADU56198.1|  catalase                                                180   2e-50   
gb|AAR97905.1|  catalase                                                180   2e-50   
emb|CAA85470.1|  catalase                                               180   2e-50   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               180   2e-50   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             180   2e-50   
ref|XP_002521709.1|  catalase, putative                                 180   3e-50   
gb|AAG61140.2|AF332973_1  catalase 2                                    180   3e-50   
gb|AAB07026.1|  catalase 1                                              180   3e-50   
dbj|BAJ90861.1|  predicted protein                                      179   4e-50   
tpg|DAA43177.1|  TPA: catalase2                                         179   4e-50   
ref|NP_001105415.1|  catalase isozyme 1                                 179   4e-50   
gb|ADU56199.1|  catalase                                                179   4e-50   
ref|XP_010692546.1|  PREDICTED: catalase                                179   5e-50   
prf||1803522A  catalase                                                 179   5e-50
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               179   5e-50   
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      179   6e-50   
ref|NP_001105310.1|  catalase isozyme 2                                 179   6e-50   
gb|AAL00886.1|  catalase                                                174   6e-50   
gb|AIU99483.1|  catalase                                                179   6e-50   
dbj|BAJ88747.1|  predicted protein                                      180   7e-50   
tpg|DAA43178.1|  TPA: catalase2                                         179   7e-50   
gb|ABV55108.1|  catalase 2                                              179   9e-50   
gb|AAK67359.2|AF390210_1  catalase                                      178   1e-49   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             179   1e-49   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      178   1e-49   
gb|AAC19398.1|  root catalase                                           178   1e-49   
gb|KHG21219.1|  Catalase isozyme 1                                      176   2e-49   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 179   2e-49   
gb|AAF61733.1|AF243518_1  catalase 3                                    177   3e-49   
emb|CAE82295.1|  catalase                                               177   3e-49   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         177   4e-49   
emb|CBI29556.3|  unnamed protein product                                166   5e-49   
gb|ADK25939.1|  catalase                                                170   5e-49   
gb|AHB72694.1|  catalase                                                176   1e-48   
gb|AAF61734.1|AF243519_1  catalase 4                                    176   1e-48   
ref|NP_001031073.1|  catalase 3                                         176   1e-48   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               176   1e-48   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      174   4e-48   
gb|ADN94253.1|  catalase                                                174   4e-48   
gb|ABY21704.1|  catalase-1 precursor                                    174   4e-48   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      174   8e-48   
emb|CDY29518.1|  BnaA06g14520D                                          173   8e-48   
emb|CDY31490.1|  BnaC05g15990D                                          173   9e-48   
dbj|BAH37035.1|  catalase 1                                             173   9e-48   
ref|XP_009149540.1|  PREDICTED: catalase-1                              173   9e-48   
gb|AFD29285.1|  catalase                                                173   1e-47   
gb|ACH63223.1|  catalase                                                172   2e-47   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             172   2e-47   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             171   6e-47   
gb|ABB72796.1|  catalase isozyme 1-like protein                         171   6e-47   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             170   1e-46   
gb|ACL81498.1|  catalase                                                169   3e-46   
gb|AFI48111.1|  catalase isozyme B                                      159   3e-46   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   170   4e-46   
gb|AFK46618.1|  unknown                                                 159   5e-46   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            169   5e-46   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         168   6e-46   
gb|ABY68162.1|  catalase                                                159   6e-46   
gb|ABY68159.1|  catalase                                                159   6e-46   
gb|ABY68164.1|  catalase                                                158   7e-46   
gb|ABY68158.1|  catalase                                                158   8e-46   
gb|AFI48068.1|  catalase isozyme B                                      158   9e-46   
gb|AFI48101.1|  catalase isozyme B                                      157   2e-45   
dbj|BAD07937.1|  catalase catA-like protein                             158   2e-45   
gb|AFI48054.1|  catalase isozyme B                                      157   2e-45   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         167   3e-45   
gb|ABY68160.1|  catalase                                                157   3e-45   
gb|AJF34884.1|  catalase                                                166   3e-45   
gb|ABY68161.1|  catalase                                                156   4e-45   
ref|XP_010477308.1|  PREDICTED: catalase-1                              166   7e-45   
dbj|BAD94702.1|  catalase                                               155   1e-44   
ref|XP_010105996.1|  Catalase isozyme 1                                 162   1e-44   
dbj|BAH56915.1|  AT1G20620                                              164   2e-44   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              163   3e-44   
ref|XP_001779509.1|  predicted protein                                  162   1e-43   
gb|AFI48131.1|  catalase isozyme B                                      153   1e-43   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             162   1e-43   
ref|NP_001031791.1|  catalase 2                                         162   1e-43   
dbj|BAH19523.1|  AT4G35090                                              162   1e-43   
gb|AFI48098.1|  catalase isozyme B                                      152   2e-43   
gb|ABY68163.1|  catalase                                                150   1e-42   
dbj|BAJ92414.1|  predicted protein                                      159   2e-42   
gb|AFI48130.1|  catalase isozyme B                                      150   2e-42   
gb|AAC17730.1|  catalase 2                                              157   2e-42   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 159   2e-42   
gb|AAX88799.1|  catalase                                                159   2e-42   
gb|ADY02963.1|  catalase                                                159   3e-42   
gb|EMS51034.1|  Catalase isozyme 2                                      159   3e-42   
emb|CAH61266.1|  catalase                                               158   3e-42   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               158   5e-42   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      157   8e-42   
ref|XP_001752315.1|  predicted protein                                  157   9e-42   
ref|NP_001045673.1|  Os02g0115700                                       157   1e-41   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      157   1e-41   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          157   1e-41   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      156   2e-41   
gb|ABN71233.2|  catalase                                                156   2e-41   
gb|EMS61345.1|  Catalase isozyme 1                                      157   3e-41   
gb|EMT06167.1|  Catalase isozyme 2                                      157   3e-41   
ref|XP_001784759.1|  predicted protein                                  154   1e-40   
gb|ADQ28492.1|  catalase                                                154   1e-40   
gb|AGI65617.1|  catalase                                                153   2e-40   
gb|ABK24449.1|  unknown                                                 153   3e-40   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          152   5e-40   
gb|AGT16203.1|  catalase                                                150   2e-39   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              150   4e-39   
gb|AII23739.1|  catalase                                                149   6e-39   
ref|XP_005645077.1|  catalase                                           149   1e-38   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    148   2e-38   
gb|ABR16304.1|  unknown                                                 147   2e-38   
gb|ABK24543.1|  unknown                                                 147   3e-38   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          147   4e-38   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           147   6e-38
emb|CAA43814.1|  catalase                                               146   6e-38   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     145   1e-37   
gb|ABK41476.1|  catalase                                                142   2e-36   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               142   2e-36   
gb|AFW66787.1|  catalase3                                               142   2e-36   
gb|AID50071.1|  catalase                                                134   2e-36   
gb|AGT16310.1|  catalase                                                142   3e-36   
gb|AGT16188.1|  catalase                                                142   3e-36   
gb|AGT16054.1|  catalase                                                142   3e-36   
gb|AGT15888.1|  catalase                                                142   3e-36   
gb|AFW66785.1|  catalase3 isoform 1                                     143   4e-36   
gb|AHZ13843.1|  catalase                                                140   8e-36   
ref|XP_011396830.1|  Catalase isozyme 2                                 135   1e-33   
gb|ABS72010.1|  putative catalase                                       126   1e-33   
gb|KIY96954.1|  catalase                                                133   1e-33   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      134   2e-33   
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 126   2e-33   
gb|AEY70510.1|  catalase                                                130   4e-33   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 124   1e-32   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             124   5e-32   
ref|NP_001105416.1|  catalase isozyme 3                                 130   5e-32   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        130   6e-32   
emb|CAA42026.1|  catalase                                               121   8e-32   
ref|XP_002950455.1|  catalase                                           129   1e-31   
gb|EMS35721.1|  Catalase isozyme 1                                      125   2e-31   
ref|XP_005708279.1|  catalase                                           126   8e-31   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             126   9e-31   
gb|AFW66789.1|  catalase3                                               124   1e-30   
emb|CAA73663.1|  catalase                                               126   1e-30   
ref|XP_001696763.1|  catalase/peroxidase                                125   2e-30   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            124   8e-30
gb|AAR84577.1|  catalase 1b                                             123   8e-30   
gb|AFW66788.1|  catalase3                                               124   1e-29   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              124   1e-29   
gb|AAB70006.1|  catalase                                                122   3e-29   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             112   7e-28   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      117   1e-27   
emb|CDY43951.1|  BnaC04g21590D                                          114   2e-27   
gb|KJB17474.1|  hypothetical protein B456_003G002800                    116   3e-27   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    116   3e-27   
emb|CDY31866.1|  BnaC07g15160D                                          110   2e-26   
gb|KDD77132.1|  catalase                                                113   5e-26   
gb|ABB88582.1|  catalase                                                112   8e-26   
gb|AGS17821.1|  catalase 2                                              106   8e-24   
gb|AAO16182.1|  catalase-1                                            99.0    8e-23   
ref|XP_005536240.1|  catalase                                           101   8e-22   
gb|AAP57673.1|  catalase                                              96.3    1e-20   
gb|AFN85536.1|  catalase                                              89.0    1e-19   
gb|ABR25882.1|  catalase isozyme b                                    88.2    3e-19   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                   92.0    6e-19   
ref|XP_005712277.1|  unnamed protein product                          94.0    6e-19   
gb|ABB51561.1|  truncated catalase 2                                  92.8    8e-19   
gb|AAY34915.1|  catalase                                              86.3    1e-18   
gb|AFH53189.1|  catalase                                              89.4    4e-18   
gb|AFH53190.1|  catalase                                              89.0    4e-18   
gb|AFH53187.1|  catalase                                              89.0    4e-18   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2    86.7    1e-16   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like               86.7    2e-16   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like               86.3    2e-16   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            80.5    3e-16   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg           85.5    3e-16   
emb|CCQ26769.2|  perixode catalase                                    79.7    3e-16   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g           84.7    7e-16   
ref|XP_004366029.2|  catalase isozyme 2                               83.2    4e-15   
gb|KJE89728.1|  catalase isozyme 2                                    83.2    5e-15   
emb|CDP22058.1|  unnamed protein product                              78.6    8e-15   
gb|ACU23083.1|  unknown                                               77.0    6e-14   
ref|NP_973873.1|  catalase 3                                          78.6    1e-13   
ref|XP_005644653.1|  catalase-domain-containing protein               76.6    7e-13   
gb|KEH36313.1|  catalase heme-binding enzyme                          74.7    2e-12   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           70.1    1e-11   
ref|XP_005647994.1|  catalase-domain-containing protein               72.0    2e-11   
ref|XP_005642928.1|  catalase                                         71.6    3e-11   
gb|AEA86295.1|  putative catalase                                     66.6    1e-10   
gb|ABS89000.1|  catalase                                              65.1    4e-10   
ref|XP_010320460.1|  PREDICTED: catalase isozyme 3-like               64.3    5e-10   
gb|KCW44990.1|  hypothetical protein EUGRSUZ_L01419                   67.4    6e-10   
ref|WP_016429054.1|  hypothetical protein                             67.0    9e-10   
ref|WP_029723487.1|  catalase                                         67.0    9e-10   
gb|AFA36510.1|  catalase                                              64.3    1e-09   
ref|WP_032664185.1|  catalase                                         66.2    2e-09   
gb|EQM67709.1|  catalase                                              65.9    2e-09   
ref|WP_037022052.1|  catalase                                         65.9    2e-09   
ref|WP_032632526.1|  catalase                                         65.5    3e-09   
ref|XP_002980255.1|  hypothetical protein SELMODRAFT_112561           60.5    3e-09   
ref|WP_043244592.1|  catalase                                         65.5    3e-09   
ref|WP_044037961.1|  catalase                                         65.5    3e-09   
ref|WP_043304355.1|  catalase                                         65.1    4e-09   
ref|WP_037277190.1|  catalase                                         65.1    4e-09   
ref|WP_032884665.1|  catalase                                         65.1    4e-09   
gb|KIQ35234.1|  catalase                                              65.1    4e-09   
ref|WP_004887231.1|  catalase                                         65.1    4e-09   
gb|ADR01107.1|  catalase 3                                            64.3    5e-09   
ref|WP_027605312.1|  catalase                                         64.7    6e-09   
ref|WP_032610664.1|  catalase                                         64.3    7e-09   
sp|P46206.2|CATB_PSESY  RecName: Full=Catalase; Flags: Precursor      63.9    9e-09   
ref|WP_022641122.1|  catalase                                         63.5    1e-08   
ref|WP_032622880.1|  catalase                                         63.5    1e-08   
gb|AAR25790.1|  catalase                                              59.7    2e-08   
ref|WP_043830984.1|  catalase                                         63.2    2e-08   
ref|WP_044323073.1|  catalase                                         62.8    2e-08   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   251 bits (641),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN SY GYMNFVHR EEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVI
Sbjct  44   LPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVI  103

