BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045M19

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003635158.1|  PREDICTED: oligopeptide transporter 3-like         389   3e-133   Vitis vinifera
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              401   2e-131   Nicotiana sylvestris
emb|CDP04526.1|  unnamed protein product                                401   2e-131   Coffea canephora [robusta coffee]
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         400   4e-131   Solanum tuberosum [potatoes]
emb|CBI18636.3|  unnamed protein product                                381   8e-131   Vitis vinifera
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              398   2e-130   Solanum lycopersicum
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              396   2e-129   Nicotiana tomentosiformis
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              393   1e-128   Sesamum indicum [beniseed]
gb|KDO78547.1|  hypothetical protein CISIN_1g004659mg                   383   1e-128   Citrus sinensis [apfelsine]
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              393   2e-128   Vitis vinifera
gb|KDP35505.1|  hypothetical protein JCGZ_08943                         391   7e-128   Jatropha curcas
emb|CBI18634.3|  unnamed protein product                                391   9e-128   Vitis vinifera
ref|XP_002522882.1|  Oligopeptide transporter, putative                 391   1e-127   
gb|KDO78546.1|  hypothetical protein CISIN_1g004659mg                   383   3e-127   Citrus sinensis [apfelsine]
gb|ABF98906.1|  oligopeptide transporter 3, putative, expressed         382   5e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              389   6e-127   Nelumbo nucifera [Indian lotus]
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         388   9e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 388   1e-126   
gb|ADW66457.1|  oligopeptide transporter                                388   1e-126   Phytolacca americana [common pokeberry]
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         388   1e-126   Eucalyptus grandis [rose gum]
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         388   1e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         388   2e-126   Populus euphratica
gb|ABF70152.1|  oligopeptide transporter OPT family protein             388   2e-126   Musa acuminata [banana]
ref|XP_002463868.1|  hypothetical protein SORBIDRAFT_01g007900          374   4e-126   
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                387   4e-126   Erythranthe guttata [common monkey flower]
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            387   5e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         385   1e-125   Elaeis guineensis
ref|XP_002323123.2|  OLIGOPEPTIDE TRANSPORTER family protein            383   1e-125   
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              385   2e-125   Populus euphratica
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              385   2e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             385   2e-125   Citrus clementina [clementine]
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   384   3e-125   Citrus sinensis [apfelsine]
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         384   3e-125   Citrus sinensis [apfelsine]
gb|AAO32313.1|  putative oligopeptide transporter protein               384   3e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665425.1|  PREDICTED: oligopeptide transporter 3              384   6e-125   
gb|ACL82964.1|  glutathione transporter                                 384   6e-125   Zea mays [maize]
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    384   7e-125   
ref|NP_001051290.1|  Os03g0751100                                       384   8e-125   
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             383   1e-124   
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                383   1e-124   Gossypium arboreum [tree cotton]
gb|KHN42268.1|  Oligopeptide transporter 3                              381   2e-124   Glycine soja [wild soybean]
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         382   4e-124   Glycine max [soybeans]
gb|AAQ91200.1|  putative glutathione transporter                        380   7e-124   Zea mays [maize]
dbj|BAK07444.1|  predicted protein                                      380   1e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         380   2e-123   Glycine max [soybeans]
gb|EMT33592.1|  Oligopeptide transporter 3                              380   2e-123   
gb|KHN03544.1|  Oligopeptide transporter 3                              379   4e-123   Glycine soja [wild soybean]
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              379   4e-123   Prunus mume [ume]
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         379   5e-123   Eucalyptus grandis [rose gum]
gb|KJB67417.1|  hypothetical protein B456_010G190300                    379   6e-123   Gossypium raimondii
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              378   9e-123   Pyrus x bretschneideri [bai li]
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         377   2e-122   
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         377   2e-122   Phoenix dactylifera
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         377   3e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             377   3e-122   Phaseolus vulgaris [French bean]
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    376   4e-122   Arabis alpina [alpine rockcress]
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          377   4e-122   Sorghum bicolor [broomcorn]
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              375   9e-122   Fragaria vesca subsp. vesca
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              375   2e-121   Cucumis melo [Oriental melon]
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         375   2e-121   Malus domestica [apple tree]
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             374   2e-121   Capsella rubella
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              374   3e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         374   3e-121   Camelina sativa [gold-of-pleasure]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         374   3e-121   Cucumis sativus [cucumbers]
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          374   3e-121   Amborella trichopoda
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    374   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         374   4e-121   Phoenix dactylifera
gb|AAK96781.1|  Unknown protein                                         374   4e-121   Arabidopsis thaliana [mouse-ear cress]
gb|ADW09325.1|  oligopeptide transporter 3                              374   4e-121   Noccaea caerulescens
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             374   4e-121   Arabidopsis lyrata subsp. lyrata
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              374   5e-121   Brassica rapa
emb|CDY42539.1|  BnaC08g10640D                                          373   5e-121   Brassica napus [oilseed rape]
gb|KEH32683.1|  oligopeptide transporter OPT family protein             372   2e-120   Medicago truncatula
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         372   3e-120   Cicer arietinum [garbanzo]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             371   3e-120   Eutrema salsugineum [saltwater cress]
emb|CAD91127.1|  glutathione transporter GT1                            369   4e-120   Brassica juncea [brown mustard]
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         371   5e-120   Pyrus x bretschneideri [bai li]
ref|NP_567493.5|  oligopeptide transporter                              370   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    370   3e-119   Eucalyptus grandis [rose gum]
ref|XP_010039447.1|  PREDICTED: oligopeptide transporter 3-like i...    368   3e-119   Eucalyptus grandis [rose gum]
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         367   4e-118   
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              356   2e-114   Tarenaya hassleriana [spider flower]
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         354   6e-114   Eucalyptus grandis [rose gum]
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     354   2e-113   Eucalyptus grandis [rose gum]
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              348   2e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         346   2e-110   Elaeis guineensis
gb|AAO72613.1|  Isp-4-like protein                                      313   3e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010087657.1|  Oligopeptide transporter 3                         321   8e-101   
emb|CDP04527.1|  unnamed protein product                                320   8e-101   Coffea canephora [robusta coffee]
gb|KDP35952.1|  hypothetical protein JCGZ_09924                         288   1e-93    Jatropha curcas
ref|XP_010919977.1|  PREDICTED: oligopeptide transporter 4-like         284   6e-91    
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         294   1e-90    Nelumbo nucifera [Indian lotus]
gb|ABK94821.1|  unknown                                                 286   1e-90    Populus trichocarpa [western balsam poplar]
gb|KJB58811.1|  hypothetical protein B456_009G227200                    292   1e-89    Gossypium raimondii
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like         291   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO67987.1|  hypothetical protein CISIN_1g020208mg                   279   3e-89    Citrus sinensis [apfelsine]
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         290   8e-89    Solanum tuberosum [potatoes]
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              289   2e-88    Nicotiana sylvestris
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              288   2e-88    Nicotiana tomentosiformis
emb|CDO97359.1|  unnamed protein product                                278   2e-88    Coffea canephora [robusta coffee]
gb|KJB32168.1|  hypothetical protein B456_005G227300                    283   3e-88    Gossypium raimondii
gb|KEH36459.1|  oligopeptide transporter OPT family protein             283   3e-88    Medicago truncatula
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              288   4e-88    Solanum lycopersicum
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         288   5e-88    Pyrus x bretschneideri [bai li]
ref|XP_007018304.1|  Oligopeptide transporter 2                         288   5e-88    
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             287   8e-88    Populus trichocarpa [western balsam poplar]
ref|XP_002518328.1|  Oligopeptide transporter, putative                 286   2e-87    Ricinus communis
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         286   2e-87    Citrus sinensis [apfelsine]
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              286   2e-87    Populus euphratica
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              286   2e-87    Sesamum indicum [beniseed]
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         286   2e-87    Eucalyptus grandis [rose gum]
gb|EYU18387.1|  hypothetical protein MIMGU_mgv1a0036351mg               281   2e-87    Erythranthe guttata [common monkey flower]
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             286   3e-87    Citrus clementina [clementine]
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         285   3e-87    Eucalyptus grandis [rose gum]
ref|XP_004485624.1|  PREDICTED: oligopeptide transporter 4-like         285   3e-87    Cicer arietinum [garbanzo]
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             285   3e-87    Selaginella moellendorffii
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         285   6e-87    Cucumis sativus [cucumbers]
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         285   6e-87    Elaeis guineensis
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                285   7e-87    Gossypium arboreum [tree cotton]
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         285   9e-87    Phoenix dactylifera
gb|AES90550.2|  oligopeptide transporter OPT family protein             284   9e-87    Medicago truncatula
ref|XP_003593303.1|  Oligopeptide transporter                           284   1e-86    
gb|KJB58809.1|  hypothetical protein B456_009G227000                    277   1e-86    Gossypium raimondii
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         283   1e-86    Prunus mume [ume]
ref|XP_007042780.1|  Oligopeptide transporter 4                         287   1e-86    
emb|CAN81605.1|  hypothetical protein VITISV_025060                     284   1e-86    Vitis vinifera
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              284   2e-86    Vitis vinifera
gb|KJB32170.1|  hypothetical protein B456_005G227300                    284   2e-86    Gossypium raimondii
emb|CBI35438.3|  unnamed protein product                                282   2e-86    Vitis vinifera
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             283   2e-86    Selaginella moellendorffii
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         283   2e-86    
ref|XP_003608353.1|  Oligopeptide transporter                           283   2e-86    
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         283   2e-86    
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         283   2e-86    Citrus sinensis [apfelsine]
gb|KJB58808.1|  hypothetical protein B456_009G227000                    283   2e-86    Gossypium raimondii
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              283   3e-86    Cucumis melo [Oriental melon]
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g             283   3e-86    Phaseolus vulgaris [French bean]
ref|XP_010112260.1|  Oligopeptide transporter 4                         283   3e-86    Morus notabilis
gb|KJB32169.1|  hypothetical protein B456_005G227300                    283   3e-86    Gossypium raimondii
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like         283   3e-86    Glycine max [soybeans]
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             282   4e-86    Prunus persica
emb|CAN61122.1|  hypothetical protein VITISV_038682                     279   4e-86    Vitis vinifera
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              282   5e-86    Vitis vinifera
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    283   5e-86    Phoenix dactylifera
gb|EMS45133.1|  Oligopeptide transporter 4                              281   7e-86    Triticum urartu
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     282   7e-86    Eucalyptus grandis [rose gum]
emb|CBI19305.3|  unnamed protein product                                281   8e-86    Vitis vinifera
gb|AAM64614.1|  Isp4-like protein                                       281   8e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             281   1e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         281   1e-85    Camelina sativa [gold-of-pleasure]
ref|NP_201246.1|  oligopeptide transporter 4                            281   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             281   1e-85    Capsella rubella
emb|CBI19303.3|  unnamed protein product                                284   1e-85    Vitis vinifera
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             281   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         281   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              281   1e-85    
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             281   1e-85    
ref|XP_010104576.1|  Oligopeptide transporter 2                         281   1e-85    
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              281   1e-85    Tarenaya hassleriana [spider flower]
gb|EMT05383.1|  Oligopeptide transporter 4                              277   2e-85    
ref|XP_001767301.1|  predicted protein                                  280   2e-85    
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         281   2e-85    Vitis vinifera
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4              281   2e-85    
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     280   2e-85    Eucalyptus grandis [rose gum]
gb|KHN33580.1|  Oligopeptide transporter 4                              281   2e-85    Glycine soja [wild soybean]
ref|XP_007148333.1|  hypothetical protein PHAVU_006G200000g             280   2e-85    Phaseolus vulgaris [French bean]
gb|EPS59040.1|  hypothetical protein M569_15770                         276   2e-85    Genlisea aurea
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             279   3e-85    
ref|XP_007148334.1|  hypothetical protein PHAVU_006G200100g             280   3e-85    Phaseolus vulgaris [French bean]
gb|KJB32171.1|  hypothetical protein B456_005G227300                    284   3e-85    Gossypium raimondii
gb|EMT16469.1|  Oligopeptide transporter 4                              281   4e-85    
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         280   4e-85    
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         280   4e-85    
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         280   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              279   6e-85    Brassica rapa
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             279   7e-85    Citrus clementina [clementine]
dbj|BAJ90957.1|  predicted protein                                      279   9e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13287.1|  Oligopeptide transporter 4                              273   1e-84    
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              279   1e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         279   1e-84    Eucalyptus grandis [rose gum]
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              278   1e-84    Tarenaya hassleriana [spider flower]
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                279   1e-84    Gossypium arboreum [tree cotton]
gb|KJB58807.1|  hypothetical protein B456_009G227000                    279   2e-84    Gossypium raimondii
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         278   2e-84    Nelumbo nucifera [Indian lotus]
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     279   2e-84    Eucalyptus grandis [rose gum]
emb|CDP19591.1|  unnamed protein product                                275   2e-84    Coffea canephora [robusta coffee]
emb|CDY46800.1|  BnaC02g43080D                                          278   3e-84    Brassica napus [oilseed rape]
emb|CDY31321.1|  BnaA02g34200D                                          278   3e-84    Brassica napus [oilseed rape]
gb|EMS64171.1|  Oligopeptide transporter 4                              275   3e-84    Triticum urartu
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         277   4e-84    Cucumis sativus [cucumbers]
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       277   4e-84    Cucumis sativus [cucumbers]
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              277   4e-84    Cucumis melo [Oriental melon]
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         277   6e-84    Eucalyptus grandis [rose gum]
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         277   7e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    281   7e-84    Arabis alpina [alpine rockcress]
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             276   1e-83    Capsella rubella
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         276   1e-83    Brachypodium distachyon [annual false brome]
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    276   1e-83    Glycine max [soybeans]
ref|NP_001266848.1|  uncharacterized protein LOC101027225               265   2e-83    
gb|KHN33579.1|  Oligopeptide transporter 4                              274   2e-83    Glycine soja [wild soybean]
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         275   2e-83    Camelina sativa [gold-of-pleasure]
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         275   3e-83    Jatropha curcas
ref|XP_007018306.1|  Oligopeptide transporter 4                         275   3e-83    
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              275   3e-83    Camelina sativa [gold-of-pleasure]
emb|CDP04528.1|  unnamed protein product                                272   4e-83    Coffea canephora [robusta coffee]
gb|AFW63465.1|  hypothetical protein ZEAMMB73_812110                    268   6e-83    
emb|CBI19304.3|  unnamed protein product                                274   1e-82    Vitis vinifera
ref|XP_002527347.1|  Oligopeptide transporter, putative                 273   1e-82    Ricinus communis
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              273   1e-82    Vitis vinifera
emb|CDP19592.1|  unnamed protein product                                272   2e-82    Coffea canephora [robusta coffee]
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          273   2e-82    Amborella trichopoda
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        273   2e-82    
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              273   2e-82    Populus euphratica
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             273   2e-82    
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         273   2e-82    Solanum tuberosum [potatoes]
dbj|BAD08158.1|  putative sexual differentiation process protein ...    273   3e-82    Oryza sativa Japonica Group [Japonica rice]
gb|EEE57620.1|  hypothetical protein OsJ_08019                          273   3e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002892535.1|  ATOPT2                                             272   3e-82    Arabidopsis lyrata subsp. lyrata
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         272   3e-82    Sesamum indicum [beniseed]
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                272   4e-82    Erythranthe guttata [common monkey flower]
gb|EEC73829.1|  hypothetical protein OsI_08562                          272   6e-82    Oryza sativa Indica Group [Indian rice]
gb|ABE65610.1|  oligopeptide transporter OPT family protein             271   6e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_172464.1|  oligopeptide transporter 2                            271   7e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KDP41519.1|  hypothetical protein JCGZ_15926                         263   1e-81    Jatropha curcas
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             271   1e-81    Prunus persica
emb|CDY69955.1|  BnaCnng66090D                                          270   1e-81    Brassica napus [oilseed rape]
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              270   2e-81    Brassica rapa
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         270   4e-81    Solanum lycopersicum
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         270   4e-81    Nicotiana tomentosiformis
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    269   6e-81    Setaria italica
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         269   6e-81    Prunus mume [ume]
gb|EMS53301.1|  Oligopeptide transporter 4                              266   8e-81    Triticum urartu
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         268   9e-81    Cucumis melo [Oriental melon]
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    270   9e-81    
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         268   1e-80    Zea mays [maize]
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    268   2e-80    
ref|XP_006847459.1|  hypothetical protein AMTR_s03508p00001080          258   2e-80    
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         267   3e-80    Citrus sinensis [apfelsine]
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like         267   3e-80    Cucumis sativus [cucumbers]
ref|XP_004164894.1|  PREDICTED: oligopeptide transporter 4-like         267   3e-80    
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             266   5e-80    
dbj|BAD94325.1|  hypothetical protein                                   254   5e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             266   6e-80    Phaseolus vulgaris [French bean]
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         266   6e-80    
gb|EAY75055.1|  hypothetical protein OsI_02950                          266   6e-80    Oryza sativa Indica Group [Indian rice]
dbj|BAB89477.1|  isp4 protein-like                                      266   7e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004288877.2|  PREDICTED: oligopeptide transporter 2-like         267   7e-80    Fragaria vesca subsp. vesca
gb|KHG27447.1|  Oligopeptide transporter 2 -like protein                252   8e-80    Gossypium arboreum [tree cotton]
ref|XP_008348885.1|  PREDICTED: oligopeptide transporter 4-like         252   1e-79    
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     266   1e-79    Eucalyptus grandis [rose gum]
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             265   1e-79    Eutrema salsugineum [saltwater cress]
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         266   1e-79    Nelumbo nucifera [Indian lotus]
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         266   2e-79    Phoenix dactylifera
emb|CDY22616.1|  BnaC08g42500D                                          267   2e-79    Brassica napus [oilseed rape]
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         264   3e-79    Solanum lycopersicum
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              264   4e-79    Pyrus x bretschneideri [bai li]
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         265   4e-79    
ref|XP_010104574.1|  Oligopeptide transporter 4                         264   6e-79    Morus notabilis
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          263   6e-79    
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         263   9e-79    Nicotiana sylvestris
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         263   1e-78    Nicotiana tomentosiformis
emb|CDP00949.1|  unnamed protein product                                263   1e-78    Coffea canephora [robusta coffee]
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         262   2e-78    Nelumbo nucifera [Indian lotus]
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4              261   3e-78    Fragaria vesca subsp. vesca
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         261   5e-78    
emb|CDP19589.1|  unnamed protein product                                261   5e-78    Coffea canephora [robusta coffee]
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             261   6e-78    
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         261   6e-78    Nelumbo nucifera [Indian lotus]
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             259   1e-77    
gb|ACF78596.1|  unknown                                                 249   1e-77    Zea mays [maize]
gb|KHN08229.1|  Oligopeptide transporter 4                              259   1e-77    Glycine soja [wild soybean]
ref|XP_002874647.1|  ATOPT7                                             260   2e-77    
gb|EYU36438.1|  hypothetical protein MIMGU_mgv1a023798mg                258   2e-77    Erythranthe guttata [common monkey flower]
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         259   3e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              259   4e-77    Camelina sativa [gold-of-pleasure]
gb|KDO81278.1|  hypothetical protein CISIN_1g0461252mg                  254   5e-77    Citrus sinensis [apfelsine]
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         259   5e-77    Camelina sativa [gold-of-pleasure]
emb|CDP19590.1|  unnamed protein product                                259   5e-77    Coffea canephora [robusta coffee]
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              259   5e-77    
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         258   7e-77    
gb|AAB60748.1|  Similar to S. pombe ISP4 (gb|D83992)                    257   9e-77    
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         258   9e-77    
ref|NP_192815.1|  oligopeptide transporter 7                            258   1e-76    
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         258   1e-76    
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         258   2e-76    
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          257   2e-76    
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             257   2e-76    
gb|EPS65868.1|  hypothetical protein M569_08909                         253   2e-76    
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         257   2e-76    
ref|NP_194503.1|  oligopeptide transporter                              256   2e-76    
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         257   2e-76    
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         257   2e-76    
ref|XP_006413163.1|  hypothetical protein EUTSA_v10024804mg             253   3e-76    
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             257   3e-76    
ref|NP_200164.1|  oligopeptide transporter 8                            256   3e-76    
ref|XP_002867556.1|  ATOPT5                                             256   4e-76    
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         256   4e-76    
ref|XP_002867483.1|  ATOPT6                                             256   4e-76    
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    256   4e-76    
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             256   5e-76    
gb|KCW76549.1|  hypothetical protein EUGRSUZ_D00938                     253   5e-76    
ref|XP_010671041.1|  PREDICTED: oligopeptide transporter 2              255   5e-76    
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    256   5e-76    
ref|XP_010448244.1|  PREDICTED: oligopeptide transporter 5-like         256   7e-76    
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         255   8e-76    
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    255   8e-76    
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    255   8e-76    
ref|XP_010090089.1|  Oligopeptide transporter 7                         248   9e-76    
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         255   9e-76    
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         255   1e-75    
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         255   1e-75    
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         255   1e-75    
ref|XP_004238545.1|  PREDICTED: oligopeptide transporter 4-like         254   1e-75    
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    255   1e-75    
emb|CDY55351.1|  BnaAnng13860D                                          254   2e-75    
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         254   2e-75    
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         254   2e-75    
ref|NP_001169171.1|  hypothetical protein                               246   2e-75    
emb|CDY47076.1|  BnaA03g12220D                                          254   2e-75    
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         254   2e-75    
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         254   2e-75    
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         254   2e-75    
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              254   2e-75    
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             254   2e-75    
emb|CDY19030.1|  BnaC01g20380D                                          254   2e-75    
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         254   3e-75    
ref|XP_010438730.1|  PREDICTED: oligopeptide transporter 5              254   3e-75    
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              254   3e-75    
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              253   4e-75    
ref|XP_010433474.1|  PREDICTED: oligopeptide transporter 5-like         253   5e-75    
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    253   5e-75    
ref|XP_009795934.1|  PREDICTED: oligopeptide transporter 7-like i...    250   5e-75    
dbj|BAJ85921.1|  predicted protein                                      243   6e-75    
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             253   6e-75    
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    253   6e-75    
dbj|BAD94070.1|  sexual differentiation process protein ISP4-like       242   6e-75    
ref|XP_006656581.1|  PREDICTED: oligopeptide transporter 7-like         252   6e-75    
emb|CDY38751.1|  BnaC03g14980D                                          253   6e-75    
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         253   7e-75    
ref|NP_001167707.1|  uncharacterized protein LOC100381394               251   7e-75    
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         253   8e-75    
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         253   8e-75    
emb|CDX86844.1|  BnaA09g22340D                                          253   8e-75    
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              253   1e-74    
emb|CDY06549.1|  BnaC02g12730D                                          253   1e-74    
ref|XP_007156163.1|  hypothetical protein PHAVU_003G263700g             246   1e-74    
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         252   1e-74    
emb|CDX96230.1|  BnaC02g14210D                                          252   1e-74    
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                251   1e-74    
gb|KJB40154.1|  hypothetical protein B456_007G049100                    248   1e-74    
ref|NP_194389.1|  oligopeptide transporter 5                            252   2e-74    
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             252   2e-74    
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         252   2e-74    
emb|CBI34570.3|  unnamed protein product                                251   2e-74    
ref|XP_002864248.1|  predicted protein                                  251   2e-74    
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         251   2e-74    
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              251   2e-74    
emb|CDY28832.1|  BnaA02g10240D                                          251   2e-74    
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         251   2e-74    
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                251   2e-74    
dbj|BAJ85522.1|  predicted protein                                      249   2e-74    
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g             251   2e-74    
ref|XP_003603705.1|  Oligopeptide transporter                           251   3e-74    
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         251   3e-74    
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          251   3e-74    
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          251   3e-74    
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              251   3e-74    
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         251   3e-74    
dbj|BAJ95761.1|  predicted protein                                      249   3e-74    
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              251   3e-74    
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    251   4e-74    
emb|CDP01884.1|  unnamed protein product                                251   5e-74    
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    251   5e-74    
ref|NP_001130398.1|  uncharacterized protein LOC100191494               251   6e-74    
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          251   6e-74    
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         250   6e-74    
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             250   8e-74    
ref|XP_010485098.1|  PREDICTED: oligopeptide transporter 8-like         249   8e-74    
ref|XP_010932249.1|  PREDICTED: oligopeptide transporter 5-like         237   9e-74    
gb|KDP39297.1|  hypothetical protein JCGZ_01054                         249   1e-73    
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like         249   1e-73    
ref|NP_001056665.1|  Os06g0127700                                       250   1e-73    
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         249   1e-73    
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              249   2e-73    
ref|NP_001056650.2|  Os06g0125400                                       235   2e-73    
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    249   2e-73    
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         249   2e-73    
ref|XP_008346658.1|  PREDICTED: oligopeptide transporter 7-like         244   2e-73    
gb|KDP39296.1|  hypothetical protein JCGZ_01053                         249   2e-73    
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          249   2e-73    
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         249   3e-73    
ref|XP_007156164.1|  hypothetical protein PHAVU_003G263700g             247   3e-73    
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         248   4e-73    
gb|KJB68518.1|  hypothetical protein B456_010G248000                    248   4e-73    
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    248   4e-73    
ref|XP_002864417.1|  ATOPT1                                             248   4e-73    
gb|KCW53169.1|  hypothetical protein EUGRSUZ_J02450                     244   4e-73    
emb|CCO06497.1|  oligopeptide transporter                               248   4e-73    
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         248   4e-73    
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    248   5e-73    
dbj|BAD67732.1|  putative sexual differentiation process protein ...    248   6e-73    
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         248   6e-73    
gb|EEC79904.1|  hypothetical protein OsI_21444                          248   6e-73    
gb|KJB40153.1|  hypothetical protein B456_007G049100                    248   6e-73    
gb|KDP39295.1|  hypothetical protein JCGZ_01052                         247   6e-73    
gb|EMS65130.1|  Oligopeptide transporter 7                              246   6e-73    
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    247   7e-73    
ref|XP_008374152.1|  PREDICTED: oligopeptide transporter 7-like         244   7e-73    
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       248   7e-73    
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              247   8e-73    
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    248   8e-73    
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         248   8e-73    
gb|KCW45497.1|  hypothetical protein EUGRSUZ_L00776                     245   8e-73    
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...    248   9e-73    
ref|XP_010536754.1|  PREDICTED: oligopeptide transporter 5-like         247   9e-73    
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             247   1e-72    
ref|XP_009414381.1|  PREDICTED: oligopeptide transporter 5-like         247   1e-72    
emb|CDP13696.1|  unnamed protein product                                246   1e-72    
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             247   1e-72    
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         247   1e-72    
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         249   1e-72    
ref|XP_009142514.1|  PREDICTED: oligopeptide transporter 5              247   1e-72    
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             247   1e-72    
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         248   1e-72    
gb|KDP35527.1|  hypothetical protein JCGZ_08965                         243   1e-72    
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g             247   1e-72    
gb|KCW53166.1|  hypothetical protein EUGRSUZ_J02448                     244   2e-72    
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    247   2e-72    
ref|XP_004511249.1|  PREDICTED: oligopeptide transporter 7-like         246   2e-72    
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    247   2e-72    
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         248   2e-72    
gb|EYU45287.1|  hypothetical protein MIMGU_mgv1a0020141mg               232   2e-72    
emb|CDX94308.1|  BnaC01g18760D                                          247   2e-72    
ref|XP_010113336.1|  Oligopeptide transporter 7                         249   2e-72    
emb|CDX89322.1|  BnaA01g15710D                                          246   2e-72    
gb|EPS62495.1|  hypothetical protein M569_12295                         246   2e-72    
ref|XP_010097383.1|  Oligopeptide transporter 1                         246   2e-72    
ref|XP_009137603.1|  PREDICTED: oligopeptide transporter 5-like         246   2e-72    
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         246   2e-72    
gb|KEH19466.1|  oligopeptide transporter OPT family protein             244   2e-72    
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                246   2e-72    
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    246   3e-72    
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         246   3e-72    
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         246   3e-72    
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    246   3e-72    
gb|EMT07894.1|  Oligopeptide transporter 7                              246   3e-72    
ref|XP_009414376.1|  PREDICTED: oligopeptide transporter 5-like         245   4e-72    
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         246   4e-72    
ref|XP_009777242.1|  PREDICTED: oligopeptide transporter 1-like         245   5e-72    
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             245   5e-72    
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             245   5e-72    
ref|XP_010034698.1|  PREDICTED: oligopeptide transporter 7-like         245   6e-72    
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         245   6e-72    
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             245   7e-72    
ref|XP_003628537.1|  Oligopeptide transporter                           244   7e-72    
gb|KJB39494.1|  hypothetical protein B456_007G016300                    244   7e-72    
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              244   8e-72    
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g             244   9e-72    
ref|XP_007208018.1|  hypothetical protein PRUPE_ppa003195mg             241   1e-71    
dbj|BAJ85948.1|  predicted protein                                      244   1e-71    
ref|NP_200404.1|  oligopeptide transporter 1                            244   1e-71    
gb|AET00810.2|  oligopeptide transporter OPT family protein             244   1e-71    
ref|XP_003617851.1|  Oligopeptide transporter OPT family                244   1e-71    
ref|XP_007039134.1|  Oligopeptide transporter 1 isoform 3               240   1e-71    
ref|XP_002530420.1|  Oligopeptide transporter, putative                 243   1e-71    
ref|XP_007039427.1|  Oligopeptide transporter 7 isoform 2               239   2e-71    
gb|KCW77331.1|  hypothetical protein EUGRSUZ_D01692                     243   2e-71    
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         244   2e-71    
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    244   2e-71    
emb|CAH67988.1|  OSIGBa0142I02-OSIGBa0101B20.31                         243   2e-71    
ref|NP_001053729.2|  Os04g0594800                                       244   2e-71    
emb|CAE04152.1|  OSJNBa0009P12.37                                       243   2e-71    
gb|KCW76553.1|  hypothetical protein EUGRSUZ_D00943                     239   2e-71    
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    243   2e-71    
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         243   2e-71    
ref|XP_006452633.1|  hypothetical protein CICLE_v10007763mg             241   2e-71    
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              243   3e-71    
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         243   3e-71    
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         243   3e-71    
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              243   3e-71    
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         243   3e-71    
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         243   3e-71    
ref|XP_010109222.1|  Oligopeptide transporter 6                         243   4e-71    
ref|XP_008449039.1|  PREDICTED: oligopeptide transporter 5-like         243   4e-71    
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         244   4e-71    
ref|XP_010644740.1|  PREDICTED: oligopeptide transporter 1-like         237   4e-71    
ref|XP_008366120.1|  PREDICTED: oligopeptide transporter 1-like         242   4e-71    
ref|XP_009773686.1|  PREDICTED: oligopeptide transporter 7-like i...    241   5e-71    
ref|XP_007162247.1|  hypothetical protein PHAVU_001G136300g             241   5e-71    
ref|XP_006413037.1|  hypothetical protein EUTSA_v10024519mg             239   5e-71    
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    243   5e-71    
ref|XP_007039133.1|  Oligopeptide transporter 1 isoform 2               240   5e-71    
ref|XP_008347530.1|  PREDICTED: oligopeptide transporter 1-like         236   5e-71    
ref|XP_009773685.1|  PREDICTED: oligopeptide transporter 7-like i...    242   5e-71    
emb|CAN76256.1|  hypothetical protein VITISV_023414                     233   5e-71    
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         242   6e-71    
gb|KHG17687.1|  Oligopeptide transporter 7                              243   6e-71    
gb|EAZ26400.1|  hypothetical protein OsJ_10283                          242   7e-71    
ref|XP_008218454.1|  PREDICTED: oligopeptide transporter 1-like         242   7e-71    