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQD FINRWVK+LSEPRVTHEI STWIS LTQ DRSLGQKV
Sbjct  104  EKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKV  163

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  164  ASRLNIRPT  172



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN SY GYMNFVHR EEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQD FINRWVK+LSEPRVTHEI STWIS LTQ DRSLGQKV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKV  482

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  483  ASRLNIRPT  491



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   250 bits (638),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN SY GYMNFVHR EEVDYFPSKFDNTRNAERFPTPLRIVTG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGQRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQD FINRWVK+LSEPRVTHEI STWIS LTQ DRSLGQKV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWISYLTQADRSLGQKV  482

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  483  ASRLNIRPT  491



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF+HR EE+DYFPS+FD  R+AERFP P  IVTG+R++C+I
Sbjct  2    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCII  61

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKEN+FKQPG+RYRSWAPDRQD F+ RWV+ L++PRVTHEI S WIS L+Q DRSLGQKV
Sbjct  62   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  121

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  122  ASHLNMRPS  130



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF+HR EE+DYFPS+FD  R+A+RFP P  IVTG+R++C+I
Sbjct  6    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKRERCII  65

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKEN+FKQPG+RYRSWAPDRQD F+ RWV+ L++PRVTHEI S WIS L+Q DRSLGQKV
Sbjct  66   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  125

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  126  ASHLNMRPS  134



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE++P PLR++TG+RDKC++
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPLRVLTGKRDKCIV  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  483  ASRLNIRPT  491



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  16   LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  75

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  76   KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  135

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  136  ASRLNVRPS  144



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG+RDKC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIPPRVLTGKRDKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D++LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKTLGQKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC YHN  Y G+MNF+HR EEVDYFPS++D  R+AER P P  I++GRR+KCVI
Sbjct  132  LPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVI  191

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSW PDRQ+ F+ R V +LS+PR+THEI S W+S  +Q D+SLGQK+
Sbjct  192  EKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKL  251

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  252  ASRLNVRP  259



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF+HR EEVDYFPS++   R+AE FP P  I+TG+RDKCVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIPSNIITGKRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F++RWV  LSEPRVT+EI S WIS  +Q DRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ATRLNVRPS  491



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  RNAERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIPPNILSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   196 bits (499),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC YHN  Y G+MNF+HR EEVDYFPS++D  R+AER P P  I++GRR+KCVI
Sbjct  141  LPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLPHAIISGRREKCVI  200

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSW PDRQ+ F+ R V +LS+PR+THEI S W+S  +Q D+SLGQK+
Sbjct  201  EKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVSYWSQCDKSLGQKL  260

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  261  ASRLNVRP  268



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI+RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   202 bits (515),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P  I++G+R+KC+I
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPPNILSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI+RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D +R+AERFP P  + TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIPPALCTGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FINRWV ++S+PRVTHEI S WI+  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWITYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  294  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  353

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI+RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  354  EKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWISYWSQADKSLGQKL  413

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  414  ASRLNVRPS  422



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+HR EEV+YFPS+FD  R+AE++P P RI+TG+RD+C+I
Sbjct  363  LPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSW+PDRQ+ FI RW+ +LS+PRVTHEI + WIS  +Q D+SLG+K+
Sbjct  423  EKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWISYWSQADKSLGEKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPFRILTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ+ FI RWV++LS+PRVT+EI + WIS  +Q DRSLGQK+
Sbjct  423  HKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWISYWSQCDRSLGQKI  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ATRLNVKPS  491



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE++P P  ++TG+RDKC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPCVLTGKRDKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S W S  +Q D++LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFSYWSQADKTLGQKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P +I TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIPPQICTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RW+ +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN++P+
Sbjct  483  ASRLNVKPS  491



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MN +HR EE++YFPSKFD  R+AER+P P +IVTG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKREKVII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FINRW+K+L+EPRVTHE  S WIS  TQ D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWISYWTQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRL+ RP+
Sbjct  483  ASRLSARPS  491



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F++RWV  LSEPRVTHEI S WIS  +Q DRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F++RWV  LSEPRVTHEI S WIS  +Q DRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWISYWSQADRSFGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D +R+AERFP P  + +GRR+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+ RWV +LSEPRVTHE+ S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNVRPS  491



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   195 bits (496),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  I +GRR+KC I
Sbjct  179  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGI  238

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQD F  RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  239  EKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  298

Query  204  ASRLNIRP  181
            ASRL++RP
Sbjct  299  ASRLSMRP  306



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC + N  Y G+MNF+HR EEVDYFPS++D TR+AER+P P  ++TGRR+K  I
Sbjct  348  LPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACI  407

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+NRW+K+L +PRVTHE+ S W+S  +Q DRSLGQK+
Sbjct  408  EKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKL  467

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  468  ASRLNVRPS  476



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D +R+AERFP P  + +GRR+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIPSAVCSGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+ RWV +LSEPRVTHE+ S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNVRPS  491



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC + N  Y G+MNF+HR EEVDYFPS++D TR+AER+P P  ++TGRR+K  I
Sbjct  364  LPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIPSDVITGRREKACI  423

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+NRW+K+L +PRVTHE+ S W+S  +Q DRSLGQK+
Sbjct  424  EKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVSYWSQADRSLGQKL  483

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  484  ASRLNVRPS  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  I+ G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPSNILYGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  215  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  274

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+S+GQK+
Sbjct  275  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  334

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  335  ASRLNVRPS  343



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS+FD  R+AERFP+P  I +GRR+KC+I
Sbjct  363  LPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSPPAICSGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+ RWV++LS+ R THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSRILTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW P+RQ+ FI RWV++LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  HKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGQKI  482

Query  204  ASRLNIRP  181
            A+RLN++P
Sbjct  483  ATRLNVKP  490



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIPSNICTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F++RWV +LS+PRVT+EI S WIS  +Q DRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE++P P R++ G+RD+C+I
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIPPRVLNGKRDRCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRSWAPDRQ+ FI RWV +LSEPRVTHEI + W+S  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLSYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN++PT
Sbjct  483  ASRLNVKPT  491



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+Y PS+FD  R+AERFP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIPPAVCTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F +RWV++LS+PRVTHEI S WIS  TQ D+ LGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWISYWTQCDKFLGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ATRLNVRPS  491



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P  +VTGRR+K +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSSVVTGRREKSII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ+ F++RWV +LS+PRVTHEI   WIS  +Q D+SLGQK+
Sbjct  423  NKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWISYWSQCDKSLGQKI  482

Query  204  ASRLNIRPT  178
            A+RLN++PT
Sbjct  483  ATRLNVKPT  491



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  I TG+R+KCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSNICTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F++RWV +LS+PRVT+EI S WIS  +Q DRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWISYWSQADRSFGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF++R EEV+YFPS+FD  R+AE++P P RI+TG+RD+C+I
Sbjct  363  LPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIPPRILTGKRDRCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSW+PDRQ+ FI RW+ +LS+PRVTHEI   WIS  +Q D+SLG+K+
Sbjct  423  EKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWISYWSQADKSLGEKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  Y G+MNF+HR EEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  162  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACI  221

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK PGDRYRSWAPDRQ+ FI R V  LS+PRVT EI S W+S  +Q D+SLGQK+
Sbjct  222  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKI  281

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  282  ASRLNVRP  289



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  248  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  307

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  308  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  367

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  368  ASRLNVRPS  376



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++YFPSKFD  R+AER+P P +IVTG+R++ +I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIPSQIVTGKRERVII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSWAPDRQ+ FINRW+K+LSEPRVTHE  S WIS  TQ D+S+GQK+
Sbjct  423  EKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTQADKSIGQKL  482

Query  204  ASRLNIRPT  178
            AS L+ RP+
Sbjct  483  ASSLSARPS  491



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVPSKSYTGIRTKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD FI RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  Y G+MNF+HR EEVDYFPSK+D TR+AER P P  ++TGRRD+ VI
Sbjct  363  LPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIPNAVITGRRDRRVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKE+NFKQ GDRYRSWAPDRQ+ F+ RWV +LS+PR+T EI S W+S  +Q D+S GQK+
Sbjct  423  EKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVSYWSQADKSFGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
             SRLN+RP+
Sbjct  483  LSRLNVRPS  491



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS+ D  R+AER+P P  I++G+R+KCVI
Sbjct  363  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIPSNILSGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
             SRLN+RP+
Sbjct  483  LSRLNVRPS  491



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ FI RWV++LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+ RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G MNF+HR EEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+I
Sbjct  363  LPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV++LS+PRVT EI S WIS  TQ D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASCLNVRPS  491



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  371  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  430

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  431  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  490

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  491  ASRLNVRPS  499



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  I TG R++C I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAICTGSRERCAI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+APDRQD F+ RWV +LS+PRVTHEI STWIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWISYWSQADRSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNLRPS  491



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D+ R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+R+RSWAPDRQD FI RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  483  ASHLNMRP  490



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D+ R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIPPAICSGRREKCGI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+R+RSWAPDRQD FI RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  483  ASHLNMRP  490



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  414  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  473

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  474  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  533

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  534  ASRLNVRPS  542



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYRSWAPDRQD +IN+WV+SLS+PRVTHEI S WIS L+Q D+S GQKV
Sbjct  423  PKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTVKPT  491



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R++ERFP P  I +GRRDKCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIPSTICSGRRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNF+QPG+RYRSWAPDRQ+ F+NR V  LS+PR+THE+ S WIS  TQ DRSLGQK+
Sbjct  423  EKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWISYWTQCDRSLGQKL  482

Query  204  ASRLNIRPT  178
            A RLN+RP+
Sbjct  483  AFRLNVRPS  491



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   196 bits (497),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PR THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER P P  +++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIPPPVLSGKRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+ RVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            A+RLN+RPT
Sbjct  483  ATRLNVRPT  491



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIPPAICSGRREKCGI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQD F  RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            AS L+ RP
Sbjct  483  ASHLSTRP  490



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER P P RI+TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIPSRILTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRSW PDRQ  FI RWV++LS+PRVTHEI S WIS  +Q D+SLG+K+
Sbjct  423  QKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWISYWSQCDKSLGRKI  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ATRLNVKPS  491



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  427  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  486

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q DRSLGQK+
Sbjct  487  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADRSLGQKL  546

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  547  ASRLNVRPS  555



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y GYMN +HR EE+DYFPS++D  R+AER P P R++TGRR++ VI
Sbjct  363  LPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIPTRVLTGRRERRVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQP +RYRSWAPDRQ+ F+ RWV +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            A RLN+RPT
Sbjct  483  AFRLNVRPT  491



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF+HR EEVDYFPS++D  R+AERFP P R++TG+R+KC+I
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIPTRVLTGKREKCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS++PDRQ+ FI RWV++LS+P+VTHEI S WIS  +Q D+SL QK+
Sbjct  423  SKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWISYWSQCDKSLSQKL  482

Query  204  ASRLNIRPT  178
            A+RL+++P+
Sbjct  483  ATRLSVKPS  491



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ FI RWV++ S+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  I +GRR+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIPPAICSGRREKCGI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQD F  RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            ASRL++RP
Sbjct  483  ASRLSMRP  490