>ref|XP_003635158.1| PREDICTED: oligopeptide transporter 3-like [Vitis vinifera]
Length=283

 Score =   389 bits (1000),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIW
Sbjct  71   PRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIW  130

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGM
Sbjct  131  GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGM  190

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+
Sbjct  191  PPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEN  250

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG++LDHCPLA+CPT PGIVVEGCPVF+
Sbjct  251  HNLKWWGTKLDHCPLATCPTQPGIVVEGCPVFQ  283



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWMLGSIENICD +AL P+SPWTCPKFRVTFDASVIW
Sbjct  539  PRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVEALHPDSPWTCPKFRVTFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  599  GLIGPQRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVFKYRK WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  659  PPATPTNIASWLITGMIFNYFVFKYRKEWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  718

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+ELDHCPLA+CPTAPGIVV GCPVFK
Sbjct  719  KNLKWWGTELDHCPLATCPTAPGIVVAGCPVFK  751



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSG VNLAV WWMLGSIEN+CD +AL P SPWTCPKFRVTFDASVIW
Sbjct  543  PRCMYTAQLVGTLVSGTVNLAVAWWMLGSIENLCDVEALHPESPWTCPKFRVTFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLF+IGAVLPVPVW+LSKMFP++KWIPLINIPVISYGFAGM
Sbjct  603  GLIGPERLFGPGGLYRNLVWLFIIGAVLPVPVWMLSKMFPDQKWIPLINIPVISYGFAGM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SWI+TG+IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  663  PPATPTNIASWIITGMIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  722

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K +KWWG+E DHCPLASCPTAPGIVVEGCP+FK
Sbjct  723  KNIKWWGAEPDHCPLASCPTAPGIVVEGCPLFK  755



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G +NLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDASVIW
Sbjct  540  PRCMYTAQLVGTLVAGTINLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDASVIW  599

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGA+LPVP+WVLSKMFPEKKWIPLINIPVISYGFAGM
Sbjct  600  GLIGPERLFGPGGLYRNLVWLFLIGALLPVPIWVLSKMFPEKKWIPLINIPVISYGFAGM  659

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVFKYRK WW+KYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  660  PPATPTNIASWLITGMIFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMGVLLFFALQNEG  719

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+ELDHCPLA+CPTAPGI+V+GCPVFK
Sbjct  720  KNLKWWGTELDHCPLATCPTAPGIIVQGCPVFK  752



>emb|CBI18636.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   381 bits (979),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 195/210 (93%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIW
Sbjct  5    PRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIW  64

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGM
Sbjct  65   GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGM  124

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+
Sbjct  125  PPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEN  184

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
              LKWWG++LDHCPLA+CPT PGIVVEGCP
Sbjct  185  HNLKWWGTKLDHCPLATCPTQPGIVVEGCP  214



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G +NLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDASVIW
Sbjct  543  PRCMYTAQLVGTLVAGTINLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGA+LPVP+WVLSKMFPEKKWIPLINIPVISYGFAGM
Sbjct  603  GLIGPERLFGPGGLYRNLVWLFLIGALLPVPIWVLSKMFPEKKWIPLINIPVISYGFAGM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVFKYRK WW+KYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  663  PPATPTNIASWLITGMIFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMGVLLFFALQNEG  722

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+ELDHCPLA+CPTAPGI+V+GCPVF 
Sbjct  723  KNLKWWGTELDHCPLATCPTAPGIIVQGCPVFN  755



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIW
Sbjct  539  PRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFG GGLYRNLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  599  GLIGPERLFGSGGLYRNLVWLFLIGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVFKYRK WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  659  PPATPTNIASWLITGMIFNYFVFKYRKEWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  718

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG++LDHCPLA+CPTAPGIVV GCPVFK
Sbjct  719  KNLKWWGTQLDHCPLATCPTAPGIVVAGCPVFK  751



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 196/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSG VNLAV WWMLGSIENICD +AL P SPWTCPKFRVTFDASVIW
Sbjct  528  PRCMYTAQLVGTLVSGTVNLAVAWWMLGSIENICDVEALHPESPWTCPKFRVTFDASVIW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVW+LSK+FP+KKWIPLINIPVISYGFAGM
Sbjct  588  GLIGPERLFGPGGLYRNLVWLFLIGAVLPVPVWILSKIFPDKKWIPLINIPVISYGFAGM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SWI+TG IFNYFVFKYRK WWQ+YNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  648  PPATPTNIASWIITGTIFNYFVFKYRKTWWQRYNYVLSAALDAGTAFMGVLLFFALQNEG  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K + WWGS+ DHCPLASCPTAPGI VEGCP F+
Sbjct  708  KNVNWWGSKPDHCPLASCPTAPGIAVEGCPFFR  740



>gb|KDO78547.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=441

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIW
Sbjct  229  PRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIW  288

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  289  GLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  348

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  349  PPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNND  408

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  409  INLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  441



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIW
Sbjct  536  PRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIW  595

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGM
Sbjct  596  GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGM  655

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+
Sbjct  656  PPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEN  715

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG++LDHCPLA+CPT PGIVVEGCPVF+
Sbjct  716  HNLKWWGTKLDHCPLATCPTQPGIVVEGCPVFQ  748



>gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   391 bits (1005),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSMY AQLVGT V+G +NLAV WWML +IENICD DAL P SPWTCPK+RVTFDASVIW
Sbjct  531  PRSMYAAQLVGTFVAGTLNLAVAWWMLENIENICDVDALHPESPWTCPKYRVTFDASVIW  590

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGA LPVP+W+LSKM+PEKKWIPLINIPVISYGFAGM
Sbjct  591  GLIGPKRLFGPGGLYRNLVWLFLIGAFLPVPIWILSKMYPEKKWIPLINIPVISYGFAGM  650

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  651  PPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  710

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K LKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  711  KNLKWWGTEIDHCPLASCPTAPGIEVKGCPVF  742



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   391 bits (1005),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWMLGSIENICD + L P+SPWTCPKFRVTFDASVIW
Sbjct  536  PRCMYTAQLVGTLVAGTVNLAVAWWMLGSIENICDVETLHPDSPWTCPKFRVTFDASVIW  595

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVWV+SK+FPEKKWIPLINIPVISYGFAGM
Sbjct  596  GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPVWVMSKIFPEKKWIPLINIPVISYGFAGM  655

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE+
Sbjct  656  PPATPTNIASWLITGAIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEN  715

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK*ASS  98
              LKWWG++LDHCPLA+CPT PGIVVEGCPV    SS
Sbjct  716  HNLKWWGTKLDHCPLATCPTQPGIVVEGCPVSSGKSS  752



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MYVAQLVGTL++G VNLAV WWML ++ENICD +AL P SPWTCPK+RVTFDASVIW
Sbjct  522  PRCMYVAQLVGTLIAGTVNLAVAWWMLENVENICDIEALHPESPWTCPKYRVTFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGA LPVP+W+LSKMFPEKKWIPLINIPVISYGFAGM
Sbjct  582  GLIGPRRLFGPGGLYRNLVWLFLIGAFLPVPIWILSKMFPEKKWIPLINIPVISYGFAGM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  642  PPATPTNIASWLVTGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  701

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K LKWWG+E+DHCPLA+CPTAPGI VEGCPVF
Sbjct  702  KTLKWWGTEIDHCPLATCPTAPGITVEGCPVF  733



>gb|KDO78546.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=527

 Score =   383 bits (984),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIW
Sbjct  315  PRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIW  374

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  375  GLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  434

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  435  PPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNND  494

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  495  INLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  527



>gb|ABF98906.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=528

 Score =   382 bits (982),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  317  PRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIW  376

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  377  GLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  436

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  437  PPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  496

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+ +DHCPLASCPTAPGI V+GCPVF
Sbjct  497  HELKWWGTAVDHCPLASCPTAPGIAVKGCPVF  528



>ref|XP_010270227.1| PREDICTED: oligopeptide transporter 3 [Nelumbo nucifera]
Length=746

 Score =   389 bits (999),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR M+ AQLVGT+++G VNLAV WWMLGSI+NICD +AL P+SPWTCPKFRVTFDASVIW
Sbjct  534  PRCMFTAQLVGTIIAGTVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKFRVTFDASVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVPVW+LSKMFPEKKWIPLINIPVISYGFAGM
Sbjct  594  GLIGPERLFGPGGLYRNLVWLFLIGAVLPVPVWILSKMFPEKKWIPLINIPVISYGFAGM  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+ TG IFNYFVF+YRK WWQ+YNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  654  PPATPTNIASWLATGTIFNYFVFRYRKRWWQRYNYVLSAALDAGTAFMGVLLFFALQNEG  713

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            + LKWWG++ DHCPLA+CPT PGI V+GCPVFK
Sbjct  714  RNLKWWGTKYDHCPLATCPTEPGIAVKGCPVFK  746



>ref|XP_009380132.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   388 bits (997),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SIENICD ++L P+SPWTCPK+RVTFDASVIW
Sbjct  529  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIENICDVESLHPDSPWTCPKYRVTFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG GGLYRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  589  GLIGPGRLFGHGGLYRNLVWLFLVGAVLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQN+ 
Sbjct  649  PPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNQD  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              LKWWG+ELDHCPLASCPTAPGI VEGCPVF
Sbjct  709  HNLKWWGTELDHCPLASCPTAPGISVEGCPVF  740



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G VNLAV WWML SI+NICD +   P SPWTCPK+RVTFDASVIW
Sbjct  527  PRCMYTAQLVGTLVAGTVNLAVAWWMLDSIDNICDVEGKHPESPWTCPKYRVTFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  587  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  647  PPATPTNIASWLITGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              +KWWG+E+DHCPLASCPTAPGI VEGCPVFK
Sbjct  707  HNVKWWGTEVDHCPLASCPTAPGITVEGCPVFK  739



>gb|ADW66457.1| oligopeptide transporter [Phytolacca americana]
Length=733

 Score =   388 bits (996),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSGVVNLAV WWML SI+N+CD ++L+PNSPWTCPKFRVTFDASVIW
Sbjct  522  PRCMYTAQLVGTLVSGVVNLAVAWWMLASIDNLCDVESLNPNSPWTCPKFRVTFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVW+L K++PEKKWIPLINIPVISYGFAGM
Sbjct  582  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWILHKIYPEKKWIPLINIPVISYGFAGM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKYRK WW+KYNYVLSAALDAGTAFMAV +FFALQNE 
Sbjct  642  PPATPTNIASWLVTGTIFNYFVFKYRKEWWKKYNYVLSAALDAGTAFMAVFIFFALQNEK  701

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
             +LKWWG+++DHCPLASCPTAPGIVV+GCP
Sbjct  702  IDLKWWGTDIDHCPLASCPTAPGIVVQGCP  731



>ref|XP_010039442.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW45989.1| hypothetical protein EUGRSUZ_L00157 [Eucalyptus grandis]
Length=745

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSGVVNLAV WWML  IENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  533  PRCMYTAQLVGTLVSGVVNLAVAWWMLDGIENICDVEALHPDSPWTCPKYRVTFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNL+WLFLIGAVLPVP+W LSKMFPEKKWI LINIPVISYGFAGM
Sbjct  593  GLIGPRRLFGPGGLYRNLIWLFLIGAVLPVPIWALSKMFPEKKWIALINIPVISYGFAGM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRK WWQKYNY+LSAALDAGTAFM VLLFFALQNE+
Sbjct  653  PPATPTNIASWLITGTIFNYFVFRYRKRWWQKYNYILSAALDAGTAFMGVLLFFALQNEN  712

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+++DHCPLASCPTAPGI V  CPVF 
Sbjct  713  KNLKWWGTDIDHCPLASCPTAPGISVPNCPVFN  745



>ref|XP_009397220.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+VSGVVNLAV WWMLGSIENICD DAL P SPWTCPK+RVTFDASVIW
Sbjct  537  PRCMYTAQLVGTVVSGVVNLAVAWWMLGSIENICDVDALHPESPWTCPKYRVTFDASVIW  596

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP RLFG GGLYRNLVWLFL+GA LPVPVW LSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  597  GLVGPGRLFGHGGLYRNLVWLFLVGAALPVPVWALSKIFPEKKWIPLINIPVISYGFAGM  656

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQN +
Sbjct  657  PPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNAN  716

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L+WWG+ELDHCPLASCPT PGI V+GCPVF
Sbjct  717  HNLRWWGTELDHCPLASCPTEPGISVKGCPVF  748



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MYVAQLVGT V+G VNLAV WWML +IENICDTD L  NSPWTCPK+RVTFDASVIW
Sbjct  533  PRCMYVAQLVGTFVAGTVNLAVAWWMLENIENICDTDVLDSNSPWTCPKYRVTFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGP GLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGM
Sbjct  593  GLIGPRRLFGPDGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  
Sbjct  653  PPATPTNIASWLVTGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNSG  712

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K+LKWWG+ELDHCPLASCPTAPGIVV+GCPVF
Sbjct  713  KQLKWWGTELDHCPLASCPTAPGIVVKGCPVF  744



>gb|ABF70152.1| oligopeptide transporter OPT family protein [Musa acuminata]
Length=748

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+VSGVVNLAV WWMLGSIENICD DAL P SPWTCPK+RVTFDASVIW
Sbjct  537  PRCMYTAQLVGTVVSGVVNLAVAWWMLGSIENICDVDALHPESPWTCPKYRVTFDASVIW  596

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP RLFG GGLYRNLVWLFL+GA LPVPVW LSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  597  GLVGPGRLFGHGGLYRNLVWLFLVGAALPVPVWALSKIFPEKKWIPLINIPVISYGFAGM  656

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQN +
Sbjct  657  PPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNAN  716

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L+WWG+ELDHCPLASCPT PGI V+GCPVF
Sbjct  717  HNLRWWGTELDHCPLASCPTEPGISVKGCPVF  748



>ref|XP_002463868.1| hypothetical protein SORBIDRAFT_01g007900 [Sorghum bicolor]
 gb|EER90866.1| hypothetical protein SORBIDRAFT_01g007900 [Sorghum bicolor]
Length=349

 Score =   374 bits (960),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQL+GT+V+GVVNLAV WWML +I+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  138  PRCMYTAQLIGTVVAGVVNLAVAWWMLDNIDNICDVEALHPDSPWTCPKYRVTFDASVIW  197

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  198  GLIGPGRLFGRHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  257

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI +W+VTG IFN+FVF+YRK WWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  258  PPATPTNIATWLVTGTIFNFFVFRYRKAWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  317

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  318  HDLKWWGTEVDHCPLASCPTAPGIAVKGCPVF  349



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   387 bits (993),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+ M+ AQLVGT VSG VNLAV WWMLGSIENICD +AL P SPWTCPKFRVTFDASVIW
Sbjct  533  PKCMFTAQLVGTFVSGTVNLAVAWWMLGSIENICDVEALHPESPWTCPKFRVTFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGA LPVPVWVLSK++PEKKWIPLINIPVISYGFAGM
Sbjct  593  GLIGPERLFGPGGMYRNLVWLFLIGAFLPVPVWVLSKIYPEKKWIPLINIPVISYGFAGM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SWI+TG +FNYFVFKYRK WWQ+YNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  653  PPATPTNIASWIITGTVFNYFVFKYRKTWWQRYNYVLSAALDAGTAFMGVLLFFALQNEG  712

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              +KWWGS+ DHCPLASCPTAPGIVV+GCPVF 
Sbjct  713  VNVKWWGSQPDHCPLASCPTAPGIVVQGCPVFS  745



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MYVAQLVGT V+G +NLAV WWML +IENICDTD L  +SPWTCPK+RVTFDASVIW
Sbjct  533  PRCMYVAQLVGTFVAGTLNLAVAWWMLENIENICDTDVLDSSSPWTCPKYRVTFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGM
Sbjct  593  GLIGPRRLFGPGGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  
Sbjct  653  PPATPTNIASWLVTGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNSG  712

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            KELKWWG+E+DHCPLASCPTAPGIVV+GCPVF
Sbjct  713  KELKWWGTEVDHCPLASCPTAPGIVVKGCPVF  744



>ref|XP_010907563.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=735

 Score =   385 bits (990),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G++NLAV WWML SIENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  524  PRCMYTAQLVGTVVAGIMNLAVAWWMLESIENICDVEALHPDSPWTCPKYRVTFDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG GGLYRNLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  584  GLIGPGRLFGHGGLYRNLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VLLFFALQNE+
Sbjct  644  PPATPTNIASWLITGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLLFFALQNEN  703

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + L WWG+ELDHCPLASCPT PGI V+GCPVF
Sbjct  704  RNLSWWGTELDHCPLASCPTEPGISVKGCPVF  735



>ref|XP_002323123.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEF04884.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=661

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MYVAQLVGTLV+G VNLAV WWML +IENICD D+   NSPWTCPK+RVTFDASVIW
Sbjct  450  PRCMYVAQLVGTLVAGTVNLAVAWWMLENIENICDVDSQDSNSPWTCPKYRVTFDASVIW  509

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGM
Sbjct  510  GLIGPKRLFGPGGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGM  569

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PP+TPTNI SW++TG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  
Sbjct  570  PPSTPTNIASWLITGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNTD  629

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K+L WWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  630  KKLSWWGAELDHCPLATCPTAPGIVVKGCPVF  661



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MYVAQLVGTLV+G VNLAV WWML +IENICD D+   NSPWTCPK+RVTFDASVIW
Sbjct  532  PRCMYVAQLVGTLVAGTVNLAVAWWMLENIENICDVDSQDSNSPWTCPKYRVTFDASVIW  591

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGA LPVP WVLSKMFPEKKWI LINIPVISYGFAGM
Sbjct  592  GLIGPKRLFGPGGLYRNLVWLFLIGAFLPVPFWVLSKMFPEKKWIALINIPVISYGFAGM  651

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFFA+QN  
Sbjct  652  PPATPTNIASWLITGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFAVQNTD  711

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K+L WWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  712  KKLSWWGAELDHCPLATCPTAPGIVVKGCPVF  743



>ref|XP_010686627.1| PREDICTED: oligopeptide transporter 3 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   385 bits (989),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML +I+N+CD ++L+PNSPWTCPKFRVTFDASVIW
Sbjct  530  PRCMYTAQLVGTLVAGVVNLAVAWWMLATIDNLCDVESLNPNSPWTCPKFRVTFDASVIW  589

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG GGLYRNLVWLFLIGAVLPVPVWVL KMFP+ KWIPLINIPVISYGFAGM
Sbjct  590  GLIGPNRLFGSGGLYRNLVWLFLIGAVLPVPVWVLHKMFPKNKWIPLINIPVISYGFAGM  649

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKYRK WW++YNYVLSAALDAGTAFMAVL+FFALQNE+
Sbjct  650  PPATPTNIASWLVTGTIFNYFVFKYRKEWWKRYNYVLSAALDAGTAFMAVLIFFALQNEN  709

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            KELKWWG+++DHCPLASCPTAPGI+VE CP+
Sbjct  710  KELKWWGTDIDHCPLASCPTAPGIMVEKCPL  740



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSGVVNL V WWML S+ENICD ++L P+S WTCPK+RVTFDASVIW
Sbjct  527  PRCMYTAQLVGTLVSGVVNLGVAWWMLESVENICDVESLHPDSQWTCPKYRVTFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  587  GLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  647  PPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNND  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  707  INLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  739



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIW
Sbjct  527  PRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  587  GLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  647  PPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNND  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  707  INLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  739



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   384 bits (987),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+VSGVVNL V WWML SIENICD ++L P+S WTCPK+RVTFDASVIW
Sbjct  527  PRCMYTAQLVGTIVSGVVNLGVAWWMLESIENICDVESLHPDSQWTCPKYRVTFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFL+GAVLPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  587  GLIGPRRLFGPGGMYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWIPLINIPVISYGFAGM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  647  PPATPTNIASWLITGMIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNND  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+ +DHCPLA+CPTAPGI VEGCPVFK
Sbjct  707  INLKWWGTHVDHCPLATCPTAPGIAVEGCPVFK  739



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   384 bits (986),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  515  PRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIW  574

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  575  GLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  634

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  635  PPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  694

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+ +DHCPLASCPTAPGI V+GCPVF
Sbjct  695  HELKWWGTAVDHCPLASCPTAPGIAVKGCPVF  726



>ref|XP_008665425.1| PREDICTED: oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  537  PRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIW  596

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  597  GLIGPGRLFGQHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  656

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  657  PPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  716

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  717  HELKWWGTEVDHCPLASCPTAPGIAVKGCPVF  748



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  535  PRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIW  594

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  595  GLIGPGRLFGQHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  654

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  655  PPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  714

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  715  HELKWWGTEVDHCPLASCPTAPGIAVKGCPVF  746



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   384 bits (986),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  539  PRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLF++GAVLPVPVW+LS+ FPEKKWI LINIPVISYGFAGM
Sbjct  599  GLIGPGRLFGRHGLYRNLVWLFVVGAVLPVPVWLLSRAFPEKKWIALINIPVISYGFAGM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  659  PPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  718

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+E+DHCPLASCPTAPGIVV+GCPVF
Sbjct  719  HELKWWGTEVDHCPLASCPTAPGIVVKGCPVF  750



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   384 bits (986),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  546  PRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIW  605

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  606  GLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  665

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  666  PPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  725

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+ +DHCPLASCPTAPGI V+GCPVF
Sbjct  726  HELKWWGTAVDHCPLASCPTAPGIAVKGCPVF  757



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G+VNLAV WWML SI+N+CD DAL PNSPWTCPK+RVTFDASVIW
Sbjct  522  PRCMYTAQLVGTLVAGIVNLAVAWWMLESIDNLCDIDALHPNSPWTCPKYRVTFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLF++GA LPVP+W+LSK+FP+KKWIPLIN+PVI+YGFAGM
Sbjct  582  GLIGPKRLFGPGGLYRNLVWLFIVGAFLPVPIWILSKIFPDKKWIPLINMPVITYGFAGM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN +
Sbjct  642  PPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNN  701

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +KWWG+ELDHCPLA+CPTAPGI VEGCPVF
Sbjct  702  YNVKWWGTELDHCPLATCPTAPGIKVEGCPVF  733



>gb|KHG20373.1| Oligopeptide transporter 3 -like protein [Gossypium arboreum]
Length=741

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/213 (84%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G+VNL V WWML  I+NICD +   P+SPWTCPK+RVTFDASVIW
Sbjct  529  PRCMYTAQLVGTVVAGIVNLGVAWWMLDDIDNICDVEGNHPDSPWTCPKYRVTFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  589  GLIGPRRLFGPGGMYRNLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  649  PPATPTNIASWLITGTIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+E+DHCPLA+CPTAPGI VEGCPVFK
Sbjct  709  HNLKWWGTEVDHCPLATCPTAPGISVEGCPVFK  741



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   381 bits (978),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDASVIW
Sbjct  486  PRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDASVIW  545

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGM
Sbjct  546  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGM  605

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  606  PPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  665

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWGSELDHCPLA+CPTAPGI VEGCPVFK
Sbjct  666  HNLKWWGSELDHCPLATCPTAPGIEVEGCPVFK  698



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDASVIW
Sbjct  530  PRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDASVIW  589

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGM
Sbjct  590  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGM  649

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  650  PPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  709

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWGSELDHCPLA+CPTAPGI VEGCPVFK
Sbjct  710  HNLKWWGSELDHCPLATCPTAPGIEVEGCPVFK  742



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   380 bits (977),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML +IENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  510  PRCMYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIW  569

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  570  GLIGPGRLFGQHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  629

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI +W+VTG IFNYFVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  630  PPATPTNIATWLVTGTIFNYFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  689

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+E+DHCPLASCP APGI V+GCPVF
Sbjct  690  HELKWWGTEVDHCPLASCPPAPGIAVKGCPVF  721



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   380 bits (977),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML SIENICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  534  PRCMYTAQLVGTVVAGVVNLAVAWWMLDSIENICDVEALHPDSPWTCPKYRVTFDASVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLF++GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGFAGM
Sbjct  594  GLIGPGRLFGQHGLYRNLVWLFVVGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGFAGM  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG +FN+FVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  654  PPATPTNIASWLVTGTVFNFFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  713

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLA+CPTAPGIVV+GCPVF
Sbjct  714  HDLKWWGTEVDHCPLATCPTAPGIVVKGCPVF  745



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D +  +SPWTCPK+RVTFDASVIW
Sbjct  529  PRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKVHHDSPWTCPKYRVTFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGM
Sbjct  589  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  649  PPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWGSELDHCPLA+CPTAPGI V+GCPVFK
Sbjct  709  HNLKWWGSELDHCPLATCPTAPGIEVDGCPVFK  741



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML SI+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  539  PRCMYTAQLVGTVVAGVVNLAVAWWMLDSIDNICDVEALHPDSPWTCPKYRVTFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLF++GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGFAGM
Sbjct  599  GLIGPGRLFGQHGLYRNLVWLFVVGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGFAGM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG +FN+FVF+YRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  659  PPATPTNIASWLVTGTVFNFFVFRYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  718

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLA+CPTAPGIVV+GCPVF
Sbjct  719  HDLKWWGTEVDHCPLATCPTAPGIVVKGCPVF  750



>gb|KHN03544.1| Oligopeptide transporter 3 [Glycine soja]
Length=725

 Score =   379 bits (972),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D +  +SPWTCPK+RVTFDASVIW
Sbjct  513  PRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKVHHDSPWTCPKYRVTFDASVIW  572

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWIPLINIPVI+YGFAGM
Sbjct  573  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIPLINIPVITYGFAGM  632

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP NI SW+VTG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  633  PPATPANIASWLVTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  692

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWGSELDHCPLA+CPTAPGI V+GCPVFK
Sbjct  693  HNLKWWGSELDHCPLATCPTAPGIEVDGCPVFK  725



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   379 bits (973),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G+VNLAV WWML SI+N+CD DA  PNSPWTCPK++VTFDASVIW
Sbjct  528  PRCMYTAQLVGTLVAGIVNLAVAWWMLESIDNLCDIDAHHPNSPWTCPKYKVTFDASVIW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLF++GA LPVP+W+LSK+FP+KKWIPLIN+PVI+YGFAGM
Sbjct  588  GLIGPRRLFGPGGLYRNLVWLFIVGAFLPVPIWILSKIFPDKKWIPLINMPVITYGFAGM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN +
Sbjct  648  PPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNN  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +KWWG+ELDHCPLA+CPTAPGI VEGCPVF
Sbjct  708  YNVKWWGTELDHCPLATCPTAPGIKVEGCPVF  739



>ref|XP_010057794.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW75109.1| hypothetical protein EUGRSUZ_E03859 [Eucalyptus grandis]
Length=744

 Score =   379 bits (972),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MYVAQLVGT+V+ +VNLAV WWML +I +ICD +   P+SPWTCPK+RVTFDASVIW
Sbjct  532  PRCMYVAQLVGTVVAALVNLAVAWWMLENINDICDVEGQHPDSPWTCPKYRVTFDASVIW  591

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK+FPEKKWI LINIPVISYGFAGM
Sbjct  592  GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIFPEKKWIALINIPVISYGFAGM  651

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN +
Sbjct  652  PPATPTNIASWLITGMIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNNN  711

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + LKWWGSELDHCPLASCPT PGIVV+GC VF
Sbjct  712  RNLKWWGSELDHCPLASCPTEPGIVVKGCRVF  743



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   379 bits (972),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G+VNL V WWML  I+NICD +   P+SPWTCPK+RVTFDASVIW
Sbjct  529  PRCMYTAQLVGTVVAGIVNLGVAWWMLDDIDNICDVEGNHPDSPWTCPKYRVTFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGA LPVPVWVLSK+FPEKKWIPLINIPVISYGFAGM
Sbjct  589  GLIGPRRLFGPGGMYRNLVWLFLIGAFLPVPVWVLSKIFPEKKWIPLINIPVISYGFAGM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  649  PPATPTNIASWLITGTIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
              LKWWG+E+DHCPLA+CPTAPGI V+GC VFK
Sbjct  709  HNLKWWGTEVDHCPLATCPTAPGISVDGCRVFK  741



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   378 bits (971),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSG+VNLAV WWML SIENICD ++ +PNSPWTCPK+RVTFDASVIW
Sbjct  538  PRCMYTAQLVGTLVSGIVNLAVAWWMLESIENICDVESQNPNSPWTCPKYRVTFDASVIW  597

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFL+GA LPVP+WV+SK+FP+KKWIPLIN+PVI YGFAGM
Sbjct  598  GLIGPRRLFGPGGLYRNLVWLFLVGAFLPVPIWVMSKIFPDKKWIPLINMPVILYGFAGM  657

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  658  PPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPK  717

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG++LDHCPLA+CP APGI V+GCPVF
Sbjct  718  HELKWWGTKLDHCPLATCPIAPGIHVDGCPVF  749



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   377 bits (969),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWMLG+I+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  531  PRCMYTAQLVGTVVAGVVNLAVAWWMLGNIDNICDVEALHPDSPWTCPKYRVTFDASVIW  590

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWL   GAVLPVPVW+LS+ FPEKKWI L+N+PVISYGFAGM
Sbjct  591  GLIGPARLFGRHGLYRNLVWLGGAGAVLPVPVWLLSRAFPEKKWIALVNVPVISYGFAGM  650

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  651  PPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  710

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  711  HELKWWGTEVDHCPLASCPTAPGIAVKGCPVF  742



>ref|XP_008780991.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=735

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G++NLAV WWML SI+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  524  PRCMYTAQLVGTVVAGIMNLAVAWWMLESIDNICDFEALHPDSPWTCPKYRVTFDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG GGLYRNLVWLFLIGA LPVPVWVLSK+FPEK+WIPLINIPVISYGFAGM
Sbjct  584  GLIGPSRLFGHGGLYRNLVWLFLIGAFLPVPVWVLSKIFPEKEWIPLINIPVISYGFAGM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRK WWQKYNYVLSAALDAGTAFM VLLFF LQNE+
Sbjct  644  PPATPTNIASWLITGTIFNYFVFRYRKRWWQKYNYVLSAALDAGTAFMGVLLFFVLQNEN  703

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + L WWG++LDHCPLASCPT PGI V+GCPVF
Sbjct  704  RNLSWWGTDLDHCPLASCPTEPGISVKGCPVF  735



>ref|XP_009404107.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQL GT+V+GV+NL+V WWML +IENICD D+L P+SPWTCPK+RVTFDASVIW
Sbjct  527  PRCMYTAQLAGTVVAGVLNLSVAWWMLENIENICDVDSLHPDSPWTCPKYRVTFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLI P RLFG GGLYRNLVWLFL+GAVLPVPVWVLSK+FPEKKWI LIN+PVI+YGFAGM
Sbjct  587  GLIAPGRLFGHGGLYRNLVWLFLVGAVLPVPVWVLSKVFPEKKWISLINVPVITYGFAGM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+YRK WWQ+YNYVLSAALDAGTAFM VLLFFALQN+H
Sbjct  647  PPATPTNIASWLITGTIFNYFVFRYRKVWWQRYNYVLSAALDAGTAFMGVLLFFALQNQH  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWGSELDHCPLASCPTAPGI V+GCPVF
Sbjct  707  HNLHWWGSELDHCPLASCPTAPGISVKGCPVF  738



>ref|XP_007154044.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
 gb|ESW26038.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
Length=741

 Score =   377 bits (967),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D L  +SPWTCPK+RVTFDASVIW
Sbjct  529  PRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKLHHDSPWTCPKYRVTFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+WVLSK++PEKKWIPLINIPVISYGFAGM
Sbjct  589  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWVLSKIYPEKKWIPLINIPVISYGFAGM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP NI SW++TG+IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  649  PPATPANIASWLLTGMIFNYFVFRYNKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              LKWWGSE+DHCPLA+CPTAPGI V+GCPVF
Sbjct  709  HNLKWWGSEMDHCPLATCPTAPGIEVDGCPVF  740



>gb|KFK26550.1| hypothetical protein AALP_AA8G263100 [Arabis alpina]
Length=734

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G VNL V WWML SI++ICD + + PNSPWTCPK+RVTFDASVIW
Sbjct  523  PRCMYTAQLVGTVVAGAVNLGVAWWMLESIQDICDIEGVHPNSPWTCPKYRVTFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  583  GLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  643  PPATPTNIASWLVTGTIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  702

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  703  HDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  734



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   377 bits (967),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQL+GT+V+GVVNLAV WWML +I+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  536  PRCMYTAQLIGTVVAGVVNLAVAWWMLDNIDNICDVEALHPDSPWTCPKYRVTFDASVIW  595

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL+GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  596  GLIGPGRLFGRHGLYRNLVWLFLVGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  655

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI +W+VTG IFN+FVF+YRK WWQKYNYVLSAALDAGTAFM VL+FFALQN H
Sbjct  656  PPATPTNIATWLVTGTIFNFFVFRYRKAWWQKYNYVLSAALDAGTAFMGVLIFFALQNAH  715

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI V+GCPVF
Sbjct  716  HDLKWWGTEVDHCPLASCPTAPGIAVKGCPVF  747



>ref|XP_004295330.1| PREDICTED: oligopeptide transporter 3 [Fragaria vesca subsp. 
vesca]
Length=736

 Score =   375 bits (964),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSG+VNLAV WWML  I+NICDTD L P+SPWTCPK+RVTFDASVIW
Sbjct  525  PRCMYTAQLVGTLVSGIVNLAVAWWMLEGIQNICDTDVLPPDSPWTCPKYRVTFDASVIW  584

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFL+GA+LPVP++VLSK+FP+KKWIPLIN+PVI YGFAGM
Sbjct  585  GLIGPRRLFGPGGLYRNLVWLFLVGALLPVPIYVLSKIFPDKKWIPLINMPVILYGFAGM  644

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYF+F+Y K WWQKYNYVLSAALDAGTAFM VL+FFALQN +
Sbjct  645  PPATPTNIASWLITGAIFNYFLFRYHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNNN  704

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGSELDHCPLASCPTAPGI V+GCPVF
Sbjct  705  ILVHWWGSELDHCPLASCPTAPGITVKGCPVF  736



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G +NLAV WWML SIENICD DAL   SPWTCPK+RVTFDASVIW
Sbjct  534  PRCMYTAQLVGTLVAGTINLAVAWWMLDSIENICDDDALHAESPWTCPKYRVTFDASVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVP+W LSK FPEKKWI LINIPVISYGFAGM
Sbjct  594  GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPIWALSKAFPEKKWIKLINIPVISYGFAGM  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  654  PPATPTNIASWLMTGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  713

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L+WWGS+ DHCPLA CPTAPGI V+GCPVF
Sbjct  714  HNLRWWGSQPDHCPLAKCPTAPGIAVKGCPVF  745



>ref|XP_008345787.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=753

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLVSGVVNLAV WWML SI+NICD ++ +PNSPWTCPK+RVTFDASVIW
Sbjct  542  PRCMYTAQLVGTLVSGVVNLAVAWWMLESIDNICDVESQNPNSPWTCPKYRVTFDASVIW  601

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFL+G  LPVP+WV+SK+FP+KKWIPLIN+PVI YGFAGM
Sbjct  602  GLIGPRRLFGPGGLYRNLVWLFLVGVFLPVPIWVMSKIFPDKKWIPLINMPVILYGFAGM  661

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  662  PPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPK  721

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+ LDHCPLA+CP APGI V+GCPVF
Sbjct  722  HELKWWGTTLDHCPLATCPIAPGIHVDGCPVF  753



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   374 bits (961),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP+KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPKKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_010449801.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=737

 Score =   374 bits (961),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKVFPNKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_010440168.1| PREDICTED: oligopeptide transporter 3-like [Camelina sativa]
Length=737

 Score =   374 bits (960),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKVFPNKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 ref|XP_004162504.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   374 bits (961),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G +NLAV WWML SIENICD DAL   SPWTCPK+RVTFDASVIW
Sbjct  534  PRCMYTAQLVGTLVAGTINLAVAWWMLDSIENICDDDALHAESPWTCPKYRVTFDASVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNLVWLFLIGAVLPVP+W LSK FPEKKWI LINIPVISYGFAGM
Sbjct  594  GLIGPRRLFGPGGLYRNLVWLFLIGAVLPVPIWALSKAFPEKKWIALINIPVISYGFAGM  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG +FNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  654  PPATPTNIASWLMTGTVFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  713

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L+WWGS+ DHCPLA CPTAPGI V+GCPVF
Sbjct  714  HNLRWWGSQPDHCPLAKCPTAPGISVKGCPVF  745



>ref|XP_006856263.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
 gb|ERN17730.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
Length=738

 Score =   374 bits (960),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQL GTL++G VNLA+ WWMLGSI+++CD ++L PNSPWTCPK+RVTFD+SVIW
Sbjct  527  PRCMYTAQLAGTLIAGTVNLAIAWWMLGSIKDLCDVESLHPNSPWTCPKYRVTFDSSVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFL+GA+LP+PVWVLSK+FP KKWIPLINIPVISYGFAGM
Sbjct  587  GLIGPRRLFGPGGMYRNLVWLFLVGALLPIPVWVLSKIFPNKKWIPLINIPVISYGFAGM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG+IFNYFVF+Y KGWWQKYNYVLSAALDAGTAFM VLL+FAL  E+
Sbjct  647  PPATPTNIASWLVTGMIFNYFVFRYNKGWWQKYNYVLSAALDAGTAFMGVLLYFALGMEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + L WWG++LDHCPLASCPT PG+ V GCPVF
Sbjct  707  RNLNWWGTQLDHCPLASCPTEPGVSVAGCPVF  738



>sp|O23482.3|OPT3_ARATH RecName: Full=Oligopeptide transporter 3; Short=AtOPT3 [Arabidopsis 
thaliana]
 gb|AAN72034.1| isp4 like protein [Arabidopsis thaliana]
Length=737

 Score =   374 bits (960),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWML +IENICDTDAL  +SPWTCPK+RVTFDASVIW
Sbjct  519  PRCMYTAQLVGTIVAGVVNLAVAWWMLENIENICDTDALPSDSPWTCPKYRVTFDASVIW  578

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLF  GGLYRNLVWLFLIGAVLPVP+W+LSKM+P+KKWIPLINIPVISYGFAGM
Sbjct  579  GLIGPSRLFAHGGLYRNLVWLFLIGAVLPVPIWLLSKMYPKKKWIPLINIPVISYGFAGM  638

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFN+FV +YRK WWQKYNYVLSAALDAGTAFM VLLF ALQN+H
Sbjct  639  PPATPTNIASWLITGTIFNFFVLRYRKEWWQKYNYVLSAALDAGTAFMGVLLFLALQNQH  698

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG+E+DHCPLASCPT PGIVV+GCPVF
Sbjct  699  IGVHWWGTEVDHCPLASCPTEPGIVVKGCPVF  730



>gb|AAK96781.1| Unknown protein [Arabidopsis thaliana]
Length=737

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>gb|ADW09325.1| oligopeptide transporter 3 [Noccaea caerulescens]
Length=736