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+ P P  I  G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIPSAIFNGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RW+ +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P RI TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIPPRICTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+ PDRQ+ FI RW  +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ATRLNVKPS  491



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   191 bits (486),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD +R+AER+P P  + +G+R++C+I
Sbjct  215  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCII  274

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRSW PDRQ+ F+ RWV +LS+ RVTHEI S WIS  +Q DRSLGQK+
Sbjct  275  EKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKL  334

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  335  ASHLNVRPS  343



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE +P P ++ +G+R+KC+I
Sbjct  39   LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEIYPIPSKVCSGKREKCII  98

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYR++ PDRQ+ F+ RWV+ LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  99   QKENNFKQAGERYRTFTPDRQERFVRRWVEPLSDPRITYEIRSIWISYWSQADKSLGQKL  158

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  159  ASRLNVRPS  167



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  329  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  388

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  389  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  448

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  449  ASRLNVRPS  457



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D +R+AER+P P  +++G+R K  I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQ+ FI RWV++LS+PR+THEI S W+S  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RPT
Sbjct  483  ASHLNVRPT  491



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+S+GQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC++HN  + G+MNF+HR EEV+YFPS++   R+AE FP P  I+TG+RDKCVI
Sbjct  363  LPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIPSSIITGKRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F++RWV  LSE RVT+EI S WIS  +Q DRS GQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWISYWSQADRSFGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ATRLNVRPS  491



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            +P NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER P P RI+ G+R+KC+I
Sbjct  363  IPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ F+ RWV +LSEPRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN++P+
Sbjct  483  ASHLNLKPS  491



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D +R+AER+P P  +++G+R K  I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIPPVVLSGKRGKICI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQ+ FI RWV++LS+PR+THEI S W+S  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVSYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP 
Sbjct  483  ASRLNVRPA  491



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   194 bits (494),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPNKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+HR EEVDYFPS+FD  R+AE FP P  I  G+R+K VI
Sbjct  363  LPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+APDRQ+ FINRWV++LS+PRVT+EI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+HR EEVDYFPS+FD  R+AE FP P  I  G+R+K VI
Sbjct  363  LPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIPSTICHGKREKVVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+APDRQ+ FINRWV++LS+PRVT+EI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G MNF+HR EEV+YFPS+FD+ R+AE+FP P  ++ G+RD+C+I
Sbjct  455  LPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIPPPVLNGKRDRCMI  514

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV++LS+PRVT EI S WIS  TQ D+SLGQK+
Sbjct  515  EKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWISYWTQADKSLGQKI  574

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  575  ASCLNVRPS  583



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  I +GRR++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPVICSGRRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+ PDRQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  ++TGRR+KCVI
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIPSCVLTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ  FI RWV++LS+PRVT+EI S WIS  +Q DRSLGQK+
Sbjct  423  HKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWISYWSQCDRSLGQKI  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ATRLNVKPS  491



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  I+TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIPPAILTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS+APDRQ+ FI RWV +LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G MNF+HR EEV+YFPS+FD  R+AER P P  ++TG+RD+C+I
Sbjct  363  LPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIPPPVLTGKRDRCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYR++APDRQ+ F+ RWV +LS+PRVTHEI S WIS  TQ D+SLGQK+
Sbjct  423  EKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWISYWTQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYRSWAPDRQD +IN+WV+SLS+PR THEI S WIS L+Q D+S GQKV
Sbjct  423  PKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTVKPT  491



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G MNF+HR EEVDYFPS++D  R+AE+FP P   + GRRD+ +I
Sbjct  363  LPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIPPVNLIGRRDRRII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGD YR+WAPDRQ+ FI RW+  LS+P+VTHE+ S WIS L+Q DRSLGQKV
Sbjct  423  EKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWISYLSQADRSLGQKV  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNMRPS  491



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  362  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  421

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  422  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  481

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  482  ASRLNVRPS  490



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P   + G+RD+  I
Sbjct  136  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHPPVALNGKRDRICI  195

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG++YRS+ PDRQ+ FI RWV +LS+PR+THEI S W+S  TQ D+SLGQK+
Sbjct  196  EKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVSYWTQADKSLGQKL  255

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  256  ASRLNIRPT  264



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  254  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  313

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSW PDRQD ++++WV+ LS+PRVT+EI S WIS L+Q D+S GQKV
Sbjct  314  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  373

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  374  ASRLTLKPT  382



>emb|CAA10286.1| catalase [Cicer arietinum]
Length=125

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -3

Query  549  PKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVIEKENN  370
            PKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AERFPTP   ++G+R++C+  KENN
Sbjct  1    PKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIRPKENN  60

Query  369  FKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKVASRLN  190
            FKQPG+RYR+WAPDRQD F  RW+++LS+PRVTHE+ S WIS  +Q DRSLGQK+AS LN
Sbjct  61   FKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKIASHLN  120

Query  189  IRPT  178
            +RP+
Sbjct  121  MRPS  124



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKC++HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q DRS+GQK+
Sbjct  423  DKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWISYWSQADRSVGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNMRPS  491



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  I TGRR++ VI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIPSAICTGRRERTVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRS++PDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  DKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHPPAVCTGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFK+PG+RYRSW PDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q DRS+GQK+
Sbjct  423  QKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWISYWSQADRSVGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNVRPS  491



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS+ PDRQ+ FI RWV++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  LKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+AP+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPGDRYRS+ PDRQ+ FI RWV++LS+PR+T+EI + WIS  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   184 bits (466),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTG-RRDKCV  388
            LPVNAPKCA+ N  + GYMNF+HR EEV+Y PSKFD   NAER+P P ++ +  +R+KC+
Sbjct  40   LPVNAPKCAHRNNHFDGYMNFMHRDEEVNYHPSKFDPVTNAERYPIPTKVYSACKREKCI  99

Query  387  IEKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
            IEK+N+FKQPG+RYR++ PDRQ+ FINRWVK+LSEPR+THEI S WI  L++ D SLG+K
Sbjct  100  IEKQNDFKQPGERYRTFEPDRQERFINRWVKALSEPRITHEIRSIWIDWLSRADESLGRK  159

Query  207  VASRLNIRPT  178
            VA RLNIRP+
Sbjct  160  VAMRLNIRPS  169



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD+ R+A ++P P  I +G R KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAICSGERVKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQ+ + NRWV++LS+ RVT EI   WIS L+Q D+SLG KV
Sbjct  423  EKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWISYLSQSDKSLGMKV  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ANRLNVRPS  491



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+AP+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPTNSYTGIRTKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF+HR EEVDYFPS+FD  R+A R P P  ++ G+RD+CVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIPSTVLRGKRDRCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYRSWAPDRQ+ FI RWV  LS+ RVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  PKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWISYWSQADKSLGQKM  482

Query  204  ASRLNIRPT  178
            A+RLN+RPT
Sbjct  483  ATRLNVRPT  491



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  + +G+R+KC+I
Sbjct  362  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKREKCII  421

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  422  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  481

Query  204  ASRLNI  187
            ASRLN+
Sbjct  482  ASRLNV  487



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF HR EEVDYFPS+FD  R+AE+FP P +I +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMPPQICSGKREKCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+A DRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWISYWSQCDKSLGQKL  482

Query  204  ASRLNIRP  181
            A+ LN++P
Sbjct  483  ATHLNLKP  490



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D  R+AERFP P  + +GRR+KC+I
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIPPAVCSGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WI+  +Q  +SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWITYWSQACKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  RNAE FP P  I +G+R+KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+NR V  LS+PR+THE+ + WIS   Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ATRLNVKPS  491



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EE++YFPS++D  R+AE FP P  + TGRR+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIPPAVCTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+S+GQK+
Sbjct  423  EKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSVGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASLLNVRPS  491



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P RI+ G R+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIPPRILNGGREKCCI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG++YRSWAPDRQ+ FI RW+ +LS+PRVTHEI + WI+  +Q D+ LGQK+
Sbjct  423  QKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWITYWSQCDKFLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLNI+PT
Sbjct  483  ASRLNIKPT  491



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  356  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  415

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  416  QKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWISYWSQADKSLGQKL  475