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD + + PNSPWTCPK+RVTFDASVIW
Sbjct  525  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGVHPNSPWTCPKYRVTFDASVIW  584

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP KKWIPLINIPVISYGFAGM
Sbjct  585  GLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPNKKWIPLINIPVISYGFAGM  644

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  645  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  704

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLA+CPTAPGI V+GCPVF
Sbjct  705  HDLKWWGTEVDHCPLATCPTAPGIRVKGCPVF  736



>ref|XP_002868139.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44398.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   374 bits (959),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_009124517.1| PREDICTED: oligopeptide transporter 3 [Brassica rapa]
 emb|CDY22769.1| BnaA08g05990D [Brassica napus]
Length=735

 Score =   374 bits (959),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  524  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGFAGM
Sbjct  584  GLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGFAGM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  644  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  703

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  704  HDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  735



>emb|CDY42539.1| BnaC08g10640D [Brassica napus]
Length=735

 Score =   373 bits (958),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  524  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGFAGM
Sbjct  584  GLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGFAGM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  644  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  703

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  704  HDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  735



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   372 bits (955),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNL+V WWML SI++IC  D    +SPWTCPK+RVTFDASVIW
Sbjct  530  PRCMYTAQLVGTLVAGVVNLSVAWWMLDSIKDICMDDKAHHDSPWTCPKYRVTFDASVIW  589

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFL+GAVLPVPVWV SK++P KKWIPLINIPVISYGFAGM
Sbjct  590  GLIGPKRLFGPGGLYRNLVWLFLVGAVLPVPVWVFSKIYPNKKWIPLINIPVISYGFAGM  649

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF++ K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  650  PPATPTNIASWLLTGMIFNYFVFRFHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  709

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              LKWWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  710  HTLKWWGTELDHCPLATCPTAPGIVVDGCPVF  741



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+GVVNLAV WWML SI++IC  D    +SPWTCPK+RVTFDASVIW
Sbjct  528  PRCMYTAQLVGTLVAGVVNLAVAWWMLDSIKDICMDDKAHHDSPWTCPKYRVTFDASVIW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFL+GAVLPVPVWV SK++P+KKWI LINIPVISYGFAGM
Sbjct  588  GLIGPKRLFGPGGLYRNLVWLFLVGAVLPVPVWVFSKIYPDKKWIALINIPVISYGFAGM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG+IFNYFVF++ K WWQKYNYVLSAALDAGTAFM VL+FFALQN  
Sbjct  648  PPATPTNIASWLLTGMIFNYFVFRFHKRWWQKYNYVLSAALDAGTAFMGVLIFFALQNAG  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              LKWWG+ELDHCPLA+CPTAPGIVV+GCPVF
Sbjct  708  HSLKWWGTELDHCPLATCPTAPGIVVDGCPVF  739



>ref|XP_006414361.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
 gb|ESQ55814.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
Length=736

 Score =   371 bits (953),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+ VVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  525  PRCMYTAQLVGTVVASVVNLGVAWWMLESIQDICDIEGEHPNSPWTCPKYRVTFDASVIW  584

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAVLPVPVW +SK+FP KKWIPLINIPVISYGFAGM
Sbjct  585  GLIGPRRLFGPGGMYRNLVWLFLIGAVLPVPVWAMSKIFPNKKWIPLINIPVISYGFAGM  644

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  645  PPATPTNIASWLVTGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  704

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLA+CPTAPGI  +GCPVF
Sbjct  705  HDLKWWGTEVDHCPLATCPTAPGIRAKGCPVF  736



>emb|CAD91127.1| glutathione transporter GT1 [Brassica juncea]
Length=661

 Score =   369 bits (947),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  450  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  509

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFG GG+YRNLVWLFLIGAVLPVPVW +SK+FP+KKWIPLINIPVISYGFAGM
Sbjct  510  GLIGPKRLFGAGGMYRNLVWLFLIGAVLPVPVWAMSKIFPDKKWIPLINIPVISYGFAGM  569

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYN VLSAALDAGTAFM VLLFFALQN  
Sbjct  570  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNCVLSAALDAGTAFMGVLLFFALQNAG  629

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI+ +GCPVF
Sbjct  630  HDLKWWGTEVDHCPLASCPTAPGIIAKGCPVF  661



>ref|XP_009374859.1| PREDICTED: oligopeptide transporter 3-like [Pyrus x bretschneideri]
Length=753

 Score =   371 bits (953),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTLV+G+VNLAV WWML +IENICD ++ +PNSPWTCPK+RVTFDASVIW
Sbjct  542  PRCMYTAQLVGTLVAGIVNLAVAWWMLENIENICDVESHNPNSPWTCPKYRVTFDASVIW  601

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGP GLYRNLVWLFL+GA+LP P+  +SK+FP+KKWIPLIN+PVI+YGFAGM
Sbjct  602  GLIGPRRLFGPRGLYRNLVWLFLVGALLPFPICAMSKIFPDKKWIPLINMPVITYGFAGM  661

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  662  PPATPTNIASWLITGGIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPK  721

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+ELDHCPLA+CP APGI VEGCPVF
Sbjct  722  HELKWWGTELDHCPLATCPIAPGIHVEGCPVF  753



>ref|NP_567493.5| oligopeptide transporter [Arabidopsis thaliana]
 gb|AEE83738.1| oligopeptide transporter [Arabidopsis thaliana]
Length=737

 Score =   370 bits (949),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGDHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLV LFLIGAVLPVPVW LSK+FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVGLFLIGAVLPVPVWALSKIFPNKKWIPLINIPVISYGFAGM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  646  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  706  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  737



>ref|XP_010039444.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039445.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW45991.1| hypothetical protein EUGRSUZ_L00159 [Eucalyptus grandis]
Length=765

 Score =   370 bits (949),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR M+  QLV +LVSG+VNLAV WWM+GSIENICD +AL P+SPWTCPKF VTFD SVIW
Sbjct  553  PRCMFTVQLVASLVSGIVNLAVAWWMMGSIENICDVEALHPDSPWTCPKFAVTFDNSVIW  612

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLF P GLYRNL+WLFL+GA+LP+P+W LSKMFPEKKWI LINIPV+S+GFAG+
Sbjct  613  GLIGPRRLFVPDGLYRNLIWLFLVGALLPLPIWALSKMFPEKKWIRLINIPVLSFGFAGV  672

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+PTNI SW++TG+ FNYF+F+YRK WWQKYNYVLSAALDAGTAFM V LFFALQN++
Sbjct  673  PPASPTNIASWLITGMFFNYFMFRYRKRWWQKYNYVLSAALDAGTAFMGVFLFFALQNQN  732

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+E+DHCPLA+CPT PG+VV+GCPVFK
Sbjct  733  KSLKWWGTEIDHCPLATCPTEPGVVVQGCPVFK  765



>ref|XP_010039447.1| PREDICTED: oligopeptide transporter 3-like isoform X2 [Eucalyptus 
grandis]
Length=704

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR M+  QLV +LVSG+VNLAV WWM+GSIENICD +AL P+SPWTCPKF VTFD SVIW
Sbjct  492  PRCMFTVQLVASLVSGIVNLAVAWWMMGSIENICDVEALHPDSPWTCPKFAVTFDNSVIW  551

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLF P GLYRNL+WLFL+GA+LP+P+W LSKMFPEKKWI LINIPV+S+GFAG+
Sbjct  552  GLIGPRRLFVPDGLYRNLIWLFLVGALLPLPIWALSKMFPEKKWIRLINIPVLSFGFAGV  611

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+PTNI SW++TG+ FNYF+F+YRK WWQKYNYVLSAALDAGTAFM V LFFALQN++
Sbjct  612  PPASPTNIASWLITGMFFNYFMFRYRKRWWQKYNYVLSAALDAGTAFMGVFLFFALQNQN  671

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+E+DHCPLA+CPT PG+VV+GCPVFK
Sbjct  672  KSLKWWGTEIDHCPLATCPTEPGVVVQGCPVFK  704



>ref|XP_008349335.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=756

 Score =   367 bits (941),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY  QLVGTLV+G+VNLAV WWML +IENICD ++ +PNSPWTCPK+RVTFDASVIW
Sbjct  545  PRCMYTXQLVGTLVAGIVNLAVAWWMLENIENICDVESRNPNSPWTCPKYRVTFDASVIW  604

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGGLYRNL+WLFL+GA+LP P+  +SK+FP+KKWIPLIN+PVI+YGFAGM
Sbjct  605  GLIGPRRLFGPGGLYRNLMWLFLVGALLPFPICSMSKIFPDKKWIPLINMPVITYGFAGM  664

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG IFNY VFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  665  PPATPTNIASWLITGGIFNYXVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNPK  724

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ELKWWG+ELDHCPLA+CP APGI VEGCPVF
Sbjct  725  HELKWWGTELDHCPLATCPIAPGIHVEGCPVF  756



>ref|XP_010542186.1| PREDICTED: oligopeptide transporter 3 [Tarenaya hassleriana]
Length=727

 Score =   356 bits (914),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 188/212 (89%), Gaps = 5/212 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGTL++GVVNL V WWML SI++ICD +   P+SPWTCPK+RVTFDASVIW
Sbjct  521  PRCMYTAQLVGTLLAGVVNLGVAWWMLESIQDICDIEGEHPDSPWTCPKYRVTFDASVIW  580

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGG+YRNLVWLFLIGAVLPVPVWVLSK+FP++KW     +PV+ +G +GM
Sbjct  581  GLIGPKRLFGPGGMYRNLVWLFLIGAVLPVPVWVLSKIFPDQKW-----MPVVHFGISGM  635

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG+IFNYFVFKY K WWQKYNYVLSAALDAGTAFM VLLFFALQNE 
Sbjct  636  PPATPTNIASWLVTGMIFNYFVFKYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNEG  695

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              LKWWG+++DHCPLASCPTAPGI V+GCPVF
Sbjct  696  HNLKWWGTQVDHCPLASCPTAPGIKVKGCPVF  727



>ref|XP_010039443.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
Length=697

 Score =   354 bits (908),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR M+ AQLV +LVSG VNLAV WWM+GSIENICD + L  +SPWTCPKF+V FD SVIW
Sbjct  486  PRCMFTAQLVASLVSGTVNLAVAWWMIGSIENICDVEGLHRDSPWTCPKFKVAFDYSVIW  545

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLF P GLYRNLVWLFL+GA+LP+P+WVLSK+FPEKKWI  INIP++S+GFAG+
Sbjct  546  GLIGPRRLFIPDGLYRNLVWLFLVGALLPLPIWVLSKIFPEKKWIRHINIPLLSFGFAGI  605

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+PTNI SWI+TG+ FNYF+ +YRK WWQKYNYVLSAALDAGTAFM V L+FALQN+ 
Sbjct  606  PPASPTNIASWIITGMFFNYFMLRYRKRWWQKYNYVLSAALDAGTAFMGVFLYFALQNQK  665

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+++DHCPLA+CPT PG+VV+GCPVF
Sbjct  666  TDLKWWGTQIDHCPLATCPTEPGVVVKGCPVF  697



>gb|KCW45990.1| hypothetical protein EUGRSUZ_L00158 [Eucalyptus grandis]
Length=745

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR M+ AQLV +LVSG VNLAV WWM+GSIENICD + L  +SPWTCPKF+V FD SVIW
Sbjct  534  PRCMFTAQLVASLVSGTVNLAVAWWMIGSIENICDVEGLHRDSPWTCPKFKVAFDYSVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLF P GLYRNLVWLFL+GA+LP+P+WVLSK+FPEKKWI  INIP++S+GFAG+
Sbjct  594  GLIGPRRLFIPDGLYRNLVWLFLVGALLPLPIWVLSKIFPEKKWIRHINIPLLSFGFAGI  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+PTNI SWI+TG+ FNYF+ +YRK WWQKYNYVLSAALDAGTAFM V L+FALQN+ 
Sbjct  654  PPASPTNIASWIITGMFFNYFMLRYRKRWWQKYNYVLSAALDAGTAFMGVFLYFALQNQK  713

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+++DHCPLA+CPT PG+VV+GCPVF
Sbjct  714  TDLKWWGTQIDHCPLATCPTEPGVVVKGCPVF  745



>ref|XP_010436532.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=726

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 180/212 (85%), Gaps = 11/212 (5%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNL V WWML SI++ICD +   PNSPWTCPK+RVTFDASVIW
Sbjct  526  PRCMYTAQLVGTVVAGVVNLGVAWWMLESIQDICDIEGTHPNSPWTCPKYRVTFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGPGG+YRNLVWLFLIGAV           FP KKWIPLINIPVISYGFAGM
Sbjct  586  GLIGPRRLFGPGGMYRNLVWLFLIGAV-----------FPNKKWIPLINIPVISYGFAGM  634

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW+VTG IFNYFVF Y K WWQKYNYVLSAALDAGTAFM VLLFFALQN  
Sbjct  635  PPATPTNIASWLVTGTIFNYFVFNYHKRWWQKYNYVLSAALDAGTAFMGVLLFFALQNAG  694

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             +LKWWG+E+DHCPLASCPTAPGI  +GCPVF
Sbjct  695  HDLKWWGTEVDHCPLASCPTAPGIKAKGCPVF  726



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   346 bits (887),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G+VNLAV WWML +IENICDTD L  +SPWTCPK+RVTFDASVIW
Sbjct  518  PRCMYTAQLVGTIVAGIVNLAVAWWMLENIENICDTDVLPSDSPWTCPKYRVTFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLF  GGLYRNLVWLFLIGAVLPVP+W+LSKM+P+KKWIPLINIPVISYGFAGM
Sbjct  578  GLIGPSRLFAHGGLYRNLVWLFLIGAVLPVPIWLLSKMYPKKKWIPLINIPVISYGFAGM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATPTNI SW++TG +FN+FVF++RK WW+KYNYVLSAALDAGTAFM VLLF ALQN+ 
Sbjct  638  PPATPTNIASWLITGTVFNFFVFRFRKEWWRKYNYVLSAALDAGTAFMGVLLFLALQNQD  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             ++ WWG+E+DHCPLASCPT PGI V+GCPVF
Sbjct  698  IDVHWWGTEVDHCPLASCPTEPGIAVKGCPVF  729



>gb|AAO72613.1| Isp-4-like protein [Oryza sativa Japonica Group]
Length=446

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+GVVNLAV WWMLGSI+NICD +AL P+SPWTCPK+RVTFDASVIW
Sbjct  272  PRCMYTAQLVGTVVAGVVNLAVAWWMLGSIDNICDVEALHPDSPWTCPKYRVTFDASVIW  331

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP RLFG  GLYRNLVWLFL GAVLPVPVW+LS+ FPEKKWI LIN+PVISYGFAGM
Sbjct  332  GLIGPARLFGRHGLYRNLVWLFLAGAVLPVPVWLLSRAFPEKKWIALINVPVISYGFAGM  391

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFA  224
            PPATPTNI SW+VTG IFNYFVFKYRKGWWQKYNYVLSAALDAGTAFM VL+FFA
Sbjct  392  PPATPTNIASWLVTGTIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMGVLIFFA  446



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   321 bits (822),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 174/212 (82%), Gaps = 16/212 (8%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR MY AQLVGT+V+G VNLAV WWML SI++ICD + L P+SPWTCPK+RVTFDASVIW
Sbjct  529  PRCMYTAQLVGTIVAGTVNLAVAWWMLESIDDICDVEGLHPDSPWTCPKYRVTFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVP+W+LSKM          N+   S+  +  
Sbjct  589  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPIWLLSKM----------NVSRNSHQHSEF  638

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
                  NI SW++TG IFNYFVF+Y K WWQKYNYVLSAALDAGTAFMAVLLFFALQNE+
Sbjct  639  ------NIASWLITGTIFNYFVFRYHKRWWQKYNYVLSAALDAGTAFMAVLLFFALQNEN  692

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K LKWWG+ LDHCPLA+CPTAPGI V+GCPVF
Sbjct  693  KNLKWWGTSLDHCPLATCPTAPGIKVDGCPVF  724



>emb|CDP04527.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   320 bits (819),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 173/213 (81%), Gaps = 12/213 (6%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+  QLVG+LV+ + NL + WWML SI NICD +AL P+SPWTCPKFRV FD +V+W
Sbjct  478  PRSMFTVQLVGSLVASLANLGMGWWMLESIPNICDVEALHPDSPWTCPKFRVMFDTTVVW  537

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGP GLYRN++WLF +GA+LP+PVW+LS+ FP+KKWI LINIP+I+ GF G+
Sbjct  538  GLIGPERLFGPHGLYRNMIWLFPLGALLPIPVWILSRKFPDKKWISLINIPLITCGFTGI  597

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA PTNI SWI            YRKGWWQKYNYVLS+ALDAGTAFM VLLFFALQN  
Sbjct  598  PPAAPTNIASWI------------YRKGWWQKYNYVLSSALDAGTAFMGVLLFFALQNSG  645

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+E DHCPLASCPTAPGI V GCPV K
Sbjct  646  KNLKWWGTEPDHCPLASCPTAPGITVAGCPVVK  678



>gb|KDP35952.1| hypothetical protein JCGZ_09924 [Jatropha curcas]
Length=254

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDASVIW
Sbjct  43   PRSMFLVQFIGTILAGTINLAVAWWLLNSIHNICQDDLLPPNSPWTCPGDRVFFDASVIW  102

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ + W FL GAV P  VWVL K FP++ WIPLIN+PV+      M
Sbjct  103  GLVGPKRIFGSLGNYQAMNWFFLGGAVGPFIVWVLHKSFPKQSWIPLINLPVLLGSTGNM  162

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E+
Sbjct  163  PPATAVNYNSWIIVGTIFNFFVFRYRKHWWQRYNYILSAALDAGVAFMAVLLYFSVGMEN  222

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + L WWG+E +HC LA+CPTA GIVV+GCPV
Sbjct  223  RSLNWWGTEGEHCDLATCPTAKGIVVDGCPV  253



>ref|XP_010919977.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=356

 Score =   284 bits (727),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+LGSI+NICD   LSPNSPWTCP  RV FDASVIW
Sbjct  145  PRSMFIVQFIGTIIAGTINLGVAWWLLGSIKNICDDQLLSPNSPWTCPSDRVFFDASVIW  204

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W FL GA+ P+ VW   K FP + WIPLIN+PV+    A M
Sbjct  205  GLVGPRRIFGPLGNYGALNWFFLGGALGPIIVWTFHKFFPAQTWIPLINLPVLLGATASM  264

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWIV G +FN+FV++YRK WW++YNY+LSAALDAG AFM V L+F L  E+
Sbjct  265  PPATAVNYNSWIVVGTVFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVFLYFTLNLEN  324

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HC LA+CPTA G+ V+GCPVF
Sbjct  325  VTLDWWGTAGEHCELATCPTAKGVQVDGCPVF  356



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 167/212 (79%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G +NL V WW+L SIENIC  D L PNSPWTCP  RV FDASVIW
Sbjct  527  PRSMFIVQLIGTIIAGTINLGVAWWLLDSIENICQDDLLPPNSPWTCPGDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL GA+ PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  587  GLVGPKRIFGTLGNYGALNWFFLGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATAMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFM VL++F+L  E+
Sbjct  647  PPATALNYNAWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMGVLIYFSLTMEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            ++L WWG++ +HCPLA+CPTA G+VVEGCP +
Sbjct  707  RDLNWWGTDGEHCPLATCPTAKGVVVEGCPAY  738



>gb|ABK94821.1| unknown [Populus trichocarpa]
Length=436

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 165/212 (78%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDASVIW
Sbjct  222  PRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDASVIW  281

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  282  GLVGPKRIFGTLGNYQAMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGATAMM  341

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++  E 
Sbjct  342  PPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIED  401

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + L WWG+  +HC LA+CPTA GI+V+GCP F
Sbjct  402  RTLNWWGTNGEHCELATCPTAKGIMVDGCPDF  433



>gb|KJB58811.1| hypothetical protein B456_009G227200 [Gossypium raimondii]
Length=741

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 161/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GT+++G VNLAV WW+L ++ENIC    L PNSPWTCP  RV FDASVIW
Sbjct  530  PRSMFVVQSIGTVIAGTVNLAVAWWLLTTVENICQDHLLPPNSPWTCPGDRVFFDASVIW  589

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  L W FL GAV PV VW+  K FP +KWIPLIN+PV+    A M
Sbjct  590  GLVGPKRIFGPLGNYSALNWFFLGGAVGPVVVWLFHKAFPNQKWIPLINLPVLLGATAAM  649

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   W++ G IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L    
Sbjct  650  PPATSLNFNCWLIIGFIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMHG  709

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGS+ +HC LASCPTA GIVV+GCPVF
Sbjct  710  ISISWWGSDGEHCDLASCPTAKGIVVDGCPVF  741



>ref|XP_009398499.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 163/212 (77%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+++G +NL V WW+LGSIENIC    L PNSPWTCP  RV FDASVIW
Sbjct  527  PKSMFLVQFIGTIIAGTINLGVAWWLLGSIENICHPGLLPPNSPWTCPSDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y +L W FL+GA+ P+ VW+  K FP + WIPLIN+PV+      M
Sbjct  587  GLVGPRRIFGPKGNYGSLNWFFLVGALGPIIVWLFHKAFPRQSWIPLINLPVLLGATGMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI  G  FN+FVF+YRK WW++YNY+LSAALDAG AFM VLL+FAL  E+
Sbjct  647  PPATPLNFSAWIAVGTAFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFALSMEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG+E +HCPLASCPTA G+ V+GCP F
Sbjct  707  KSITWWGAEGEHCPLASCPTAKGVQVDGCPQF  738



>gb|KDO67987.1| hypothetical protein CISIN_1g020208mg [Citrus sinensis]
Length=329

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIW
Sbjct  118  PRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIW  177

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  178  GLVGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATGMM  237

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E 
Sbjct  238  PPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMED  297

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  298  KGLSWWGTEGEHCDLATCPTAKGILVDGCPV  328



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =   290 bits (741),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L PNSPWTCP  RV FDASVIW
Sbjct  527  PRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPNSPWTCPGDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VW+L KMFP + WIPLIN+PV+      M
Sbjct  587  GLVGPKRIFGTLGNYSSMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGATGAM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  647  PPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG+  +HC LA+CPTA GI V+GCP 
Sbjct  707  KGVTWWGTNGEHCKLATCPTAKGIAVDGCPT  737



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   289 bits (739),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L P+SPWTCP  RV FDASVIW
Sbjct  527  PRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GAV PV VW+L K+FP K WIPLIN+PV+      M
Sbjct  587  GLVGPKRIFGSLGNYSSMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGATGAM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  647  PPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K L WWG+  +HC LA+CPTA GI V+GCP
Sbjct  707  KGLTWWGTNGEHCELATCPTAKGIAVDGCP  736



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L P+SPWTCP  RV FDASVIW
Sbjct  526  PRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GAV PV VW+L K+FP K WIPLIN+PV+      M
Sbjct  586  GLVGPKRIFGSLGNYSSMNWFFLGGAVGPVIVWLLHKVFPTKSWIPLINLPVLLGATGAM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  646  PPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMEN  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K L WWG+  +HC LA+CPTA GI V+GCP
Sbjct  706  KGLTWWGTNGEHCELATCPTAKGIAVDGCP  735



>emb|CDO97359.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+V+G +N++V WW+L SI+NIC  D L  +SPWTCP  RV FDASVIW
Sbjct  165  PRSMFLVQFIGTIVAGTINVSVAWWLLHSIKNICQDDLLPQDSPWTCPGDRVFFDASVIW  224

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ P+ VW+  K FP++ WIPLIN+PV+      M
Sbjct  225  GLVGPKRIFGTLGNYTEMNWFFLGGALGPIIVWLFHKAFPKQSWIPLINLPVLLGATGAM  284

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F +  E+
Sbjct  285  PPATPLNYNAWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFTVGMEN  344

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            +E+ WWG++ + C LA+CPTA GI V+GCPV
Sbjct  345  REVTWWGTKGEQCDLATCPTAKGITVDGCPV  375



>gb|KJB32168.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=528

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIW
Sbjct  317  PRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIW  376

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  377  GLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMM  436

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E+
Sbjct  437  PPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMEN  496

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  497  RSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  527



>gb|KEH36459.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=552

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L S+ENIC  D L   SPWTCP  RV FDASVIW
Sbjct  341  PRSMFLVQFIGTMLAGTINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDASVIW  400

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W F+ GA+ P+ VW+L K FP + WI LIN+PV+    A M
Sbjct  401  GLVGPKRIFGSKGNYSAMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGATAMM  460

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI  G IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L  E+
Sbjct  461  PPATPLNYNSWIFVGTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLSLEN  520

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HCPLASCPTA GI V+GCPV
Sbjct  521  RSISWWGTEGEHCPLASCPTAKGIAVDGCPV  551



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT++SG +N++V WW+L SIENIC  D L P+SPWTCP  RV FDASVIW
Sbjct  524  PRSMFLVQFLGTIISGTINISVAWWLLNSIENICQDDLLPPDSPWTCPGDRVFFDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VW+L KMFP + WIPLIN+PV+      M
Sbjct  584  GLVGPKRIFGTLGNYSSMNWFFLGGAIGPVIVWLLHKMFPTQSWIPLINLPVLLGATGAM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  644  PPATPLNYNAWVIVGTIFNFFIFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGMEN  703

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K + WWG+  +HC LA+CPTA GI V+GCP
Sbjct  704  KGVTWWGTNGEHCKLATCPTAKGIAVDGCP  733



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   288 bits (736),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM++ Q +GT+V+G VN+ V WW+L SIENIC    L PNSPWTCP  RV FDASVIW
Sbjct  523  PISMFIVQCIGTIVAGTVNIGVAWWLLSSIENICQDQLLPPNSPWTCPGDRVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ L W FLIGA+ P+ VW+L K FP +KWI LIN+PV+    A M
Sbjct  583  GLVGPKRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WIV G IFNYFVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  643  PPATTVNFNCWIVVGTIFNYFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNE  702

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG+  +HC LA+CPTA GIVV+GCPV+
Sbjct  703  KSISWWGTNGEHCDLATCPTAKGIVVDGCPVY  734



>ref|XP_007018304.1| Oligopeptide transporter 2 [Theobroma cacao]
 gb|EOY15529.1| Oligopeptide transporter 2 [Theobroma cacao]
Length=738

 Score =   288 bits (736),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 162/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GT+++G +NLAV WW+L ++ENIC    L PNSPWTCP  RV +DASVIW
Sbjct  527  PRSMFVVQAMGTIIAGTINLAVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  L W FL GA+ PV VW+  K FP +KWI LIN+PV+    A M
Sbjct  587  GLVGPKRIFGPLGNYAALNWFFLGGALGPVVVWLFHKAFPNQKWISLINLPVLLGATAAM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L  + 
Sbjct  647  PPATSLNFNCWIIVGVIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMQG  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG+E +HC LASCPTA GIVV+GCPV+
Sbjct  707  ISISWWGAEGEHCDLASCPTAKGIVVDGCPVY  738



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   287 bits (735),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 165/212 (78%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDASVIW
Sbjct  538  PRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDASVIW  597

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ + W FL GA+ PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  598  GLVGPKRIFGTLGNYQAMNWFFLGGALGPVIVWLLHKSFPKQSWIPLINLPVLLGATAMM  657

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++  E 
Sbjct  658  PPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIED  717

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + L WWG+  +HC LA+CPTA GI+V+GCP F
Sbjct  718  RTLNWWGTNGEHCELATCPTAKGIMVDGCPDF  749



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SI NIC  D L PNSPWTCP  RV FDASVIW
Sbjct  543  PRSMFLVQFIGTMLAGTINLAVAWWLLNSITNICQDDLLPPNSPWTCPGDRVFFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ + W FL GAV P+ VW+L K FP K WIPLIN+PV+      M
Sbjct  603  GLVGPRRIFGSLGNYQAMNWFFLGGAVGPIIVWLLHKSFPRKSWIPLINLPVLLGSTGMM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  663  PPATAVNYNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSLGIEN  722

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            + L WWG++ +HC LASCPTA GI V GCP
Sbjct  723  RSLTWWGTDGEHCDLASCPTAKGIDVAGCP  752



>ref|XP_006472993.1| PREDICTED: oligopeptide transporter 2-like [Citrus sinensis]
Length=742

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  745  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  566
            R+M+V Q +GT+++G VNL V WW+L ++ENIC    L PNSPWTCP  RV +DASVIWG
Sbjct  532  RAMFVVQFIGTIIAGTVNLGVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWG  591

Query  565  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  386
            LIGPKR+FG  G+Y  L W FL+G + P  VW+L K FP+ KWI LIN+PV+    A MP
Sbjct  592  LIGPKRIFGRMGIYSALNWFFLLGTLGPFVVWLLQKAFPKHKWITLINLPVLLGATAQMP  651

Query  385  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  206
            PAT  N   WIV G IFNYF+FKYRKGWWQ+YNYV+SAALDAG AFM VLL+F L  E++
Sbjct  652  PATTVNFNCWIVVGTIFNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENR  711

Query  205  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             + WWGS  +HC LASCPT  G+VVEGCPV+
Sbjct  712  SINWWGSAGEHCDLASCPTTKGVVVEGCPVY  742



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  NSPWTCP  RV FDASVIW
Sbjct  538  PRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDDLLPVNSPWTCPGDRVFFDASVIW  597

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ + W FL GA+ PV +W+L K FP++ WIPLIN+PV+    A M
Sbjct  598  GLVGPKRIFGTLGNYQAMNWFFLGGALGPVIIWLLHKSFPKQSWIPLINLPVLLGATAMM  657

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+Y+K WWQ+YNYVLSAALDAG AFMAVLL+F++  E 
Sbjct  658  PPATPVNYNAWIIVGTIFNFFIFRYKKTWWQRYNYVLSAALDAGVAFMAVLLYFSVGIED  717

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + L WWG+  +HC LA+CPTA GI+V+GCPV
Sbjct  718  RSLNWWGTNGEHCELATCPTAKGIMVDGCPV  748



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 164/212 (77%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN+AV WW+L SI NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  533  PRSMFIVQFLGTIIAGTVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VW+  K FP++ WIPLIN+PV+      M
Sbjct  593  GLVGPKRIFGSLGNYSSMNWFFLGGALGPVLVWLFHKAFPKQSWIPLINLPVLLGATGIM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAV L+F+L  E+
Sbjct  653  PPATPLNYNAWIIIGTIFNFFVFRYRKSWWQRYNYILSAALDAGVAFMAVALYFSLGMEN  712

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            KE+ WWG+  +HC LA+CPTA GI V+GCPV+
Sbjct  713  KEIHWWGTSGEHCKLATCPTAKGIQVDGCPVY  744



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 166/211 (79%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  535  PRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIW  594

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G YR + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  595  GLVGPRRIFGTLGNYRQMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMM  654

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G+IFN+F+F+YRK WWQ+YNYVLSAALDAGTAFMAVLL+F++  E+
Sbjct  655  PPATPLNYNAWVLAGVIFNFFIFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVGMEN  714

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+  +HC LA+CPTA GI V+GCPV
Sbjct  715  RSITWWGTNGEHCELAACPTAKGIEVDGCPV  745



>gb|EYU18387.1| hypothetical protein MIMGU_mgv1a0036351mg, partial [Erythranthe 
guttata]
Length=569

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 161/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN+AV WW+L SI NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  358  PRSMFIVQFLGTIIAGTVNIAVAWWLLTSITNICQDDLLPPDSPWTCPGDRVFFDASVIW  417

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VW L K FP++ WIPLIN+PV+      M
Sbjct  418  GLVGPKRIFGSLGNYSSMNWFFLGGAIGPVLVWFLHKAFPKQSWIPLINLPVLLGATGAM  477

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAV L+F L  E 
Sbjct  478  PPATPLNYNAWIIIGTIFNFFVFRYRKIWWQRYNYILSAALDAGVAFMAVGLYFTLGMEE  537

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG+  +HC LA+CPTA GI V+GCP++
Sbjct  538  KGIDWWGTSGEHCKLATCPTAKGIRVDGCPIY  569



>ref|XP_006433764.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
 gb|ESR47004.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
Length=742

 Score =   286 bits (731),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  745  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  566
            R+M+V Q +GT+++G VNL V WW+L ++ENIC    L PNSPWTCP  RV +DASVIWG
Sbjct  532  RAMFVVQFIGTIIAGTVNLGVAWWLLTTVENICQDQLLPPNSPWTCPGDRVFYDASVIWG  591

Query  565  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  386
            LIGPKR+FG  G+Y  L W FL+G + P  VW+L K FP+ KWI LIN+PV+    A MP
Sbjct  592  LIGPKRIFGRMGIYSALNWFFLLGTLGPFVVWLLHKAFPKHKWITLINLPVLLGATAQMP  651

Query  385  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  206
            PAT  N   WIV G IFNYF+FKYRKGWWQ+YNYV+SAALDAG AFM VLL+F L  E++
Sbjct  652  PATTVNFNCWIVVGTIFNYFIFKYRKGWWQRYNYVVSAALDAGLAFMGVLLYFTLTMENR  711

Query  205  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             + WWGS  +HC LASCPT  G+VVEGCPV+
Sbjct  712  SIDWWGSAGEHCDLASCPTTKGVVVEGCPVY  742



>ref|XP_010030910.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56910.1| hypothetical protein EUGRSUZ_I02586 [Eucalyptus grandis]
Length=742

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VN+AV WW+L S+ NIC  D L  +SPWTCP  RV FDASVIW
Sbjct  531  PRSMFLVQLIGTILAGTVNIAVAWWLLNSVTNICQDDLLPLDSPWTCPSDRVFFDASVIW  590

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GP+R+FG  G YR + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+    A M
Sbjct  591  GLAGPRRIFGALGDYREINWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATAMM  650

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAALDAGTAFMAVLL+FA+  E+
Sbjct  651  PPATPLNYNAWVLVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFAVGMEN  710

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG+  +HC LA+CPTA GI V+GCP+
Sbjct  711  KSITWWGTNGEHCELAACPTAKGIEVDGCPI  741



>ref|XP_004485624.1| PREDICTED: oligopeptide transporter 4-like [Cicer arietinum]
Length=740

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 162/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SIENIC  D L P SPWTCP  RV FDASVIW
Sbjct  529  PRSMFLVQFIGTILAGTINIGVAWWLLNSIENICHDDLLPPGSPWTCPGDRVFFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ P+ VW+  + FP++ WIPLIN+PV+    A M
Sbjct  589  GLVGPKRIFGSKGNYSAMNWFFLGGAIGPIIVWLFHRAFPKQSWIPLINLPVLLGATAMM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L  E+
Sbjct  649  PPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLGLEN  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            + + WWG++ +HCPLASCPTA GIVV+GCP
Sbjct  709  RSISWWGNDGEHCPLASCPTAEGIVVDGCP  738



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   285 bits (730),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  745  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  566
            RSM+  Q +GT+V+ +VN+   WW+LGSIENICD   L PNSPWTCP  RV FDASVIWG
Sbjct  533  RSMFHVQFIGTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWG  592

Query  565  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  386
            LIGPKR+FG  G Y+ L W FL GA+ PV VW+ S+ FP  KWIPLIN+PVI    A MP
Sbjct  593  LIGPKRMFGSHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMP  652

Query  385  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  206
            PAT  N  SW + G+IFNYF+F+Y KGWWQ+YNYV SAA+DAG AFM VLL+  L  E++
Sbjct  653  PATSVNYISWSIVGIIFNYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENR  712

Query  205  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             L WWG+ +D+CPLA CPTA GIV+ GCPV+
Sbjct  713  SLSWWGNNVDNCPLADCPTAKGIVIAGCPVY  743



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   285 bits (728),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM++ Q +GTL++G VN+AV WW+L SIENIC    L PNSPWTCP  RV FDASVIW
Sbjct  531  PISMFIVQCIGTLIAGTVNMAVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFFDASVIW  590

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W F+ GA+ P+ VW+L K FP+ KWI LIN+PV+    A M
Sbjct  591  GLVGPKRIFGSLGNYAALNWFFIGGAIGPILVWLLQKTFPKHKWISLINLPVLLGSTAIM  650

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F L  E 
Sbjct  651  PPATAVNFNCWIIVGTIFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLTMED  710

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K L WWGS+ +HC LA+CPTA GIVV+GCPVF
Sbjct  711  KGLTWWGSDGEHCELANCPTAKGIVVDGCPVF  742



>ref|XP_010933427.1| PREDICTED: oligopeptide transporter 4-like [Elaeis guineensis]
Length=764

 Score =   285 bits (729),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 163/212 (77%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+++G +NLAV WW+LGSIENIC +D L  NSPWTCP  RV FDASVIW
Sbjct  553  PKSMFLVQFIGTIIAGTINLAVAWWLLGSIENICQSDLLPENSPWTCPGDRVFFDASVIW  612

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W FL+GA+ P+ VW+  ++FP + WIPLIN+PV+    A M
Sbjct  613  GLVGPRRIFGPLGNYGALNWFFLVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGATANM  672

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +W+  G +FN+FVF+YRK WW++YNY+LSAALDAG AFM V L+FAL  E+
Sbjct  673  PPATAVNYTAWVTVGTVFNFFVFRYRKRWWERYNYILSAALDAGVAFMGVFLYFALNMEN  732

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG+  +HC LA+CPTA G+ V+GCPVF
Sbjct  733  TSINWWGTGGEHCDLATCPTAKGVQVDGCPVF  764



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   285 bits (728),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  NSPWTCP  RV FDASVIW
Sbjct  542  PRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPANSPWTCPGDRVFFDASVIW  601

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  602  GLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMM  661

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E+
Sbjct  662  PPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMEN  721

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  722  RSVTWWGTEGEHCELATCPTAKGIMVDGCPV  752



>ref|XP_008800083.1| PREDICTED: oligopeptide transporter 4-like [Phoenix dactylifera]
Length=748

 Score =   285 bits (728),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 164/212 (77%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q VGT+++G +NLAV WW+LGS+ENIC+   L  NSPWTCP  RV FDASVIW
Sbjct  537  PKSMFIVQFVGTIIAGTINLAVAWWLLGSVENICNDQLLPANSPWTCPGDRVFFDASVIW  596

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W F+ GA+ P+ VW+  K+FP + WIPLIN+PV+    A M
Sbjct  597  GLVGPRRIFGPLGNYGALNWFFVGGALGPIIVWIFHKIFPGQTWIPLINLPVLLGATAAM  656

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWIV G +FN+FV++YRK WW++YNY+LSAALDAG AFM V+L+FAL  E+
Sbjct  657  PPATSVNYNSWIVVGTVFNFFVYRYRKKWWERYNYILSAALDAGVAFMGVVLYFALSLEN  716

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG+  +HCPLA+CPTA G+ V+GCPVF
Sbjct  717  VSIDWWGTAGEHCPLATCPTARGVQVDGCPVF  748



>gb|AES90550.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=718

 Score =   284 bits (726),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 162/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L S++NIC+ D L   SPWTCP  RV FDASV+W
Sbjct  507  PRSMFLVQFIGTVLAGTINIGVAWWLLDSVKNICNKDLLPKGSPWTCPSDRVFFDASVVW  566

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  567  GLVGPKRIFGSLGEYSTLNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGATGMM  626

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+ AL  E+
Sbjct  627  PPATALNYNSWIIVGTIFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYLALGLEN  686

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HCPLA+CPTA GIVV+GCPVF
Sbjct  687  VSLNWWGTAGEHCPLAACPTAKGIVVDGCPVF  718



>ref|XP_003593303.1| Oligopeptide transporter [Medicago truncatula]
 gb|ABN05713.1| Peptidase aspartic, active site; Oligopeptide transporter OPT 
superfamily [Medicago truncatula]
 gb|AES63554.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=729

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L S+ENIC  D L   SPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTMLAGTINIGVAWWLLNSVENICHDDLLPEGSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W F+ GA+ P+ VW+L K FP + WI LIN+PV+    A M
Sbjct  578  GLVGPKRIFGSKGNYSAMNWFFIGGAIGPIIVWLLHKAFPRQSWIALINLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI  G IFN+FVF+YRK WWQ+YNYVLSAALD G AFM VLL+F+L  E+
Sbjct  638  PPATPLNYNSWIFVGTIFNFFVFRYRKKWWQRYNYVLSAALDTGVAFMTVLLYFSLSLEN  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HCPLASCPTA GI V+GCPV
Sbjct  698  RSISWWGTEGEHCPLASCPTAKGIAVDGCPV  728



>gb|KJB58809.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=482

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 160/216 (74%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDASVIW
Sbjct  267  PRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVIW  326

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+      M
Sbjct  327  GLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNM  386

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL  E 
Sbjct  387  PPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVES  446

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  D    HC LA+CPTA GI+VEGCP+F
Sbjct  447  KSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  482



>ref|XP_008219191.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=729

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM++ Q +GTL++G VN+ V WW+L +IENIC    L PNSPWTCP  RV FDASVIW
Sbjct  518  PISMFIVQCIGTLIAGTVNVGVAWWLLSTIENICQDQLLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ L W FLIGA+ P+ VW+L K FP KKWI LIN+PV+    A M
Sbjct  578  GLVGPRRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSKKWIKLINLPVLLGATAVM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WIV G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  638  PPATTVNFNCWIVVGAIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG+  +HC LA+CPTA GIVV+GCPV+
Sbjct  698  KSISWWGTNGEHCELATCPTAKGIVVDGCPVY  729



>ref|XP_007042780.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOX98611.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=941

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  D L  +SPWTCP  RV FDASVIW
Sbjct  730  PRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICHDDLLPADSPWTCPGDRVFFDASVIW  789

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G YR + W F+ GAV PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  790  GLVGPKRIFGSLGNYRAMNWFFVGGAVGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMM  849

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E+
Sbjct  850  PPATPLNYNAWIIVGTIFNFFIFRYRKHWWQRYNYILSAALDAGVAFMAILLYFSVGMEN  909

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + L WWG+  +HC LA+CPTA GI VEGCPV
Sbjct  910  RSLTWWGTGGEHCELATCPTAKGIAVEGCPV  940



>emb|CAN81605.1| hypothetical protein VITISV_025060 [Vitis vinifera]
Length=739

 Score =   284 bits (726),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GT+++G VN+ V WW+L SIENIC    L PNSPWTCP  RV +DASVIW
Sbjct  528  PRSMFVVQFIGTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL+GA+ PV VW+L K FP +KWI L+N+PV+      M
Sbjct  588  GLVGPRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L   +
Sbjct  648  PPATTLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMAN  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LASCPTA GIVV+GCPV
Sbjct  708  RSISWWGAEGEHCGLASCPTAKGIVVDGCPV  738



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GT+++G VN+ V WW+L SIENIC    L PNSPWTCP  RV +DASVIW
Sbjct  529  PRSMFVVQFIGTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL+GA+ PV VW+L K FP +KWI L+N+PV+      M
Sbjct  589  GLVGPRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L   +
Sbjct  649  PPATTLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMAN  708

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LASCPTA GIVV+GCPV
Sbjct  709  RSISWWGAEGEHCGLASCPTAKGIVVDGCPV  739



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIW
Sbjct  543  PRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  603  GLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E+
Sbjct  663  PPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMEN  722

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  723  RSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  753



>emb|CBI35438.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDASVIW
Sbjct  482  PRSMFLVQFIGTILAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIW  541

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    + M
Sbjct  542  GLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMM  601

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L  E 
Sbjct  602  PPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEE  661

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG++ +HC LA+CPTA GIVV+GCPV
Sbjct  662  KGLTWWGTDGEHCKLATCPTAKGIVVDGCPV  692



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  745  RSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWG  566
            RSM+  Q +GT+V+ +VN+   WW+LGSIENICD   L PNSPWTCP  RV FDASVIWG
Sbjct  533  RSMFHVQFIGTIVAAIVNMCCAWWLLGSIENICDKSLLPPNSPWTCPSDRVFFDASVIWG  592

Query  565  LIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMP  386
            LIGPKR+FG  G Y+ L W FL GA+ PV VW+ S+ FP  KWIPLIN+PVI    A MP
Sbjct  593  LIGPKRMFGSHGEYKELQWFFLGGALGPVLVWLASRTFPNVKWIPLINLPVILGATAYMP  652

Query  385  PATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHK  206
            PAT  N  SW + G+IF+YF+F+Y KGWWQ+YNYV SAA+DAG AFM VLL+  L  E++
Sbjct  653  PATSVNYISWSIVGIIFSYFIFRYHKGWWQRYNYVFSAAMDAGVAFMGVLLYLCLGIENR  712

Query  205  ELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
             L WWG+ +D+CPLA CPTA GIV+ GCPV+
Sbjct  713  SLSWWGNNVDNCPLADCPTAKGIVIAGCPVY  743



>ref|XP_010030911.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=739

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  528  PRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  588  GLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAALDAGTAFMAVLL+F++  E+
Sbjct  648  PPATPLNYNAWVLVGTIFNFFVFRYRKQWWQRYNYVLSAALDAGTAFMAVLLYFSVGMEN  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG+  +HC LA+CPTA GI V+GCP+
Sbjct  708  KSITWWGTNGEHCELAACPTAKGIEVDGCPI  738



>ref|XP_003608353.1| Oligopeptide transporter [Medicago truncatula]
Length=739

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 162/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L S++NIC+ D L   SPWTCP  RV FDASV+W
Sbjct  528  PRSMFLVQFIGTVLAGTINIGVAWWLLDSVKNICNKDLLPKGSPWTCPSDRVFFDASVVW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  588  GLVGPKRIFGSLGEYSTLNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGATGMM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+ AL  E+
Sbjct  648  PPATALNYNSWIIVGTIFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYLALGLEN  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HCPLA+CPTA GIVV+GCPVF
Sbjct  708  VSLNWWGTAGEHCPLAACPTAKGIVVDGCPVF  739



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM++ Q +GT+++G VN+ V W +L SIENIC    L PNSPWTCP  RV FDASVIW
Sbjct  522  PISMFIVQCIGTIIAGTVNIXVAWXLLSSIENICQDQLLPPNSPWTCPGDRVFFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ L W FLIGA+ P+ VW+L K FP +KWI LIN+PV+    A M
Sbjct  582  GLVGPKRIFGSLGNYKALNWFFLIGALGPLLVWLLHKAFPSQKWIKLINLPVLLGATAAM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WIV G IFNYFVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  642  PPATTVNFNCWIVVGTIFNYFVFRYRKQWWQRYNYVLSAALDAGVAFMGVLLYFSLTTYE  701

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG+  +HC LA+CPTA GIVV+GCPV+
Sbjct  702  KSISWWGTNGEHCDLATCPTAKGIVVDGCPVY  733



>ref|XP_006486776.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=736

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 164/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIW
Sbjct  525  PRSMFLVQFIGTVLAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIW  584

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  585  GLVGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIPLINLPVLLGATGMM  644

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E 
Sbjct  645  PPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMED  704

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  705  KGLSWWGTEGEHCDLATCPTAKGILVDGCPV  735