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  476  ASRLNVRPS  484



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA HN  Y G+MNF+HR EE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  363  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI   WIS  +Q  +SLGQK+
Sbjct  423  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  Y G+MNF+HR EEVDYFPS++D  R+AER P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIPNAICSGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+ R V +LSEPR+T EI S W+S  ++ D SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVSYWSKCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE FP P  + +G+R++C+I
Sbjct  321  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIPPAVCSGKRERCII  380

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  381  EKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWISYWSQADKSLGQKL  440

Query  204  ASRLNI  187
            ASRLN+
Sbjct  441  ASRLNV  446



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC YHN  Y G+MNF+HR EEVDYF S++D  R+AE+ P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKE+NF+QPGDRYRSWAPDRQ+ F+ R V +LSEPR+THEI S W+S  TQ D+SLGQK+
Sbjct  423  EKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  Y G+MNF+HR EEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  358  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPGRICSGKREKACI  417

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK PGDRYRSWAPDRQ+ FI R V  LS+PRVT EI S W+S  +Q D+SLGQK+
Sbjct  418  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVSYWSQADKSLGQKI  477

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  478  ASRLNVRP  485



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA HN  Y G+MNF+HR EE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  363  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI   WIS  +Q  +SLGQK+
Sbjct  423  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF HR EEVDYFPS+FD  R+AER P P ++V+G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLPPQLVSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRS+APDRQ+ F+ R V +LS+ RVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWISYWSQCDKSLGQKI  482

Query  204  ASRLNIRP  181
            A+RLNI+P
Sbjct  483  ATRLNIKP  490



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+HR EEV+Y PS+ D  R+AE++P P R++TG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIPPRVLTGKREKVII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+ YRSWAPDRQ+ F+ RWV +LS+PR THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  483  ASRLNIRPT  491



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA HN  Y G+MNF+HR EE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  383  LPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  442

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ+ FI RWV +LS+PRVTHEI   WIS  +Q  +SLGQK+
Sbjct  443  PKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  502

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  503  ASRLNVRP  510



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSW PDRQD ++++WV+ LS+PRVT+EI S WIS L+Q D+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTVKPT  491



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYR+W PDRQD +IN+WV+SLS+PRVTHEI S WIS L+Q D+S GQKV
Sbjct  423  PKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLLVKPT  491



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G+MNF+HR EE+DYFPS++D  R+AE  PTP  I  GRR+KC+I
Sbjct  347  LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTPPEICGGRREKCII  406

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSWAPDRQ+ F+ RWV +LS+PRVTHEI   WIS  +Q  +SLGQK+
Sbjct  407  PKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWISYWSQACKSLGQKL  466

Query  204  ASRLNIRPT  178
             +RLN+RP+
Sbjct  467  TARLNVRPS  475



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYR++ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSW PDRQD ++++WV+ LS+PRVT+EI S WIS L+Q D+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTLKPT  491



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  348  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  407

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D++LGQK+
Sbjct  408  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  467

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  468  ASRLNVRPS  476



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSW PDRQD ++++WV+ LS+PRVT+EI S WIS L+Q D+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTLKPT  491



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  362  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  421

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  422  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  481

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  482  ASRLNVRPS  490



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            +P NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER P P RI+ G+R+KC+I
Sbjct  304  IPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVPPRILDGKREKCMI  363

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWA DRQ+ F+ RWV +LSEPRVTHEI S WIS  +Q DRSLGQK+
Sbjct  364  EKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWISYWSQADRSLGQKI  423

Query  204  ASRLN  190
            AS LN
Sbjct  424  ASHLN  428



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D TR++E +P P  +++G+R+K  I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIPPVVLSGKREKRCI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI RWV++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPNKSYTGIRTKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI S WIS  +Q D SLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWISYWSQADASLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYR++ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  + +GRR++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVPSVVCSGRRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+ PDR++ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWISYWSQADQSLGQKL  482

Query  204  ASRLNIRP  181
            ASR+N+RP
Sbjct  483  ASRMNVRP  490



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNF+QPG+RYRSW  DRQ+ F+ R+V++L+EPRVTHEI S WIS  TQ D+SLGQK+
Sbjct  423  EKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWISYWTQADKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYR++ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>prf||1906388A catalase
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYR++ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AERFPTP   ++G+R++C+ 
Sbjct  364  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIR  423

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYR+WAPDRQD F  RW+++LS+PRVTHE+ S WIS  +Q DRSLGQK+
Sbjct  424  PKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKI  483

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  484  ASHLNMRPS  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYR++ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AERFPTP   ++G+R++C+ 
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTPPAALSGKRERCIR  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYR+WAPDRQD F  RW+++LS+PRVTHE+ S WIS  +Q DRSLGQK+
Sbjct  423  PKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWISYWSQADRSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNMRPS  491



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+ P P RI+ G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVPPRILGGKREKCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSW  DRQ+ F+ RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN++P+
Sbjct  483  ASHLNLKPS  491



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P +  TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIPSKSYTGIRTKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSE R+THEI S WIS  +Q DRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  Y G+MNF+HR EEVDYFPSKF N  NAE+FP P RI +G+R+K  I
Sbjct  363  LPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIPSRICSGKREKACI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK PGDRYRSWAPDRQ+ FI R V  LS+PRVT E+ S W+S  +Q D+SLGQK+
Sbjct  423  EKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVSYWSQADKSLGQKI  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  423  QKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER+P P  + TG+R++CVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHPPAVCTGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFK+PG+RYRSW PDRQ+ FI RWV +LS+PRVTHEI S WI+  +Q DRS+GQK+
Sbjct  423  QKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWITYWSQADRSVGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNVRPS  491



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D++LGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD +R+AER+P P  + +G+R++C+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRSW PDRQ+ F+ RWV +LS+ RVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWISYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNVRPS  491



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AERFP P    TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+AP+RQ+ F+ RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWISYWSQCDKSLGQKI  482

Query  204  ASRLNIR  184
            A+RLN++
Sbjct  483  AARLNMK  489



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>prf||2104177A catalase
Length=492

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF+HR EE+DYFPS++D  R+AE++P P   ++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDRQ+ FINR V  LS+PRVTHE+ S W+S  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKI  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF+HR EE+DYFPS++D  R+AE++P P   ++G+RDKCVI
Sbjct  363  LPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIPPVRLSGKRDKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDRQ+ FINR V  LS+PRVTHE+ S W+S  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVSYWSQADKSLGQKI  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNVKP  490



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++C+I
Sbjct  356  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCII  415

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  416  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  475

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  476  ASRLNVRP  483



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  I +G+R++C+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAICSGKRERCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ANRLNVRPS  491



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   190 bits (483),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R+AE++P P R++TGRR+ CVI
Sbjct  360  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLTGRREMCVI  419

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSW PDRQD ++++WV+ LS+PRVT+EI S WI  L+Q D+S GQKV
Sbjct  420  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWICSLSQADKSCGQKV  479

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  480  ASRLTLKPT  488



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE++P P  + TG+R+KCVI
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIPSTMCTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNF QPG+RYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  423  QKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   W S   + DRSLGQK+
Sbjct  423  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTSYWLKADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  361  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  420

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDR++ F+ RWV++LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  421  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  480

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  481  ASHLNMRPS  489



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+ P P  +++G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS++ DRQ+ FINRW+ +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDR++ F+ RWV++LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNMRPS  491



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AE++P P R++TG+R+K +I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIPPRVLTGKREKVII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+ YRSWAP RQ+ F+ RWV +LS+ R THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLNIRPT
Sbjct  483  ASRLNIRPT  491



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+ P P  +++G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVLSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS++ DRQ+ FINRW+ +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+ P P  +++G+RD+C I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIPPVVLSGKRDRCCI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYR+++PDRQ+ FI RWV +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  346  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  405

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYR++ PDRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  406  QKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  465

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  466  ASRLNVRPS  474



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  348  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  407

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D++LGQK+
Sbjct  408  EKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTLGQKL  467

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  468  ASHLNVRPS  476



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MN +HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  351  LPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  410

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  411  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  470

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  471  ASRLNVRPS  479



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  347  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  406