>gb|KJB58808.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 161/216 (75%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNL V WW+L ++ENIC  D L  NSPWTCP  RV FDASVIW
Sbjct  539  PRSMFLVQFIGTVLAGTVNLGVAWWLLTTVENICHRDLLPANSPWTCPGDRVFFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G+Y +L W FL G + PV VW+L K FP + WIPLIN+PV+      M
Sbjct  599  GLVGPKRIFGSQGVYSSLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFM VLL+FAL  E+
Sbjct  659  PPATPLNYTSWILIGTIFNFFVFRYRKRWWQRYNYILSAALDAGVAFMTVLLYFALGIEN  718

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  D    HC LASCPTA GI  EGCP+F
Sbjct  719  KSLNWWGASPDFFPEHCDLASCPTAKGISAEGCPIF  754



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 159/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM++ Q +GTL++G VN+AV WW+L SIENIC    L PNSPWTCP  RV FDASVIW
Sbjct  530  PISMFIVQCIGTLIAGTVNMAVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFFDASVIW  589

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W F+ GA+ P+ VW+L K FP  KWI LIN+PV+    A M
Sbjct  590  GLVGPKRIFGSLGNYAALNWFFVGGAIGPLLVWLLQKAFPNHKWISLINLPVLLGSTAIM  649

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F L  E 
Sbjct  650  PPATAVNFNCWIIVGTIFNFFVFRYRKEWWQRYNYVLSAALDAGLAFMGVLLYFTLTMED  709

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K L WWGS+ +HC LA+CPTA GIVV+GCPVF
Sbjct  710  KGLTWWGSDGEHCDLANCPTAKGIVVDGCPVF  741



>ref|XP_007159179.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
 gb|ESW31173.1| hypothetical protein PHAVU_002G215700g [Phaseolus vulgaris]
Length=738

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 163/212 (77%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N  V WW+L S+ NIC  D L  +SPWTCP   V FDASVIW
Sbjct  527  PRSMFLVQFIGTMLAGSINTGVAWWLLNSVHNICHRDLLPEDSPWTCPSDHVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ L W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  587  GLVGPRRIFGSHGNYQALNWFFLGGAIGPILVWLLHKAFPKQSWIPLINLPVLLGATGMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+
Sbjct  647  PPATALNYNAWIIIGTIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYFAVGLEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG++ +HCPLA+CPTA GIVV+GCPV+
Sbjct  707  KSISWWGNDGEHCPLATCPTAKGIVVDGCPVY  738



>ref|XP_010112260.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC33016.1| Oligopeptide transporter 4 [Morus notabilis]
Length=742

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 163/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L ++ENIC  + L  NSPWTCP  RV FDASVIW
Sbjct  531  PRSMFIVQFLGTILAGTINLAVAWWLLTTVENICQDNLLPTNSPWTCPGDRVFFDASVIW  590

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GAV PV +W+L K FP++ WIPLIN+PV+    A M
Sbjct  591  GLVGPKRIFGSQGNYAAMNWFFLGGAVGPVIIWLLHKAFPKQTWIPLINLPVLLGATAMM  650

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E 
Sbjct  651  PPATSLNFNSWIIVGTIFNFFVFRYRKQWWQRYNYILSAALDAGVAFMAVLLYFSVGLED  710

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG++ +HC LA+CPTA GI+ +GCP+
Sbjct  711  KSLTWWGTDGEHCELATCPTAKGIIKDGCPL  741



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIW
Sbjct  542  PRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIW  601

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  602  GLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMM  661

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E+
Sbjct  662  PPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMEN  721

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  722  RSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  752



>ref|XP_003528403.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=746

 Score =   283 bits (723),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI NIC  D L   SPWTCP  RV FDASVIW
Sbjct  535  PRSMFLVQFIGTMLAGTINICVAWWLLNSINNICHKDLLPEGSPWTCPSDRVFFDASVIW  594

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP R+FG  G Y+ L W F  GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  595  GLVGPLRIFGSHGDYQALNWFFFGGAIGPILVWILHKSFPKQSWIPLINLPVLLGATGMM  654

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+F L  E+
Sbjct  655  PPATPLNYNAWIIVGTIFNFFIFRYRKKWWQRYNYVLSAALDAGVAFMAVLLYFTLGLEN  714

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HCPLA+CPTA GIVV+GCPV+
Sbjct  715  TSLNWWGTAGEHCPLATCPTAKGIVVDGCPVY  746



>ref|XP_007225210.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
 gb|EMJ26409.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
Length=729

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM++ Q +GTL++G VNL V WW+L +IENIC    L PNSPWTCP  RV FDASVIW
Sbjct  518  PISMFIVQCIGTLIAGTVNLGVAWWLLSTIENICQDQLLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ L W FLIGA  P+ VW+L K FP KKWI LIN+PV+    A M
Sbjct  578  GLVGPRRIFGSLGNYKALNWFFLIGASGPLLVWLLHKAFPSKKWIKLINLPVLLGATAVM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WIV G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  638  PPATTVNFNCWIVVGAIFNFFVFRYRKKWWQRYNYVLSAALDAGVAFMGVLLYFSLTMNE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG+  +HC LA+CPTA GIVV+GCP++
Sbjct  698  KSISWWGTNGEHCELATCPTAKGIVVDGCPLY  729



>emb|CAN61122.1| hypothetical protein VITISV_038682 [Vitis vinifera]
Length=583

 Score =   279 bits (713),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT ++G +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDASVIW
Sbjct  372  PRSMFLVQFIGTXLAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIW  431

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    + M
Sbjct  432  GLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMM  491

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L  E 
Sbjct  492  PPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEE  551

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA+CPTA GIVV GCPV
Sbjct  552  KGLTWWGTXGEHCKLATCPTAKGIVVXGCPV  582



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   282 bits (722),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L +I+NIC  + L P+SPWTCP  RV FDASVIW
Sbjct  533  PRSMFLVQFIGTILAGTINIAVAWWLLTTIKNICQDELLPPDSPWTCPGDRVFFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y ++ W FL GA+ PV VWV  K FP++ WIPLIN+PV+    + M
Sbjct  593  GLVGPKRIFGSLGNYPSMNWFFLGGALGPVVVWVFHKAFPKQSWIPLINLPVLLGATSMM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAA+DAG AFMAVLL+F+L  E 
Sbjct  653  PPATSLNYNSWILVGTIFNFFVFRYRKQWWQRYNYILSAAMDAGVAFMAVLLYFSLGIEE  712

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG++ +HC LA+CPTA GIVV+GCPV
Sbjct  713  KGLTWWGTDGEHCKLATCPTAKGIVVDGCPV  743



>ref|XP_008803571.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   283 bits (723),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 161/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+LGSI NIC +D L  NSPWTCP  RV FDASVIW
Sbjct  552  PRSMFLVQFIGTIIAGTINLAVAWWLLGSITNICQSDLLPENSPWTCPSDRVFFDASVIW  611

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W F +GA+ P+ VW+  ++FP + WIPLIN+PV+    A M
Sbjct  612  GLVGPRRIFGPLGNYAALNWFFAVGALGPIIVWIFHRLFPSQTWIPLINLPVLFGATAYM  671

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +W+  G +FN+FVF+YRK WW++YNY+LSAALDAG AFM VLL+F L  E+
Sbjct  672  PPATALNYTAWVTVGTVFNFFVFRYRKKWWERYNYILSAALDAGVAFMGVLLYFTLNLEN  731

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HC LA+CPTA G+ V+GCPVF
Sbjct  732  TSLNWWGTGGEHCDLATCPTAKGVRVDGCPVF  763



>gb|EMS45133.1| Oligopeptide transporter 4 [Triticum urartu]
Length=681

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q  GTLV+G VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDASVIW
Sbjct  467  PRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDASVIW  526

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  + W FLIGA  PV V++  ++FP ++WI +IN+PV+    A M
Sbjct  527  GLVGPKRIFGPHGNYEAVNWFFLIGAAGPVIVYIFHRIFPSQRWILMINLPVLIGATANM  586

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E+
Sbjct  587  PPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLTMEN  646

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  647  RTVNWWGTAGEHCPLASCPTAKGVDLGPDSVCPVF  681



>gb|KCW56911.1| hypothetical protein EUGRSUZ_I02587 [Eucalyptus grandis]
Length=739

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 163/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  528  PRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPGDRVFFDASVIW  587

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  588  GLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMM  647

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            P ATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+
Sbjct  648  PAATPLNYSAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFAVNIEN  707

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA+CPTA GI V+GCPV
Sbjct  708  KSLTWWGTNGEHCELAACPTAKGIEVDGCPV  738



>emb|CBI19305.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   281 bits (718),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 165/216 (76%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIW
Sbjct  485  PRSMFLVQLIGTILAGTVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDASVIW  544

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  545  GLVGPKRVFGSLGNYGALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGATASM  604

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++ +L  E+
Sbjct  605  PPATPVNYNAWILIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLGIEN  664

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG++ D    HCPLASCPTA G++V+GCPVF
Sbjct  665  KNLHWWGADPDIDPEHCPLASCPTAKGVIVDGCPVF  700



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =   281 bits (720),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVIVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GT+++G VN+ V WW+L SIENIC    L PNSPWTCP  RV +DASVIW
Sbjct  648  PRSMFVVQFIGTIIAGTVNITVAWWLLTSIENICQDQLLPPNSPWTCPGDRVFYDASVIW  707

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL+GA+ PV VW+L K FP +KWI L+N+PV+      M
Sbjct  708  GLVGPRRIFGDLGDYSALNWFFLVGALGPVLVWLLHKAFPTQKWISLVNLPVLLGATGAM  767

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L   +
Sbjct  768  PPATTLNFNAWIFVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGLAFMGVLLYFSLTMAN  827

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LASCPTA GIVV+GCPV
Sbjct  828  RSISWWGAEGEHCGLASCPTAKGIVVDGCPV  858



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 160/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA+CPTA G++V+GCPV
Sbjct  698  KTLDWWGTRGEHCDLATCPTARGVIVDGCPV  728



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW L K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGALGPVLVWSLHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLAKCPTARGVIVDGCPV  728



>ref|XP_002967106.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
 gb|EFJ31705.1| hypothetical protein SELMODRAFT_87413 [Selaginella moellendorffii]
Length=739

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+  Q+VGT+++  VN+ V WW+L  I+NICDT+ L  +SPWTCP  RV FDASVIW
Sbjct  526  PRSMFTVQIVGTIIAATVNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FLIG + P+PVW+LS+  P+ +++  +NIPVI      M
Sbjct  586  GLVGPKRIFGSLGEYSQLSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI  G++FNYFV+KYRK WW++YNYVLSAALDAG+AFMAV+L+F+L  E 
Sbjct  646  PPATSVNYTTWITLGVVFNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLED  705

Query  208  KELKWWG-SELDHCPLASCPTAPGIVVEGCPVFK  110
              L WWG S+ DHCPLA CPT PGIVV+GCPV+ 
Sbjct  706  VSLTWWGTSDRDHCPLAKCPTQPGIVVDGCPVYS  739



>ref|XP_002960906.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
 gb|EFJ38445.1| hypothetical protein SELMODRAFT_229868 [Selaginella moellendorffii]
Length=739

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+  Q+VGT+++  VN+ V WW+L  I+NICDT+ L  +SPWTCP  RV FDASVIW
Sbjct  526  PRSMFTVQIVGTIIAATVNMGVAWWLLNGIDNICDTEKLPASSPWTCPSDRVFFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FLIG + P+PVW+LS+  P+ +++  +NIPVI      M
Sbjct  586  GLVGPKRIFGSLGEYSQLSWFFLIGILAPIPVWILSRALPKVEFLRYVNIPVILGATGYM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI  G++FNYFV+KYRK WW++YNYVLSAALDAG+AFMAV+L+F+L  E 
Sbjct  646  PPATSVNYTTWITLGVVFNYFVYKYRKAWWKRYNYVLSAALDAGSAFMAVVLYFSLGLED  705

Query  208  KELKWWG-SELDHCPLASCPTAPGIVVEGCPVFK  110
              L WWG S+ DHCPLA CPT PGIVV+GCPV+ 
Sbjct  706  VSLTWWGTSDRDHCPLAKCPTQPGIVVDGCPVYS  739



>ref|XP_010104576.1| Oligopeptide transporter 2 [Morus notabilis]
 gb|EXC01177.1| Oligopeptide transporter 2 [Morus notabilis]
Length=724

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 158/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P SM+V Q VGT+++G VN+ V WW+L ++ENIC    L PNSPWTCP  RV FDASVIW
Sbjct  513  PISMFVVQCVGTIIAGTVNIGVAWWLLHTVENICQDQLLPPNSPWTCPGDRVFFDASVIW  572

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FLIG + P+ VW+L K FP +KWI  +N+PV+    A M
Sbjct  573  GLVGPKRIFGSEGNYSQLNWFFLIGVMGPLLVWLLHKAFPSQKWIKFVNLPVLFGATAVM  632

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G +FN+FVF+YRK WWQKYNYVLSAALDAG AFM V+L+F L  E 
Sbjct  633  PPATTVNFNCWIIVGTVFNFFVFRYRKQWWQKYNYVLSAALDAGLAFMGVVLYFTLTMED  692

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            + L WWG++ +HC LA+CPTA GIVV+GCPVF
Sbjct  693  RSLSWWGADGEHCELATCPTAKGIVVDGCPVF  724



>ref|XP_010520694.1| PREDICTED: oligopeptide transporter 4 [Tarenaya hassleriana]
Length=756

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNL+V WW L SIENIC  D L P+SPWTCP  RV FDASVIW
Sbjct  545  PRSMFLVQFIGTILAGTVNLSVAWWQLSSIENICQEDLLPPDSPWTCPGDRVFFDASVIW  604

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W F+ GA+ P+ VW+L K FP + WIPLIN+PV+    + M
Sbjct  605  GLVGPKRIFGSQGNYAAMNWFFVGGALGPIIVWMLHKSFPNQSWIPLINLPVLLGATSMM  664

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G +FN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+F L  E 
Sbjct  665  PPATAVNYNSWILVGTVFNFFVFRYRKQWWQRYNYVLSAALDAGVAFMAVLLYFTLGMEG  724

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
              L WWG++ +HC LA CPTA GI V+GCPV
Sbjct  725  IRLSWWGTDGEHCNLAKCPTAEGISVDGCPV  755



>gb|EMT05383.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=570

 Score =   277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 163/215 (76%), Gaps = 3/215 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q VGT+V+G +NL+V WW+LGS+ENIC  + LS NSPWTCP  RV FDASVIW
Sbjct  356  PRSMFVVQFVGTIVAGTINLSVAWWLLGSVENICHIEKLSANSPWTCPNDRVFFDASVIW  415

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  + + FLIGA  P  V++  ++FP+KKWI LIN+PV+    A M
Sbjct  416  GLVGPRRIFGPLGNYAAINYFFLIGAASPFVVYIFHRIFPDKKWILLINLPVLINATASM  475

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+ SAA+DAG AFMAVLL+FAL  ++
Sbjct  476  PPATAVNYNSWLLVGTIFNFFVFRYRKRWWQRYNYIFSAAMDAGVAFMAVLLYFALTMQN  535

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLA CPT+ G+ +     CPVF
Sbjct  536  RSIVWWGTAGEHCPLAICPTSKGVDLGPESVCPVF  570



>ref|XP_001767301.1| predicted protein [Physcomitrella patens]
 gb|EDQ67982.1| predicted protein [Physcomitrella patens]
Length=690

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 156/212 (74%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR+M+ AQL+GT+++ V+NL   WW+L S+ +IC  D L  NSPWTCP   + +DASVIW
Sbjct  479  PRAMFHAQLLGTVIAAVLNLGTAWWLLTSVPDICQQDLLPANSPWTCPGDTIFYDASVIW  538

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKR+FG  GLY  + W FL GA+ PVP WVL K+FP+KKWI  I  PV+      M
Sbjct  539  GLIGPKRMFGSLGLYNAVNWFFLFGALAPVPFWVLHKIFPDKKWITYIYTPVLIGATGMM  598

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW + G IFN+ VFKYRKGWWQ+YNY+LSAALDAG AFM VLL+F LQ E 
Sbjct  599  PPATAVNYTSWFLIGYIFNHLVFKYRKGWWQRYNYILSAALDAGLAFMGVLLYFVLQLED  658

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG  LD+CPLA+CPTAPG+   GCPVF
Sbjct  659  KNMSWWGENLDNCPLAACPTAPGVTRNGCPVF  690



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 165/216 (76%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIW
Sbjct  539  PRSMFLVQLIGTILAGTVNLGVALWLLDSIDNICQDNLLPANSPWTCPSDRVFFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  599  GLVGPKRVFGSLGNYGALNWFFLGGLLGPVAVWLLHKKFPKQSWIPLINLPVLLGATASM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++ +L  E+
Sbjct  659  PPATPVNYNAWILIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYVSLGIEN  718

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG++ D    HCPLASCPTA G++V+GCPVF
Sbjct  719  KNLHWWGADPDIDPEHCPLASCPTAKGVIVDGCPVF  754



>ref|XP_003545740.1| PREDICTED: oligopeptide transporter 4 [Glycine max]
Length=736

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDASVIW
Sbjct  525  PRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIW  584

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GAV P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  585  GLVGPKRIFGSQGNYSAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMM  644

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+FAL  E+
Sbjct  645  PPATPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALGLEN  704

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K L WWG++ +HCPLA CPTA G++V+GCP
Sbjct  705  KSLNWWGNDGEHCPLAVCPTAKGVIVDGCP  734



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN+AV WW+L SI NIC  + L P+SPWTCP  RV FDASVIW
Sbjct  509  PRSMFLVQFIGTIIAGTVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDASVIW  568

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPKR+FG  G Y+ + W FL GAV P  VW+L K FP+K WIPLIN+PV+      M
Sbjct  569  GLAGPKRIFGVQGNYQAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNM  628

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L  E+
Sbjct  629  PPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMEN  688

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LASCPTA GI ++GCP 
Sbjct  689  KGLNWWGTGGEHCDLASCPTAKGISMDGCPT  719



>gb|KHN33580.1| Oligopeptide transporter 4 [Glycine soja]
Length=773

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDASVIW
Sbjct  562  PRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIW  621

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GAV P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  622  GLVGPKRIFGSQGNYSAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMM  681

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+FAL  E+
Sbjct  682  PPATPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFALGLEN  741

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K L WWG++ +HCPLA CPTA G++V+GCP
Sbjct  742  KSLNWWGNDGEHCPLAVCPTAKGVIVDGCP  771



>ref|XP_007148333.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
 gb|ESW20327.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
Length=738

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 162/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L  +SPWTCP  RV FDASVIW
Sbjct  527  PRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+P++      M
Sbjct  587  GLVGPKRIFGSQGNYSAMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPILLGATGMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+F L  E+
Sbjct  647  PPATPLNYNAWILVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLGLEN  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            + L WWG++ +HCPLA+CPTA GI+V+GCP
Sbjct  707  RSLNWWGNDGEHCPLAACPTAKGIIVDGCP  736



>gb|EPS59040.1| hypothetical protein M569_15770, partial [Genlisea aurea]
Length=538

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L +I++IC  D L PNSPWTCP  RV FDASVIW
Sbjct  327  PRSMFIVQALGTIIAGTINIGVAWWLLTTIKDICHPDLLPPNSPWTCPSDRVFFDASVIW  386

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y ++ W FL GA+ P  VW+L K FP + WIPLIN+PV+      M
Sbjct  387  GLVGPRRIFGKLGNYGSMNWFFLGGAIGPFFVWLLHKAFPRQAWIPLINLPVLLGATGAM  446

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSA LDAG AFMAVL++FAL  E+
Sbjct  447  PPATPLNYNAWIIVGTIFNFFVFRYRKRWWQRYNYILSAGLDAGVAFMAVLVYFALGIEN  506

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG+  DHC  A+CPTA GI V+GCP++
Sbjct  507  VSINWWGTAGDHCTFATCPTAKGIQVDGCPIY  538



>ref|XP_006422647.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35887.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=692

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIW
Sbjct  481  PRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIW  540

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WI LIN+PV+      M
Sbjct  541  GLAGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGATGMM  600

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E 
Sbjct  601  PPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMED  660

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+E +HC LA+CPTA GI+++GCPV
Sbjct  661  KGLSWWGTEGEHCDLATCPTAKGILIDGCPV  691



>ref|XP_007148334.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
 gb|ESW20328.1| hypothetical protein PHAVU_006G200100g [Phaseolus vulgaris]
Length=734

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 162/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L  +SPWTCP  RV FDASVIW
Sbjct  523  PRSMFLVQFIGTMLAGTINIGVAWWLLNSIKNICHDDLLPADSPWTCPGDRVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  583  GLVGPKRIFGSQGNYSAMNWFFLGGALGPVIVWLLHKAFPKQSWIPLINLPVLLGATGMM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM VLL+F L  E+
Sbjct  643  PPATPLNYNAWILVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVLLYFTLGLEN  702

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            + L WWG++ +HCPLA+CPTA G++V+GCP
Sbjct  703  RSLNWWGNDGEHCPLAACPTAKGVIVDGCP  732



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 165/211 (78%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L SIENIC  D L  +SPWTCP  RV FDASVIW
Sbjct  740  PRSMFLVQFIGTILAGTINIAVAWWLLNSIENICQDDLLPADSPWTCPGDRVFFDASVIW  799

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+L K FP++ WIPLIN+PV+      M
Sbjct  800  GLVGPKRIFGSLGNYPAMNWFFLGGALGPVIVWLLHKTFPKQSWIPLINLPVLLGATGMM  859

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA+LL+F++  E+
Sbjct  860  PPATPLNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAILLYFSVGMEN  919

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + + WWG+E +HC LA+CPTA GI+V+GCPV
Sbjct  920  RSVTWWGTEGEHCKLATCPTAKGIMVDGCPV  950



>gb|EMT16469.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=790

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q  GTLV+G VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDASVIW
Sbjct  576  PRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDASVIW  635

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  + W FLIGA  PV V++  ++FP ++WI +IN+PV+    A M
Sbjct  636  GLVGPKRIFGPHGNYEAVNWFFLIGAAGPVIVYIFHRIFPSQRWILMINLPVLIGATANM  695

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E+
Sbjct  696  PPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLTMEN  755

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  756  RTVNWWGTAGEHCPLASCPTAKGVDLGPDSVCPVF  790



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =   280 bits (717),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN+AV WW+L SI NIC  + L P+SPWTCP  RV FDASVIW
Sbjct  545  PRSMFLVQFIGTIIAGTVNMAVAWWLLNSITNICQIELLPPDSPWTCPNDRVFFDASVIW  604

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPKR+FG  G Y+ + W FL GAV P  VW+L K FP+K WIPLIN+PV+      M
Sbjct  605  GLAGPKRIFGVQGNYQAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNM  664

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L  E+
Sbjct  665  PPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMEN  724

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LASCPTA GI ++GCP 
Sbjct  725  KGLNWWGTGGEHCDLASCPTAKGISMDGCPT  755



>ref|XP_003547106.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=737

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP  RV FDASVIW
Sbjct  526  PRSMFLVQFIGTILAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPGDRVFFDASVIW  585

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  586  GLVGPKRIFGSQGNYSAMNWFFLGGALGPIIVWLLHKAFPKQSWIPLINLPVLLGATGMM  645

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G AFM V+L+F+L  E+
Sbjct  646  PPATPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVAFMTVMLYFSLGLEN  705

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K L WWG++ +HCPLA+CPTA GI+V+GCP
Sbjct  706  KSLNWWGNDGEHCPLAACPTAKGIIVDGCP  735



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  523  PRSMFLVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI LIN+PV+    A M
Sbjct  583  GLVGPKRIFGRLGNYSALNWFFLGGLIGPVLVWLLQKAFPTKTWISLINLPVLLGATAAM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  643  PPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  702

Query  208  KEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG+  ++CPLASCPTAPGI VEGCPVF
Sbjct  703  ISIDHWWGANGENCPLASCPTAPGIQVEGCPVF  735



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   279 bits (714),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L +I NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKRSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMED  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG++ +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTQGEHCDLARCPTARGVIVKGCPV  728



>ref|XP_006422648.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35888.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=736

 Score =   279 bits (714),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NLAV WW+L SIENIC  + L P+SPWTCP  RV FDASVIW
Sbjct  525  PRSMFLVQFIGTILAGTINLAVAWWLLNSIENICQDELLPPDSPWTCPGDRVFFDASVIW  584

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPKR+FG  G Y  + W F+ GA+ PV VW+L K FP++ WI LIN+PV+      M
Sbjct  585  GLAGPKRIFGSQGNYPAMNWFFVGGALGPVLVWLLHKAFPKQSWIALINLPVLLGATGMM  644

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNY+LSAA+DAG AFMAV+L+F++  E 
Sbjct  645  PPATAVNYNSWIIVGTIFNFFIFRYRKQWWQRYNYILSAAMDAGVAFMAVILYFSVGMED  704

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+E +HC LA+CPTA GI+++GCPV
Sbjct  705  KGLSWWGTEGEHCDLATCPTAKGILIDGCPV  735



>dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   279 bits (714),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q  GTLV+G VNL+V WW+LGS+ENIC    L P+SPWTCP  RV FDASVIW
Sbjct  535  PRSMFIVQFAGTLVAGTVNLSVAWWLLGSVENICQDQLLPPDSPWTCPGDRVFFDASVIW  594

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FLIGA  PV V++  ++FP ++WI +IN+PV+    A M
Sbjct  595  GLVGPKRIFGSHGNYEAVNWFFLIGAAGPVIVYIFHRIFPRQRWILMINLPVLIGATANM  654

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E+
Sbjct  655  PPATAVNYNSWLLIGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLTMEN  714

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  715  RTVNWWGTAGEHCPLASCPTAKGVDLGPDSACPVF  749



>gb|EMT13287.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=521

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 160/215 (74%), Gaps = 3/215 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q VGT+V+G VNL V WW+LGS+ENIC    L PNSPWTCP  RV FDASVIW
Sbjct  307  PKSMFIVQFVGTVVAGTVNLIVGWWLLGSVENICQDQLLPPNSPWTCPNDRVFFDASVIW  366

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP R+FG  G Y  L W FL GA  PV V++L ++FP  KWI LINIPV++   A M
Sbjct  367  GLVGPNRIFGSNGNYIALNWFFLFGAAGPVIVYILHRIFPTHKWILLINIPVLTGATALM  426

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+  N  SW++ G+IFN+FVF+YRK WWQ+YNY+LSA LDAG AFM VLL+F L  E+
Sbjct  427  PPASTLNFNSWLLYGIIFNFFVFRYRKKWWQRYNYILSAGLDAGAAFMGVLLYFTLTMEN  486

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + +KWWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  487  RTIKWWGTGGEHCPLASCPTAKGVDLGPDSVCPVF  521



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 159/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+ +G +N+AV WW+L SI NIC+ + L  +SPWTCP  RV FDASVIW
Sbjct  535  PRSMFLVQFIGTIFAGTINIAVAWWLLNSIHNICEDNLLPADSPWTCPGDRVFFDASVIW  594

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ + W F+ GA+ P+ VW+  K FP+K WIPLIN+PV+    A M
Sbjct  595  GLVGPKRIFGDLGTYKAMNWFFIGGAIGPIIVWLFHKAFPKKSWIPLINLPVLLGATAYM  654

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI+ G IFN FVF+YRK WWQ+YNY+LSAALDAG AFM VLL+F+L  E 
Sbjct  655  PPATTVNYNAWIIVGTIFNLFVFRYRKQWWQRYNYILSAALDAGVAFMGVLLYFSLGVED  714

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LASCPTA GI V+GCP+
Sbjct  715  KSLTWWGTNGEHCNLASCPTAKGIAVDGCPI  745



>ref|XP_010029956.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=743

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  532  PRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDASVIW  591

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  592  GLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMM  651

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            P ATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+
Sbjct  652  PAATPLNYNAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVNIEN  711

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG+  +HC LA+CPTA GI  +GCPV
Sbjct  712  KSITWWGTNGEHCELAACPTAKGIEGDGCPV  742



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 158/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN++V W++L ++ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  523  PRSMFLVQFIGTIIAGTVNVSVAWYLLTTVENICQKELLPPNSPWTCPGDRVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL GA+ P+ VW+L K FP +KWI  IN+PV+    A M
Sbjct  583  GLVGPRRIFGNLGNYPELNWFFLFGALGPLIVWILHKAFPNQKWISQINLPVLLGSTAAM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKYRK WWQ+YNYVLSAALDAG AFM VLL+F L    
Sbjct  643  PPATSVNFNCWIIIGVIFNYFVFKYRKSWWQRYNYVLSAALDAGLAFMGVLLYFTLSMND  702

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGS  ++CPLASCPTA G+ VEGCP F
Sbjct  703  ISISWWGSNGENCPLASCPTAEGVEVEGCPAF  734



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 160/216 (74%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDASVIW
Sbjct  540  PRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVIW  599

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+      M
Sbjct  600  GLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNM  659

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL  E 
Sbjct  660  PPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVES  719

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  D    HC LA+CPTA GI+VEGCP+F
Sbjct  720  KSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  755



>gb|KJB58807.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 160/216 (74%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L S+ENIC  + L  NSPWTCP  +V FDASVIW
Sbjct  539  PRSMFLVQFIGTMLAGTINLGVGWWLLSSVENICHKNLLPANSPWTCPGDKVFFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+      M
Sbjct  599  GLVGPKRIFGSLGEYSTLNWFFLGGLLGPVVVWLLHKAFPSQAWIPLINLPVLLGATGNM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VL++ AL  E 
Sbjct  659  PPATPLNYTSWIIVGTIFNFFVFRYRKRWWQRYNYILSAALDAGTAFMTVLIYVALGVES  718

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  D    HC LA+CPTA GI+VEGCP+F
Sbjct  719  KSLHWWGASPDVVPEHCDLATCPTAKGILVEGCPIF  754



>ref|XP_010244695.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=743

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 161/212 (76%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+++G +N+AV  W+L SI NICD   L P+SPWTCP  RV FDASVIW
Sbjct  532  PKSMFLVQFIGTIMAGTINIAVAMWLLNSIPNICDDQILPPDSPWTCPSDRVFFDASVIW  591

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL GA+ P+ VW+L K FP++ WIP IN+PV+    A M
Sbjct  592  GLVGPKRIFGTLGNYTALNWFFLGGALGPLLVWLLHKTFPKQTWIPQINLPVLLGATAMM  651

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFM VLL+F+L  E 
Sbjct  652  PPATTVNYTSWVLVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMGVLLYFSLNMEG  711

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  +HC LASCPTA GIVV+GCPVF
Sbjct  712  KGLDWWGAGGEHCDLASCPTAKGIVVDGCPVF  743



>gb|KCW56912.1| hypothetical protein EUGRSUZ_I02589 [Eucalyptus grandis]
Length=770

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L S+ NIC  D L P+SPWTCP  RV FDASVIW
Sbjct  559  PRSMFLVQFIGTILAGTINIAVAWWLLNSVTNICQDDLLPPDSPWTCPDDRVFFDASVIW  618

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y+ + W FL GA+ P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  619  GLVGPRRIFGTLGNYQAMNWFFLGGAIGPIIVWLLHKTFPKQSWIPLINLPVLLGATGMM  678

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            P ATP N  +WI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVLL+FA+  E+
Sbjct  679  PAATPLNYNAWILVGTIFNFFIFRYRKQWWQRYNYVLSAALDAGAAFMAVLLYFAVNIEN  738

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG+  +HC LA+CPTA GI  +GCPV
Sbjct  739  KSITWWGTNGEHCELAACPTAKGIEGDGCPV  769



>emb|CDP19591.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 161/214 (75%), Gaps = 2/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNL V WW+L ++E+IC  D ++ NSPWTCP  RV FDASVIW
Sbjct  379  PRSMFLVQFLGTIIAGTVNLGVAWWLLHTVEDICHPD-MASNSPWTCPGDRVFFDASVIW  437

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  L W FL G + P+ +W+L K FP++ WIPLIN+PVI    A M
Sbjct  438  GLVGPKRIFGPHGNYSALNWFFLGGLLGPLAIWLLHKQFPKQSWIPLINLPVILGATASM  497

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWIV G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMA LL+F +  E+
Sbjct  498  PPATALNYNSWIVVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAFLLYFTVGMEN  557

Query  208  KELKWWGSEL-DHCPLASCPTAPGIVVEGCPVFK  110
            + + WWG+   +HC LA+CPTA GI V+GCP F 
Sbjct  558  RSISWWGNNNPEHCDLATCPTAKGISVDGCPTFH  591



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L +I NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP+  WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMED  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLARCPTARGVIVKGCPV  728



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L +I NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLNTITNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP+  WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKHSWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAA+DAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAAMDAGVAFMAVLLYFSVGMED  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA CPTA G++V+GCPV
Sbjct  698  KSLDWWGTRGEHCDLARCPTARGVIVKGCPV  728



>gb|EMS64171.1| Oligopeptide transporter 4 [Triticum urartu]
Length=648

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 159/215 (74%), Gaps = 3/215 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q  GTLV+G VNL+  WW+LGS+ENIC    LSP+SPWTCP  RV FDASVIW
Sbjct  434  PRSMFIVQFAGTLVAGTVNLSTAWWLLGSVENICQDQLLSPDSPWTCPGDRVFFDASVIW  493

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FLIGA  PV V++  ++FP  KWI +IN+PV+    A M
Sbjct  494  GLVGPKRIFGTHGNYEAVNWFFLIGAAGPVIVYIFHRIFPSHKWILMINLPVLIGATAQM  553

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            P AT  N  SW++ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E+
Sbjct  554  PAATAMNYNSWLLIGTIFNFFVFRYRKMWWQRYNYILSAALDAGVAFMAVLLYFTLTMEN  613

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  614  RTVDWWGTGGEHCPLASCPTAKGVDLGPDSVCPVF  648



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 ref|XP_004170983.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=738

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+++G +NL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  527  PKSMFLVQFIGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKR+FG  G Y  + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    A M
Sbjct  587  GLIGPKRIFGSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++  E 
Sbjct  647  PPATPVNYNAWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEE  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + ++WWG+  +HC LA+CPTA G+VV+ CPV
Sbjct  707  RSVEWWGTAGEHCDLAACPTAKGVVVDSCPV  737



>gb|KGN53886.1| hypothetical protein Csa_4G179700 [Cucumis sativus]
Length=738

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+++G +NL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  527  PKSMFLVQFIGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKR+FG  G Y  + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    A M
Sbjct  587  GLIGPKRIFGSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++  E 
Sbjct  647  PPATPVNYNAWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEE  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + ++WWG+  +HC LA+CPTA G+VV+ CPV
Sbjct  707  RSVEWWGTAGEHCDLAACPTAKGVVVDSCPV  737



>ref|XP_008454451.1| PREDICTED: oligopeptide transporter 4 [Cucumis melo]
Length=738

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+++G +NL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  527  PKSMFLVQFIGTILAGTINLCVAWWLLTSISNICQVELLPPNSPWTCPSDRVFFDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGPKR+FG  G Y  + W FL GA+ P+ VW+L + FP++ WIPLIN+PV+    A M
Sbjct  587  GLIGPKRIFGSHGFYGTMNWFFLGGAIGPILVWLLHRAFPKQSWIPLINLPVLLGATAMM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+ +F+YRK WWQ+YNY+LSAALD G AFMAVLL+F++  E 
Sbjct  647  PPATPVNYNAWILIGTIFNFVIFRYRKQWWQRYNYILSAALDGGLAFMAVLLYFSVGMEE  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + ++WWG+  +HC LA+CPTA G+VV+ CPV
Sbjct  707  RSVEWWGTAGEHCDLAACPTAKGVVVDSCPV  737



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 158/211 (75%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+AV WW+L SI NIC    L P+SPWTCP  RV FDASVIW
Sbjct  541  PRSMFLVQFIGTIIAGTINMAVAWWLLNSITNICQDQLLPPDSPWTCPGDRVFFDASVIW  600

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GAV P  VW+L K FP+K WIPLIN+PV+      M
Sbjct  601  GLVGPKRIFGVQGNYPAMNWFFLGGAVGPFLVWLLHKAFPDKSWIPLINLPVLLGATGNM  660

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +W++ G IFN+FVF+YRK WWQ+YNYVLSAA+DAG AFM VLL+F L  E+
Sbjct  661  PPATPLNYNAWVLVGTIFNFFVFRYRKKWWQRYNYVLSAAMDAGVAFMGVLLYFCLGMEN  720

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            + L WWG+  +HC LASCPTA GI  +GCP+
Sbjct  721  RGLNWWGTGGEHCDLASCPTAKGISADGCPM  751



>ref|XP_009413226.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   277 bits (708),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/212 (59%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G +N+ V  WMLGSI+NICD   L PNSPWTCP  RV FDASVIW
Sbjct  536  PRSMFLVQLIGTIIAGTINITVAHWMLGSIDNICDRARLPPNSPWTCPGDRVFFDASVIW  595

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y +L W FL GA+ PV VW L + FP + WIPL+N+PV+      M
Sbjct  596  GLVGPRRIFGPLGNYGSLNWFFLGGAIGPVLVWGLHRAFPARSWIPLVNLPVLLGATGIM  655

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+P N  +W+V G +FNY V++ RK WW+++NY+LSAA+DAG AFM VLL+FAL  E+
Sbjct  656  PPASPINFTAWVVVGTVFNYAVYRRRKKWWERFNYILSAAMDAGVAFMGVLLYFALNMEN  715

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG++ +HCPLA+CPTA G+ VEGCPVF
Sbjct  716  TSIDWWGTD-EHCPLATCPTAKGVQVEGCPVF  746



>gb|KFK28135.1| hypothetical protein AALP_AA8G476800 [Arabis alpina]
Length=990

 Score =   281 bits (718),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 161/216 (75%), Gaps = 0/216 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW L SI+NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  518  PRSMFLVQFIGTILAGTINITVAWWQLTSIKNICQEELLPPNSPWTCPGDRVFFDASVIW  577

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GA+ PV VW+  K FP++ WIPL+N+PV+    A M
Sbjct  578  GLVGPKRIFGSQGNYAAMNWFFLGGAIGPVIVWLCHKAFPKRTWIPLVNLPVLLGATAMM  637

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+F++  E 
Sbjct  638  PPATAVNYNSWILVGTIFNLFVFRYRKSWWQRYNYVLSAALDAGVAFMAVLLYFSVGMEE  697

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK*AS  101
            K L WWG+  +HC LA CPTA G++V+GCP+   A+
Sbjct  698  KSLDWWGTRGEHCDLARCPTARGVIVDGCPILHLAN  733



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 160/213 (75%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  523  PRSMFLVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    A M
Sbjct  583  GLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  643  PPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  702

Query  208  KEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG+  ++CPLASCPTAPGI VEGCPVF
Sbjct  703  ISIDHWWGANGENCPLASCPTAPGIQVEGCPVF  735



>ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=753

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q VGTLV+G VNL+V WW+LGSIENIC    L P+SPWTCP  RV FDASVIW
Sbjct  538  PRSMFLVQFVGTLVAGTVNLSVAWWLLGSIENICQDTLLPPDSPWTCPGDRVFFDASVIW  597

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP R+FGP G Y  L   FLIGA  PV V+V  ++FP +KWI LIN+PV+    A M
Sbjct  598  GLVGPMRIFGPRGNYEALNLFFLIGAAGPVIVYVFHRIFPNQKWILLINLPVLIGATASM  657

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +W++ G  FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F L  E+
Sbjct  658  PPATAVNYNAWLLIGTFFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTLSMEN  717

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVFK  110
            + + WWG+  +HCPLA+CPTA G+ +     CPVF+
Sbjct  718  RSIDWWGTAGEHCPLATCPTAKGVDLGPDSLCPVFR  753



>ref|XP_003522744.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 2-like 
[Glycine max]
Length=730

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 160/212 (75%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q+VGTL++G +++ V WW+LGS++NIC+ D L  +SPWTCP  +V FDASVIW
Sbjct  519  PRSMFIVQVVGTLIAGTMDVGVAWWLLGSVKNICNQDLLPADSPWTCPGDKVFFDASVIW  578

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FLIGA+ P+ +W+L K F ++ WI LI++PV+    A M
Sbjct  579  GLVGPKRIFGTLGNYPKLNWFFLIGALGPLVIWLLQKAFRKQTWISLIHLPVLLGATANM  638

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+  N  +WI  G IFNYFVFKYRK WWQ+YNYVL AALDAG AFM VLL+FA+  E 
Sbjct  639  PPASSVNFNAWITVGTIFNYFVFKYRKNWWQRYNYVLPAALDAGLAFMTVLLYFAVNVEE  698

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K + WWG++ D C LA CPTA G+V EGCPVF
Sbjct  699  KGIVWWGNDGDQCKLAKCPTAKGVVTEGCPVF  730



>ref|NP_001266848.1| uncharacterized protein LOC101027225 [Zea mays]
 gb|ACN36454.1| unknown [Zea mays]
Length=370

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q VGT+V+G VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDASVIW
Sbjct  158  PKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDASVIW  216

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    A M
Sbjct  217  GLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGATAYM  276

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L  ++
Sbjct  277  PPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMQN  336

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  113
            K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  337  KSIDWWGTAGEHCPLARCPTAKGVDLGDGVCPVF  370



>gb|KHN33579.1| Oligopeptide transporter 4 [Glycine soja]
Length=666

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 158/210 (75%), Gaps = 0/210 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +N+ V WW+L SI+NIC  D L   SPWTCP   V FDASVIW
Sbjct  455  PRSMFLVQFIGTILAGTINIGVAWWLLNSIKNICHDDLLPEGSPWTCPNDLVFFDASVIW  514

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  + W FL GAV P+ VW+L K FP++ WIPLIN+PV+      M
Sbjct  515  GLVGPKRIFGSQGNYGAMNWFFLGGAVGPIIVWLLHKAFPKQSWIPLINLPVLLGATGIM  574

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA P N  +WI  G IFN+F+F+YRK WWQ+YNYVLSAALD+G  FM V+L+F+L  E+
Sbjct  575  PPARPLNYNAWIFVGTIFNFFIFRYRKKWWQRYNYVLSAALDSGVVFMTVMLYFSLGLEN  634

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCP  119
            K L WWG++ +HCPLA+CPTA GI+V+GCP
Sbjct  635  KSLNWWGNDGEHCPLAACPTAKGIIVDGCP  664



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  524  PRSMFLVQLIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WI  IN+PV+    A M
Sbjct  584  GLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGATAAM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  644  PPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  703

Query  208  KEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG++ ++CPLA+CPTAPGI VEGCPVF
Sbjct  704  ISIDHWWGAKGENCPLAACPTAPGIQVEGCPVF  736



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GTL+SG VN  V WW+L S++NIC    L P+SPWTCP  RV +DASVIW
Sbjct  519  PRSMFLVQCIGTLISGTVNTGVAWWLLTSVKNICQDSLLPPDSPWTCPSDRVFYDASVIW  578

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL GA+ PV VW+L K FP++KWIPLIN+PV+    A +
Sbjct  579  GLVGPRRIFGHLGNYSALNWFFLGGAIGPVIVWLLHKAFPKQKWIPLINLPVLLGATAIL  638

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G  FNYFVFKY K WWQ+YNYVLSAALDAG AFM V+L+F L  E 
Sbjct  639  PPATTVNFNCWILVGTTFNYFVFKYHKKWWQRYNYVLSAALDAGLAFMGVILYFTLTMEG  698

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG++ +HCPLASCPTA GI V+GC V
Sbjct  699  KFISWWGNDGEHCPLASCPTAEGIAVDGCVV  729



>ref|XP_007018306.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOY15531.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=752

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 158/216 (73%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNL V WW+L S+++IC  D L  NSPWTCP  RV FDASVIW
Sbjct  537  PRSMFLVQFIGTVLAGTVNLGVAWWLLTSVDSICHKDLLPKNSPWTCPGDRVFFDASVIW  596

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+      M
Sbjct  597  GLVGPKRIFGSLGQYSTLNWFFLGGLLGPVVVWLLHKAFPSQSWIPLINLPVLLGATGNM  656

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+P N  SWI+ G IFN+FVF+Y+K WWQ+YNY+LSAALDAG AFM VLL+FAL  E+
Sbjct  657  PPASPLNYTSWILVGTIFNFFVFRYQKQWWQRYNYILSAALDAGVAFMTVLLYFALGLEN  716

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWGS  D    HC LA CPTA GI V+GCP F
Sbjct  717  KSLNWWGSSPDYIPEHCDLAGCPTAKGISVDGCPTF  752



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  523  PRSMFLVQLIGTVIAGTVNVSVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP + WI  IN+PV+    A M
Sbjct  583  GLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTRTWISQINLPVLLGATAAM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKY KGWWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  643  PPATSVNFNCWIIVGVIFNYFVFKYYKGWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  702

Query  208  KEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG++ ++CPLA+CPTAPGI VEGCPVF
Sbjct  703  ISIDHWWGAKGENCPLAACPTAPGIQVEGCPVF  735



>emb|CDP04528.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 155/213 (73%), Gaps = 34/213 (16%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PR M+ AQLVGTLV+G+ NL + WWML SI NICD +AL P SPWTCP+FR+TFD +V+W
Sbjct  459  PRCMFTAQLVGTLVAGLANLGIGWWMLRSIPNICDVEALHPESPWTCPRFRLTFDTTVVW  518

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP+RLFGP GLYRN+VWLF +GA+LP+PVW+LS++FP+KKWI LINIP+I+ GF   
Sbjct  519  GLIGPERLFGPKGLYRNMVWLFPVGALLPLPVWILSRIFPDKKWISLINIPLITCGF---  575

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
                                           KYNYVLS+ALDAGTAFM VL+FFALQN  
Sbjct  576  -------------------------------KYNYVLSSALDAGTAFMGVLVFFALQNSG  604

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVFK  110
            K LKWWG+E DHCPLASCPTA GIV  GCP FK
Sbjct  605  KNLKWWGTEPDHCPLASCPTAAGIVAAGCPAFK  637



>gb|AFW63465.1| hypothetical protein ZEAMMB73_812110 [Zea mays]
Length=482

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q VGT+V+G VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDASVIW
Sbjct  270  PKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDASVIW  328

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    A M
Sbjct  329  GLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGATAYM  388

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L  ++
Sbjct  389  PPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMQN  448

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  113
            K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  449  KSIDWWGTAGEHCPLARCPTAKGVDLGDGVCPVF  482



>emb|CBI19304.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 160/216 (74%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GTL++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIW
Sbjct  534  PRSMFLVQLIGTLIAGSVNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDASVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+ P+R+FG  G Y  L W FL G + PV VW+L  +FP + WIPL+N+PV+    A M
Sbjct  594  GLVAPQRIFGTLGNYGALNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGATASM  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++F +  E 
Sbjct  654  PPATPVNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVGIEE  713

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  D    HCPLASCPTA G++V+GCP F
Sbjct  714  KNLYWWGANPDIDPEHCPLASCPTAKGVIVDGCPRF  749