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDR++ F+ RWV++LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  407  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  466

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  467  ASHLNMRP  474



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R+AE++P P R++ GRR+ CVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIPSRVLNGRREMCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRSW PDRQD ++++WV+ LS+PRVT+EI S WIS L+Q D+S GQKV
Sbjct  423  EKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTLKPT  491



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRS+ PDRQ+ FI RWV++LS+PR+T+EI S WI+  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ PTP    TG R KCVI
Sbjct  402  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTPTNSYTGIRTKCVI  461

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  462  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  521

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  522  ASRLNVRPS  530


 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564   LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
             LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AE++PT   + +G R+KC I
Sbjct  884   LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCSGNREKCFI  943

Query  384   EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
              KENNFKQPG+RYRSW  DRQ+ F+ R+V++LSEPRVTHEI S WIS  +Q D+SLGQK+
Sbjct  944   GKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKL  1003

Query  204   ASRLNIRP  181
             A+RLN+RP
Sbjct  1004  ATRLNVRP  1011



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDR++ F+ RWV++LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  483  ASHLNMRP  490



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP N+PKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AER P P R + G+R+KC+I
Sbjct  363  LPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVPPRTLGGKREKCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSW  DRQ+ F+ RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN++P+
Sbjct  483  ASHLNLKPS  491



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN    G+MNF+HR EEV+YFPS++D  R+AERFP P  I+TG+R++ VI
Sbjct  363  LPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIPSNILTGKRERRVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ FI R V +LS+PRV+HEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ATRLNVRPS  491



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD+ R+A ++P P  + +G R KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIPSAVCSGERIKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ +  RWV++LS+ RVT EI   WIS L+Q D+SLG KV
Sbjct  423  EKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWISYLSQSDKSLGMKV  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ANRLNVRPS  491



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AER+P P  I TG+R+KC+I
Sbjct  382  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNPSVIHTGKREKCII  441

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS++PDR++ F+ RWV++LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  442  EKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKL  501

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  502  ASHLNMRP  509



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVN+PKC++HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPK A+HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  + +GRR+K  I
Sbjct  363  LPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAVFSGRREKIAI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+R+RSWAPDRQD FI RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  483  ASHLNMRP  490



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+ R EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI
Sbjct  363  LPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKIVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             K+N+FKQPG+RYRSWAPDRQ+ F+ RW +SL  P+V+HE+ S WI+ LTQ D SLGQKV
Sbjct  423  PKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKV  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ANRLNVKPS  491



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+ R EEVDYFPS+ D  R+AERFP P R+VTG+R+K VI
Sbjct  363  LPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIPSRVVTGKREKTVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             K+N+FKQPG+RYRSWAPDRQ+ F+ RW +SL  P+V+HE+ S WI+ LTQ D SLGQKV
Sbjct  423  PKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWITYLTQCDVSLGQKV  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ANRLNVKPS  491



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AERFP P    +G R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+ PDRQ+ F+ RWV +LS+PRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWISYWSQSDKSLGQKI  482

Query  204  ASRLNIR  184
            A+RLN++
Sbjct  483  AARLNMK  489



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  384  EKENN-FKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KENN FKQ GDRYRSWAPDRQD F+ R+V++LS+PRVTHE+ + WIS  +Q DRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  207  VASRLNIRP  181
            +ASRLN+RP
Sbjct  482  IASRLNVRP  490



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  384  EKENN-FKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KENN FKQ GDRYRSWAPDRQD F+ R+V++LS+PRVTHE+ + WIS  +Q DRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  207  VASRLNIRP  181
            +ASRLN+RP
Sbjct  482  IASRLNVRP  490



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEVDYFPS++D  R+AE  P P  ++TGRR+K +I
Sbjct  363  LPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIPSAVLTGRREKTII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS+APDRQ+ FI RWV +LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLNIRP+
Sbjct  483  ASRLNIRPS  491



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE++P P  I +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIPTAICSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNF+QPG+RYRS+APDRQ+ FI RWV +LS+PRVT+EI S WIS  ++ D+SLGQK+
Sbjct  423  DKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWISYWSKADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRL++RP+
Sbjct  483  ASRLSVRPS  491



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIPSTVCSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYR++ PDRQ+ FI RWV++LS+PR+T+EI S WI+  +Q D+SLGQK+
Sbjct  423  QKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWITYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G MNF+HR EE+DYFPSKFD  R AE++P   ++ TG+R+K VI
Sbjct  363  LPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPILTKVYTGKREKTVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPGDRYRSW P RQ+ F+ RWV  LS+PRVT E+ S W+S L+Q DRSLG KV
Sbjct  423  PKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVSYLSQCDRSLGMKV  482

Query  204  ASRLNIRPT  178
            A+RLN+RPT
Sbjct  483  ATRLNMRPT  491



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AERFP P R++TG+R+KCVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLPPRVLTGKREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS+ P RQ+ F++RWV++LS+ RVTHEI   WI+  +Q D+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWITYWSQCDKSLGQKL  482

Query  204  ASRLNIRPT  178
            A+RLN+RP+
Sbjct  483  ATRLNMRPS  491



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN S  G MNF+HR EEVDY PS+FD  R AE++P P  ++ G R  CV 
Sbjct  186  LPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGPRTMCVT  245

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYRSW PDRQD +IN+WV+SLS+PRVTHEI S WIS L+Q D+S GQKV
Sbjct  246  PKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWISYLSQADKSCGQKV  305

Query  204  ASRLNIRP  181
            ASRL ++P
Sbjct  306  ASRLTVKP  313



>ref|XP_002890395.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66654.1| F5M15.5 [Arabidopsis lyrata subsp. lyrata]
Length=981

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EE++Y+PSKFD  R AE+ P P    TG R KCVI
Sbjct  370  LPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIPTNSYTGIRTKCVI  429

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ GDRYRSWAPDRQD F+ RWV+ LSEPR+THEI   WIS  +Q DRSLGQK+
Sbjct  430  KKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWISYWSQADRSLGQKL  489

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  490  ASRLNVRPS  498


 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AE++PT   + TG R+KC I
Sbjct  852  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTTPIVCTGNREKCFI  911

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNF+QPG+RYRSW  DRQ+ F+ R+V++LSEPRVTHEI S WIS  +Q D+SLGQK+
Sbjct  912  GKENNFQQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWISYWSQADKSLGQKL  971

Query  204  ASRLNIRP  181
            A+RLN+RP
Sbjct  972  ATRLNVRP  979



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++P P  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_002510677.1| catalase, putative [Ricinus communis]
 gb|EEF52864.1| catalase, putative [Ricinus communis]
Length=974

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  RNAE FP P  I +G+R+KCVI
Sbjct  845  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVPSAICSGKREKCVI  904

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSWAPDRQ+ F+NR V  LS+PR+THE+ + WIS   Q D+SLGQK+
Sbjct  905  EKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWISYWIQCDKSLGQKL  964

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  965  ATRLNVKPS  973


 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC YHN  Y G+MNF+HR EEVDYF S++D  R+AE+ P P  I +GRR+KCVI
Sbjct  363  LPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIPNAICSGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKE+NF+QPGDRYRSWAPDRQ+ F+ R V +LSEPR+THEI S W+S  TQ D+SLGQK+
Sbjct  423  EKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVSWWTQCDKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN RP+
Sbjct  483  ASRLNNRPS  491



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   183 bits (465),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF+HR EEVDYFPS++D  +NA R+P P   +TGRRDK VI
Sbjct  210  LPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIPTVHITGRRDKTVI  269

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYR+  P RQ+ FI RWV +LS+PR+THEI S W+S  +Q DRSLGQK+
Sbjct  270  AKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLSNWSQADRSLGQKL  329

Query  204  ASRLNIRPT  178
            ASRL+ +P+
Sbjct  330  ASRLSAKPS  338



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVN+PKC++HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  320  LPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  379

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+R + FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  380  EKENNFKEPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  439

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  440  ASRLNVRP  447



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G MNF+HR EEV+YFPS++D  R+AE+FP P  +++G+R K VI
Sbjct  384  LPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIPPVVLSGQRVKTVI  443

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPGDRYRSWAPDRQ+ FI RW+ +LS+PR+T EI S W+S  TQ D+SLGQK+
Sbjct  444  EKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVSYWTQADKSLGQKL  503

Query  204  ASRLNIRPT  178
            ASRLN+RP 
Sbjct  504  ASRLNVRPA  512



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPK A+HN  + G+MNF+HR EEV+YFPS++D  R+AE++P P  ++ GRR+KC+I
Sbjct  363  LPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPVVLNGRREKCMI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS++PDRQ+ F+NRW+ SLS+PRVTHEI + W++   Q D+SLGQK+
Sbjct  423  AKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVTYWYQADKSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   182 bits (462),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+HR EEV+YFPS+FD TR+AE++P P R+++G R+KC+I
Sbjct  173  LPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCII  232

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD F+ RWV +L++ RVTHEI S W+S  +Q D SLGQK+
Sbjct  233  DKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKL  292

Query  204  ASRLNIRP  181
            ASRL I+P
Sbjct  293  ASRLKIKP  300



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EE+DYFPS++D  R+AE +P P  + +G+R+KC+I
Sbjct  355  LPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIPTTVCSGKREKCII  414

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNF+QPG+RYRS++ DRQ+ FI RWV++LS+PR+T+EI S WIS  +Q D+SLGQK+
Sbjct  415  QKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWISYWSQADKSLGQKL  474

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  475  ASRLNVRPS  483



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   186 bits (473),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  Y G+MNF+HR EE+DYF S++D  R+AER+P P  I++GRR+KCVI
Sbjct  363  LPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIPNAIISGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW PDRQ+ F+ R V +LS+PR+THEI   W+S  +Q D+SLGQK+
Sbjct  423  PKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVSYWSQCDQSLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN+RP
Sbjct  483  ASRLNVRP  490



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+ D   +AER+P P  + TG+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQPPAVYTGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSW  DRQ+ F+ RWV +LS+PRVTHEI + WIS  +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGQKL  482

Query  204  ASRLNIR  184
            ASRLN++
Sbjct  483  ASRLNVK  489



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN    G MNF+HR EEVDY PS+FD  R AE++P P  ++TGRR+KCVI
Sbjct  363  LPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIPSCVLTGRREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYR+W PDRQD +IN+WV+SLS+PRVTHEI S WIS L+Q D+S GQKV
Sbjct  423  PKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRL  193
            ASRL
Sbjct  483  ASRL  486



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+ N  Y G MNF+HR EEV+YFPS+ D  R+AER+P   RIVTGRR+KC+I
Sbjct  363  LPVNAPKCAHKNSHYDGLMNFMHRDEEVNYFPSRHDPLRHAERYPINNRIVTGRREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EK+N+FKQPGDRYRSWA DRQ+ F+ RWV++L+ P+V+HE+ S W+S L++ D SLGQKV
Sbjct  423  EKQNDFKQPGDRYRSWAHDRQERFVRRWVEALAHPKVSHEVRSIWVSYLSKSDVSLGQKV  482

Query  204  ASRLNIRPT  178
            A+RLN++P+
Sbjct  483  ANRLNMKPS  491



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AERFP P    +G R+KCVI
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIPSHTHSGMREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRS+ PDRQ+ F+ RWV +LS+PRVTHEI S WI   +Q D+SLGQK+
Sbjct  423  EKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIFYWSQSDKSLGQKI  482

Query  204  ASRLNIR  184
            A+RLN++
Sbjct  483  AARLNMK  489



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++P P  ++TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIPPPVLTGRREKTVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS+ PDR+D FI RWV++LS+PRVT+EI S WIS  +Q D+SLGQK+
Sbjct  423  PKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN+RPT
Sbjct  483  ASHLNMRPT  491



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 111/133 (83%), Gaps = 4/133 (3%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPD----RQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSL  217
            EKENNFK+PG RYRS+ PD    RQ+ FI RW+++LS+PR+THEI S WIS  +Q D++L
Sbjct  423  EKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  482

Query  216  GQKVASRLNIRPT  178
            GQK+ASRLN+RP+
Sbjct  483  GQKLASRLNVRPS  495



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE+ P P  + +G+R+KC+I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIPSTVYSGKREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRS++ DRQ+ FINRW+ +LS+ RVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  GKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWISYWSQADKSLGQKI  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  421

Query  384  EKEN-NFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KEN NFKQ GDRYRSWAPDRQ+ F+ R+V++LS+PRVTHE+ + WIS  +Q DRSLGQK
Sbjct  422  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  207  VASRLNIRPT  178
            +ASR+N+RP+
Sbjct  482  IASRMNVRPS  491



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++P P  + +G R++CVI
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAPPAVCSGTRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFK+PG+RYRS+ P+RQ+ FI RW+ +LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  423  AKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF+HR EEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  371  LPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVI  430

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW P RQD FI RW+ +LS PR+THEI S W+S  +Q DRSLGQK+
Sbjct  431  AKENNFKQPGERYRSWDPARQDRFIKRWIDALSGPRLTHEIRSIWLSYWSQADRSLGQKL  490

Query  204  ASRLNIRPT  178
            ASRL+ +P+
Sbjct  491  ASRLSAKPS  499



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 112/133 (84%), Gaps = 4/133 (3%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPD----RQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSL  217
            EKENNFK+PG+RYRS+ P+    RQ+ FI RW+++LS+PR+THEI S WIS  +Q D++L
Sbjct  423  EKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRSIWISYWSQADKTL  482

Query  216  GQKVASRLNIRPT  178
            GQK+ASRLN+RP+
Sbjct  483  GQKLASRLNVRPS  495



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF+HR EEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW P RQD FI RW+ +LS+PR+THEI S W+S  +Q DRSLGQK+
Sbjct  423  AKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRL+ +P+
Sbjct  483  ASRLSAKPS  491



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPK A+HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  I +GRR+K  I
Sbjct  363  LPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+R+RSWAPDRQD F  RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            AS L++RP
Sbjct  483  ASHLSMRP  490



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G+MNF+HR EEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  363  LPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW P RQD FI RW+ +LS+PR+THEI S W+S  +Q DRSLGQK+
Sbjct  423  AKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRL+ +P+
Sbjct  483  ASRLSAKPS  491



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPK A+HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  I +GRR+K  I
Sbjct  363  LPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIPPAICSGRREKIAI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+R+RSWAPDRQD F  RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  EKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWISYWSQADRSLGQKI  482

Query  204  ASRLNIRP  181
            AS L++RP
Sbjct  483  ASHLSMRP  490



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  Y G MNF+HR +EVDYFPS++D  R+AER+P P  ++ G RD+ +I
Sbjct  363  LPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIPPNVLNGNRDRQII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQPG+RYRSW P RQ+ FI RWV +LS+PR+THEI + WIS  +Q D+S+G K+
Sbjct  423  QKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWISYWSQADKSVGMKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RPT
Sbjct  483  ASRLNVRPT  491



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  ++TG+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLTGKRERCVI  421

Query  384  EKENN-FKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KENN FKQ GDRYRSWAPDRQD F+ R+V++LS+PRVT E+ + WIS  +Q DRSLGQK
Sbjct  422  PKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTDEVRNIWISYWSQADRSLGQK  481

Query  207  VASRLNIRP  181
            +ASRLN+RP
Sbjct  482  IASRLNVRP  490



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  224  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPPRVLTGCREKCII  283

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +L++PRVTHE  + WIS  +Q D +LGQK+
Sbjct  284  QKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWISYWSQCDAALGQKL  343

Query  204  ASRLNIRPT  178
            ASRLN++P+
Sbjct  344  ASRLNLKPS  352



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN    G MN  HR EEVDY PS+FD  R AE++P P  ++ GRR  CVI
Sbjct  363  LPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIPSCVLNGRRTNCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYRSW PDRQD +IN+WV+SLS+PRVTHEI S WIS L+Q D+S GQKV
Sbjct  423  PKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWISYLSQADKSCGQKV  482

Query  204  ASRLNIRPT  178
            ASRL ++PT
Sbjct  483  ASRLTVKPT  491



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS++D  R+AE++PTP  + +G+R++CVI
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTPPAVCSGKRERCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYRS+ P+RQ+ FI RW+++L +PR+THEI S WI   +Q D++ GQK+
Sbjct  423  EKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIFYWSQADKTFGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN+RP+
Sbjct  483  ASRLNVRPS  491



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            +P NAPKCA+HN  Y G+MNF+HR EEVDYFPS++D  ++A R+P P   +TGRR+K VI
Sbjct  363  VPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKVVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW P RQD FI RW+ +LS+PR+THEI S W+S  +Q DRSLGQK+
Sbjct  423  AKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRL+ +P+
Sbjct  483  ASRLSAKPS  491



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  353  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  412

Query  384  EKEN-NFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KEN NFKQ GDRYRSWAPDRQ+ F+ R+V++LS+PRVTHE+ + WIS  +Q DRSLGQK
Sbjct  413  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  472

Query  207  VASRLNIRP  181
            +ASR+N+RP
Sbjct  473  IASRMNVRP  481



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +LS+PRVTHE  + WIS  +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  + G MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVPPRVLTGCREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQ G+RYRS+ P RQD FI RWV +LS+PR+THE+   WIS  +Q D SLGQK+
Sbjct  423  NKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  421

Query  384  EKEN-NFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KEN NFKQ GDRYRSWAPDRQ+ F+ R+V++LS+PRVTHE+ + WIS  +Q DRSLGQK
Sbjct  422  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  207  VASRLNIRP  181
            +ASR+N+RP
Sbjct  482  IASRMNVRP  490



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  + G+MNF+ R EE++YFPS+ D TR+AER+P P  + TG+R++CVI
Sbjct  276  LPVNAPKCAYHNNHHDGFMNFMDRDEEINYFPSRIDPTRHAERYPQPSAVYTGKRERCVI  335

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQPG+RYRSW  DRQ+ F+ RWV +LS+PRVTHEI + WIS  +Q D+SLG K+
Sbjct  336  EKENNFKQPGERYRSWPSDRQERFVGRWVDALSDPRVTHEIRNIWISYWSQADKSLGHKL  395

Query  204  ASRLNIR  184
            AS  N++
Sbjct  396  ASHFNLK  402



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS++D  R+AE+FP P  +++G+R++CVI
Sbjct  362  LPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMPPNVLSGKRERCVI  421

Query  384  EKEN-NFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQK  208
             KEN NFKQ GDRYRSWAPDRQ+ F+ R+V++LS+PRVTHE+ + WIS  +Q DRSLGQK
Sbjct  422  PKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWISYWSQADRSLGQK  481

Query  207  VASRLNIRP  181
            +ASR+N+RP
Sbjct  482  IASRMNVRP  490



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +LS+PRVTHE  + WIS  +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +LS+PRVTHE  + WIS  +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVGALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +LS+PRVTHE  + WIS  +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPTRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +LS+PRVTHE  + WIS  +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  + G MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD F+ RWV +LS+PR+THE+   WIS  +Q D SLGQK+
Sbjct  423  DKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  + G MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD F+ RWV +LS+PR+THE+   WIS  +Q D SLGQK+
Sbjct  423  DKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>ref|XP_002437631.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
 gb|EER88998.1| hypothetical protein SORBIDRAFT_10g030840 [Sorghum bicolor]
Length=492

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD TR+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPTRHAEKVPIPSRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+R+RS+ P RQD FI RWV +LS+PRVTHE  + WI+  +Q D SLGQK+
Sbjct  423  EKENNFKQAGERFRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWINYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|ACN36234.1| unknown [Zea mays]
Length=340

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  Y G MNF+HR EEVDYFPS++D  RNA R+P P   + GRR+K VI
Sbjct  211  LPANAPKCAHHNNHYDGSMNFMHRHEEVDYFPSRYDAVRNAPRYPIPTAHIAGRREKTVI  270

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYR+  P RQ+ FI RWV +LS+PR+THEI + W+S  +Q DRSLGQK+
Sbjct  271  SKENNFKQPGERYRAMDPARQERFITRWVDALSDPRLTHEIRTIWLSNWSQADRSLGQKL  330

Query  204  ASRLNIRPT  178
            ASRL+ +P+
Sbjct  331  ASRLSAKPS  339



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIPSRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD FI RWV +LS+PRVTHE  + WIS  +Q D SLGQK+
Sbjct  423  QKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G MNF+HR EEV+YFPS+FD TR+AE++P P R+++G R+KC+I
Sbjct  269  LPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMPPRVLSGCREKCII  328

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNFKQ G+RYRS+ P RQD F+ RWV +L++ RVTHEI S W+S  +Q D SLGQK+
Sbjct  329  DKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVSYWSQCDASLGQKL  388

Query  204  ASRLNIRP  181
            ASRL I+P
Sbjct  389  ASRLKIKP  396



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LP NAPKCA+HN  + G+MNF+HR EEV+YFPS+ D  R+AE+ P P    +  R+KC I
Sbjct  363  LPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAEKVPIPTANFSACREKCNI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             K+NNFKQPG+RYRSWAPDRQD F+ RWV +LS+PRVTHEI S WIS  +Q DRSLGQK+
Sbjct  423  PKQNNFKQPGERYRSWAPDRQDRFLRRWVDALSDPRVTHEIRSIWISYWSQADRSLGQKI  482

Query  204  ASRLNIRPT  178
            AS LN+RP+
Sbjct  483  ASHLNMRPS  491



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD  RNA+++PT   + +G R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFMHRNEEVNYFPSRFDPVRNAQKYPTTPIVCSGNREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
             KENNFKQPG+RYRSW   RQ+ F+ R+V++L+EPRVTHEI S WIS  +Q D+SLGQK+
Sbjct  423  GKENNFKQPGERYRSWDSARQERFVKRFVEALAEPRVTHEIRSIWISYWSQADKSLGQKL  482

Query  204  ASRLNIRPT  178
            ASRLN RP+
Sbjct  483  ASRLNARPS  491



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKC +HN  + G+MNF+HR EEV+YFPS+++  R+AE++PTP  +  G+R++CVI
Sbjct  351  LPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPSRYNPVRHAEKYPTPPAVCAGKRERCVI  410

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFK+PG+RYR + P+RQ+ FI RW+++LS+PR+THEI S WIS  +Q D+SLGQK+
Sbjct  411  EKENNFKEPGERYRYFPPERQERFIRRWIEALSDPRITHEIRSIWISYWSQADKSLGQKL  470

Query  204  ASRLNIRP  181
            AS LN+RP
Sbjct  471  ASHLNVRP  478



>ref|XP_003563243.1| PREDICTED: catalase isozyme 1 [Brachypodium distachyon]
Length=492

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCA+HN  + G+MNF+HR EEV+YFPS+FD TR+A+++P P R++TG R+KC+I
Sbjct  363  LPVNAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRFDPTRHAQKYPIPTRVLTGCREKCII  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            EKENNFKQ G+RYRS+ P RQD FI RWV +LS+ RVTHEI   WIS  +Q D SLGQK+
Sbjct  423  EKENNFKQAGERYRSFDPARQDRFIQRWVDALSDARVTHEIQGIWISYWSQCDTSLGQKL  482

Query  204  ASRLNIRP  181
             SRL  +P
Sbjct  483  GSRLKAKP  490



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -3

Query  564  LPVNAPKCAYHNXSYXGYMNFVHRXEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  385
            LPVNAPKCAYHN  + G MNF+HR EEV+YFPS+FD  R+AE+ P P R++TG R+KCVI
Sbjct  363  LPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIPPRVLTGCREKCVI  422

Query  384  EKENNFKQPGDRYRSWAPDRQDXFINRWVKSLSEPRVTHEIXSTWISXLTQXDRSLGQKV  205
            +KENNF+Q G+RYRS+ P RQD F+ RWV +LS+PR+THE+   WIS  +Q D SLGQK+
Sbjct  423  DKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWISYWSQCDASLGQKL  482

Query  204  ASRLNIRP  181
            ASRLN++P
Sbjct  483  ASRLNLKP  490



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920