>ref|XP_002527347.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF35019.1| Oligopeptide transporter, putative [Ricinus communis]
Length=744

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 158/216 (73%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L SI+ IC    L  NSPWTCP  RV FDASVIW
Sbjct  529  PRSMFLVQFIGTIIAGTINLGVAWWLLDSIDYICQDQLLPSNSPWTCPGSRVFFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+  K FP + WIPLIN+PV+    A M
Sbjct  589  GLVGPKRIFGSLGEYSALNWFFLGGLLGPVVVWLFHKKFPNQTWIPLINLPVLFGATAIM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVL++F L  E+
Sbjct  649  PPATAVNFNSWILVGTIFNFFIFRYRKNWWQRYNYVLSAALDAGVAFMAVLIYFTLGLEN  708

Query  208  KELKWWGS----ELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGS    + +HCPLASCPTA GI+ +GCP+F
Sbjct  709  VNMHWWGSDPNIDPEHCPLASCPTAKGIISDGCPIF  744



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 160/216 (74%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GTL++G VNL V  W+L SI+NIC  + L  NSPWTCP  RV FDASVIW
Sbjct  542  PRSMFLVQLIGTLIAGSVNLFVAMWLLDSIDNICQEELLPENSPWTCPGQRVFFDASVIW  601

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+ P+R+FG  G Y  L W FL G + PV VW+L  +FP + WIPL+N+PV+    A M
Sbjct  602  GLVAPQRIFGTLGNYGALNWFFLGGLLGPVAVWILHILFPSQSWIPLVNLPVLIGATASM  661

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVL++F +  E 
Sbjct  662  PPATPVNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLIYFTVGIEE  721

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWG+  D    HCPLASCPTA G++V+GCP F
Sbjct  722  KNLYWWGANPDIDPEHCPLASCPTAKGVIVDGCPRF  757



>emb|CDP19592.1| unnamed protein product [Coffea canephora]
Length=707

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 160/214 (75%), Gaps = 2/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNL V WW+L ++++IC  D  S NSPWTCP  RV FDASVIW
Sbjct  495  PRSMFLVQFLGTIIAGTVNLGVAWWLLHTVKDICHQDRTS-NSPWTCPGDRVFFDASVIW  553

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  L W FL G + P+ +W+L K FP++ WIPLIN+PVI    A M
Sbjct  554  GLVGPKRIFGPHGNYSALNWFFLGGLLGPLAIWLLHKQFPKQTWIPLINLPVILGATAYM  613

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL F +  E+
Sbjct  614  PPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLHFTVGMEN  673

Query  208  KELKWWGSEL-DHCPLASCPTAPGIVVEGCPVFK  110
            + + WWG+   +HC LA+CPTA GI V+GCP F 
Sbjct  674  RSISWWGNNNPEHCDLATCPTAKGISVDGCPTFH  707



>ref|XP_006856596.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 155/211 (73%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L SIENIC+  AL   SPWTCP  RV FDASVIW
Sbjct  521  PRSMFLVQFIGTVIAGTINLGVAWWLLDSIENICNKAALPKGSPWTCPGDRVFFDASVIW  580

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FGP G Y  L W FL GA+ PV VW+L K FP + WIPLIN+PV+    A M
Sbjct  581  GLVGPKRIFGPLGAYPALNWFFLGGALGPVLVWLLHKAFPSQTWIPLINLPVLLGATAYM  640

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            P AT  N  +W+  G +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F+L  E+
Sbjct  641  PAATALNYNAWVAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFSLSMEN  700

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
                WWG++ +HC  A CPTA G++ +GCPV
Sbjct  701  NSFNWWGTDGEHCDFAVCPTAKGVIAKGCPV  731



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/212 (60%), Positives = 157/212 (74%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GTL++G +N AV WW+L  IENIC  + L PNSPWTCP  RV +DASVIW
Sbjct  513  PRSMFVVQCIGTLINGTLNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDASVIW  572

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP R+FG  G Y  L W FL G + PV VW L ++FP++KWI LIN+PV+    A M
Sbjct  573  GLIGPARIFGRLGNYTALNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGSTAAM  632

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WIV  + FNYF+FK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L  + 
Sbjct  633  PPATTVNFNCWIVVAITFNYFIFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLTMKE  692

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HCPLA+CPTA G++V+GCPV+
Sbjct  693  ISLNWWGAAGEHCPLATCPTAKGVIVDGCPVY  724



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 157/212 (74%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GTL++G +N AV WW+L  IENIC  + L PNSPWTCP  RV +DASVIW
Sbjct  527  PRSMFVVQCIGTLINGTLNTAVAWWLLTGIENICQDELLPPNSPWTCPGDRVFYDASVIW  586

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP R+FG  G Y  L W FL G + PV VW L ++FP++KWI LIN+PV+    A M
Sbjct  587  GLIGPARIFGRLGNYTALNWFFLGGVLGPVLVWGLHRLFPKQKWIKLINLPVLLGSTAAM  646

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WIV  + FNYFVFK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L  + 
Sbjct  647  PPATTVNFNCWIVVAITFNYFVFKFHKVWWQRYNYVLSAALDAGLAFMGVLLYFSLTMKE  706

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              L WWG+  +HCPLA+CPTA G++V+GCPV+
Sbjct  707  ISLNWWGAAGEHCPLATCPTAKGVIVDGCPVY  738



>ref|XP_002306519.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
 gb|EEE93515.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
Length=747

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L S+E+IC  + L+ NSPWTCP  RV FDASVIW
Sbjct  532  PRSMFLVQFIGTIIAGTINLGVAWWLLNSVEHICQDNLLAANSPWTCPSDRVFFDASVIW  591

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL G + P  VW+L K FP + WIPLIN+PV+    A M
Sbjct  592  GLVGPRRIFGSLGEYAALNWFFLGGLLGPFIVWLLHKAFPGQSWIPLINLPVLLGATASM  651

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+F+F+YRK WWQ+YNYVLSAALDAG AFMAVL++  +  E+
Sbjct  652  PPATAINYNSWILVGTIFNFFIFRYRKAWWQRYNYVLSAALDAGVAFMAVLIYVTVGLEN  711

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            K L WWGS+ D    HC LA+CPTA GI V+GCP F
Sbjct  712  KNLYWWGSDPDVFPEHCSLATCPTAKGISVDGCPTF  747



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q VGT+++G VNL V WW+LGSI+NIC  D  S NSPWTCP   V FDASVIW
Sbjct  544  PRSMFLVQFVGTIIAGTVNLTVAWWLLGSIDNICHQDKFS-NSPWTCPGDHVFFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+ PKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  603  GLVSPKRIFGHLGNYSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATAFM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F +  E 
Sbjct  663  PPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGMED  722

Query  208  KELKWWG-SELDHCPLASCPTAPGIVVEGCPVF  113
            + + WWG S+ +HC LA+CPTA GI + GCP F
Sbjct  723  RSINWWGNSDPEHCDLATCPTAKGITINGCPTF  755



>dbj|BAD08158.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=751

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+V+G VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDASVIW
Sbjct  538  PKSMFLVQFIGTIVAGTVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDASVIW  596

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP R+FGP G Y  L W FLIGA  PV V++  KMFP KKWI L N+PV+    A M
Sbjct  597  GLIGPIRIFGPHGNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGATASM  656

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  657  PPATAVNYNSWLLFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMEN  716

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLA+CPTA G+ +     CPVF
Sbjct  717  RSIDWWGTAGEHCPLATCPTAKGVDLGPTSVCPVF  751



>gb|EEE57620.1| hypothetical protein OsJ_08019 [Oryza sativa Japonica Group]
Length=748

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+V+G VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDASVIW
Sbjct  535  PKSMFLVQFIGTIVAGTVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDASVIW  593

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP R+FGP G Y  L W FLIGA  PV V++  KMFP KKWI L N+PV+    A M
Sbjct  594  GLIGPIRIFGPHGNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLTNLPVLIGATASM  653

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  654  PPATAVNYNSWLLFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMEN  713

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HCPLA+CPTA G+ +     CPVF
Sbjct  714  RSIDWWGTAGEHCPLATCPTAKGVDLGPTSVCPVF  748



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  522  PRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + P+ VW+L K FP K WI  IN+PV+    A M
Sbjct  582  GLVGPKRIFGRLGNYPALNWFFLGGLIGPLLVWLLQKAFPTKTWISQINLPVLLGATAAM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFK+ K WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  642  PPATSVNFNCWIIVGVIFNYFVFKHCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  701

Query  208  KELK-WWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K ++ WWG++ ++CPLASCPTAPGI VEGCPVF
Sbjct  702  KSIEHWWGAKGENCPLASCPTAPGIHVEGCPVF  734



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QLVGT+V+G +N+ + W++L ++ NIC  + L PNSPW CP  RV FDASVIW
Sbjct  543  PRSMFIVQLVGTIVAGTINIGIAWYLLTTVNNICQDELLPPNSPWMCPNDRVFFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL GAV PV VW+L K FP K WI LIN+PV+    A M
Sbjct  603  GLVGPKRIFGDLGNYSALNWCFLGGAVAPVFVWLLHKAFPSKTWIKLINLPVLLGATAAM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN FVF+YRK WWQ+YNYVLSAALDAG AFM V+L+F L  E+
Sbjct  663  PPATTLNFNSWILVGTIFNLFVFRYRKRWWQRYNYVLSAALDAGLAFMGVVLYFCLGVEN  722

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
              + WWGS  ++C LASCPTA G+ V+GCPV
Sbjct  723  VSISWWGSNGEYCDLASCPTAKGVAVDGCPV  753



>gb|EYU21027.1| hypothetical protein MIMGU_mgv1a026700mg [Erythranthe guttata]
Length=735

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QLVGTL++G+VN+AV W++L +IENIC  + L PNS WTCP  RV +DASVIW
Sbjct  524  PRSMFIVQLVGTLIAGLVNIAVAWYLLTNIENICQDELLPPNSQWTCPNDRVFYDASVIW  583

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR FG  G Y  L W FL GAV P  VW+L K  P +KWI  +N+P++    A M
Sbjct  584  GLVGPKRFFGTLGNYNALNWFFLGGAVGPFFVWILHKALPSQKWIKSVNLPILLGATAAM  643

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN FVF+YRK WWQ+YNYVLSAALDAG AFM V L+F L  E 
Sbjct  644  PPATTLNFNSWMLVGTIFNLFVFRYRKAWWQRYNYVLSAALDAGLAFMGVALYFTLGIEE  703

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
              L WWGS+ +HC LA+CPTA G++V+GCPV
Sbjct  704  VTLTWWGSKGEHCDLATCPTARGVIVDGCPV  734



>gb|EEC73829.1| hypothetical protein OsI_08562 [Oryza sativa Indica Group]
Length=757

 Score =   272 bits (695),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+V+G VNL V WW+LGSI +IC  D+L  +SPWTCP  RV FDASVIW
Sbjct  544  PKSMFLVQFIGTIVAGTVNLGVAWWLLGSIHDICQ-DSLPADSPWTCPNDRVFFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GLIGP R+FGP G Y  L W FLIGA  PV V++  KMFP KKWI LIN+PV+    A M
Sbjct  603  GLIGPIRIFGPHGNYSALNWFFLIGAAGPVIVYIFHKMFPNKKWITLINLPVLIGATASM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  663  PPATAVNYNSWLLFGTIFNFFVFRYRKKWWERYNYILSAALDAGVAFMAVLLYFSLSMEN  722

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            + + WWG+  +HC LA+CPTA G+ +     CPVF
Sbjct  723  RSIDWWGTAGEHCALATCPTAKGVDLGPTSVCPVF  757



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  522  PRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    A M
Sbjct  582  GLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKY K WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  642  PPATSVNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  701

Query  208  KELK-WWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG++ ++CPLASCPTAPG++V+GCPVF
Sbjct  702  ISINHWWGAKGENCPLASCPTAPGVLVDGCPVF  734



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   271 bits (693),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  522  PRSMFLVQFIGTVIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  581

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + PV VW+L K FP K WI  IN+PV+    A M
Sbjct  582  GLVGPKRIFGRLGNYPALNWFFLGGLIGPVLVWLLQKAFPTKTWISQINLPVLLGATAAM  641

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G+IFNYFVFKY K WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  642  PPATSVNFNCWIIVGVIFNYFVFKYCKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  701

Query  208  KELK-WWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG++ ++CPLASCPTAPG++V+GCPVF
Sbjct  702  ISINHWWGAKGENCPLASCPTAPGVLVDGCPVF  734



>gb|KDP41519.1| hypothetical protein JCGZ_15926 [Jatropha curcas]
Length=441

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 157/216 (73%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L SI++IC    L  NSPWTCP  +V FDASVIW
Sbjct  226  PRSMFLVQFIGTIIAGTINLGVAWWLLTSIDHICQDTLLPSNSPWTCPSDQVFFDASVIW  285

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL G + PV VWV  K FP + WIPLIN+PV+    A M
Sbjct  286  GLVGPRRIFGSLGEYPALNWCFLGGFLGPVIVWVFHKAFPSQSWIPLINLPVLLGATAMM  345

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+  N  SWI+ G IFN+F+F+YRKGWWQ+YNYVLSAALDAG AFMAVL++  L   +
Sbjct  346  PPASSINYTSWILIGTIFNFFIFRYRKGWWQRYNYVLSAALDAGVAFMAVLIYLTLGLGN  405

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
              + WWG++ D    HCPLASCPTA GI ++GCP F
Sbjct  406  VNIHWWGADPDIDPEHCPLASCPTAKGINIDGCPTF  441



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 160/211 (76%), Gaps = 1/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNLAV  W+L SI NIC  D  S +SPWTCP  RV FDASVIW
Sbjct  533  PRSMFLVQFIGTILAGTVNLAVAHWLLNSITNICVDDPHS-DSPWTCPGDRVFFDASVIW  591

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPKR+FG  G+Y  + W FL GAV PV VWVL K +P++ WI LIN+PV+    A M
Sbjct  592  GLAGPKRIFGTLGIYGAINWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGATASM  651

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+ ++  E+
Sbjct  652  PPATALNYNSWIIVGTIFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGMEN  711

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K + WWG+  +HC LA+CPTA GIVV+GCPV
Sbjct  712  KSVAWWGTNGEHCTLATCPTAKGIVVDGCPV  742



>emb|CDY69955.1| BnaCnng66090D [Brassica napus]
Length=732

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 158/213 (74%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  520  PRSMFLVQFIGTIIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  579

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G V PV VW+L K FP + WI  IN+PV+    A M
Sbjct  580  GLVGPKRIFGSLGNYPALNWFFLGGLVGPVLVWLLQKAFPTRTWISQINLPVLLGATAAM  639

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G++FNYFVFK  K WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  640  PPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  699

Query  208  KEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG+E ++CPLASCPTAPG+ VEGCPVF
Sbjct  700  ISIGHWWGAEGENCPLASCPTAPGVHVEGCPVF  732



>ref|XP_009118291.1| PREDICTED: oligopeptide transporter 2 [Brassica rapa]
Length=732

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 158/213 (74%), Gaps = 1/213 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VN++V W++L S+ENIC  + L PNSPWTCP  RV FDASVIW
Sbjct  520  PRSMFLVQFIGTIIAGTVNISVAWYLLTSVENICQKELLPPNSPWTCPSDRVFFDASVIW  579

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G V PV VW+L K FP + WI  IN+PV+    A M
Sbjct  580  GLVGPKRIFGRLGNYPALNWFFLGGLVGPVLVWLLQKAFPTRTWISQINLPVLLGATAAM  639

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+ G++FNYFVFK  K WWQ+YNYVLSAALDAG AFM VLL+F+L    
Sbjct  640  PPATSVNFNCWIIVGVVFNYFVFKNYKKWWQRYNYVLSAALDAGLAFMGVLLYFSLTMNG  699

Query  208  KEL-KWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              +  WWG+E ++CPLASCPTAPG+ VEGCPVF
Sbjct  700  ISIGHWWGAEGENCPLASCPTAPGVHVEGCPVF  732



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q VGT+++G VNL V WW+L SI+NIC  D  S NSPWTCP   V FDASVIW
Sbjct  544  PRSMFLVQFVGTIIAGTVNLTVAWWLLDSIDNICHQDKFS-NSPWTCPGDHVFFDASVIW  602

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+ PKR+FG  G Y  L W FL G + PV VW+L K FP++ WIPLIN+PV+    A M
Sbjct  603  GLVSPKRIFGHLGNYSALNWFFLGGLLGPVLVWLLHKSFPKQTWIPLINLPVLLGATAMM  662

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F +  E 
Sbjct  663  PPATALNYNSWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFTVGMED  722

Query  208  KELKWWG-SELDHCPLASCPTAPGIVVEGCPVF  113
            + + WWG ++ +HC LA+CPTA GI ++GCP F
Sbjct  723  RSINWWGNTDPEHCDLATCPTAKGISIDGCPTF  755



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 161/213 (76%), Gaps = 2/213 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNL+V WW+L SI+NIC  D  S NSPWTCP   V FDASVIW
Sbjct  542  PRSMFLVQFLGTIIAGTVNLSVAWWLLDSIDNICHQDKFS-NSPWTCPGDHVFFDASVIW  600

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+ PKR+FG  G Y  L W FL G + PV VW+L K+FP++ WIPLIN+PV+    A M
Sbjct  601  GLVSPKRIFGHLGNYSALNWFFLGGMIGPVVVWLLHKLFPKQTWIPLINLPVLLGATAWM  660

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G +FN+FVF+YRK WWQ+YNY+LSAALDAG AFMAVLL+F++  E+
Sbjct  661  PPATALNYNSWILVGTVFNFFVFRYRKKWWQRYNYILSAALDAGVAFMAVLLYFSVGMEN  720

Query  208  KELKWWG-SELDHCPLASCPTAPGIVVEGCPVF  113
            + + WWG ++ +HC LA CPTA GI V+GCP F
Sbjct  721  RSINWWGNNDPEHCDLAYCPTAKGISVDGCPTF  753



>ref|XP_004953568.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Setaria 
italica]
Length=754

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 162/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+V+G VNL   WW+LGSI++IC +D+L P SPWTCP  RV FDASVIW
Sbjct  541  PKSMFLVQFIGTIVAGTVNLGTAWWLLGSIKDIC-SDSLPPESPWTCPSDRVFFDASVIW  599

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FLIGA  PV V+ L +M+P ++WIPLIN+PV+    A M
Sbjct  600  GLVGPRRIFGSAGNYGALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGATASM  659

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+Y+K WW +YNY+LSAALDAG AFM V+L+F+L  E+
Sbjct  660  PPATAVNYNSWLLIGTIFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMEN  719

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            K + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  720  KTIDWWGTAGEHCPLASCPTAKGMDLGPDSVCPVF  754



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNLAV +W+L SI NIC  D  S +SPWTCP  RV FDASVIW
Sbjct  537  PRSMFLVQFIGTILAGTVNLAVAYWLLNSITNICVDDPQS-DSPWTCPSDRVFFDASVIW  595

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPKR+FG  G+Y  + W FL GAV PV VWVL K +P++ WI LIN+PV+      M
Sbjct  596  GLAGPKRIFGTLGIYGAMNWFFLGGAVGPVIVWVLHKAYPKQNWIRLINLPVLLGATGSM  655

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YNYVLSAALDAG AFMAVLL+ ++  E+
Sbjct  656  PPATALNYNSWIIVGTIFNFFVFRYRKKWWQRYNYVLSAALDAGLAFMAVLLYLSVGMEN  715

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
              + WWG+  +HC LA+CPTA GIVV+GCPV
Sbjct  716  ISVAWWGTNGEHCDLATCPTAKGIVVDGCPV  746



>gb|EMS53301.1| Oligopeptide transporter 4 [Triticum urartu]
Length=636

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 153/208 (74%), Gaps = 3/208 (1%)
 Frame = -1

Query  727  QLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPKR  548
            Q VGT+V+G VNL V WW+LGS+ENIC    L PNSPWTCP  RV FDASVIWGL+GP R
Sbjct  429  QFVGTVVAGTVNLIVGWWLLGSVENICQDQLLPPNSPWTCPNDRVFFDASVIWGLVGPNR  488

Query  547  LFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPTN  368
            +FG  G Y  L W FLIGA  PV V++L + FP  KWI LINIPV++   A MPPAT  N
Sbjct  489  IFGSNGNYIALNWFFLIGAAGPVIVYILHRTFPTHKWILLINIPVLTGATALMPPATTVN  548

Query  367  IGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWWG  188
              SW++ G+IFN+FVF+YRK WWQ+YNY+LSA LDAG AFM VLL+F L  E++ + WWG
Sbjct  549  FNSWLLYGIIFNFFVFRYRKKWWQRYNYILSAGLDAGAAFMGVLLYFTLTMENRTINWWG  608

Query  187  SELDHCPLASCPTAPGIVV---EGCPVF  113
            +  +HCPLASCPTA G+ +     CPVF
Sbjct  609  TGGEHCPLASCPTAKGVDLGPDSVCPVF  636



>ref|XP_008466652.1| PREDICTED: oligopeptide transporter 4-like [Cucumis melo]
Length=743

 Score =   268 bits (686),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 159/215 (74%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G +N++V WW+L S++ IC   A S NSPWTCP  RV FDASVIW
Sbjct  530  PRSMFLVQLIGTVIAGTINVSVAWWLLSSVDQICHQSA-SSNSPWTCPGDRVFFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + P  V++L ++FP + WIPLIN+PV+    A M
Sbjct  589  GLVGPKRIFGSQGNYPALNWFFLAGILGPSLVYLLHRIFPNQSWIPLINLPVLFGATASM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA P N  SWI+ G IFNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ F     +
Sbjct  649  PPAAPINYNSWILVGTIFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFTFGVRN  708

Query  208  KELKWWGS---ELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGS   + DHC LASCPTA G+VV+GCPVF
Sbjct  709  VHMNWWGSNPIDTDHCLLASCPTAKGVVVDGCPVF  743



>ref|XP_004953567.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Setaria 
italica]
Length=797

 Score =   270 bits (689),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 162/215 (75%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q +GT+V+G VNL   WW+LGSI++IC +D+L P SPWTCP  RV FDASVIW
Sbjct  584  PKSMFLVQFIGTIVAGTVNLGTAWWLLGSIKDIC-SDSLPPESPWTCPSDRVFFDASVIW  642

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FLIGA  PV V+ L +M+P ++WIPLIN+PV+    A M
Sbjct  643  GLVGPRRIFGSAGNYGALNWFFLIGAAGPVIVYALHRMYPNQRWIPLINLPVLLGATASM  702

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+Y+K WW +YNY+LSAALDAG AFM V+L+F+L  E+
Sbjct  703  PPATAVNYNSWLLIGTIFNFFVFRYQKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMEN  762

Query  208  KELKWWGSELDHCPLASCPTAPGIVV---EGCPVF  113
            K + WWG+  +HCPLASCPTA G+ +     CPVF
Sbjct  763  KTIDWWGTAGEHCPLASCPTAKGMDLGPDSVCPVF  797



>ref|XP_008646108.1| PREDICTED: oligopeptide transporter 4-like [Zea mays]
 gb|AFW72904.1| hypothetical protein ZEAMMB73_956147 [Zea mays]
Length=758

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 159/214 (74%), Gaps = 3/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q VGT+V+G +N+   WW+LGSI  IC +D+L P+SPWTCP  RV FDASVIW
Sbjct  546  PKSMFLVQFVGTIVAGTINIGTAWWLLGSIHGIC-SDSLPPDSPWTCPNDRVFFDASVIW  604

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP R+FGPGG Y  + W FLIGA  PV V+ L ++FP + WIPLIN+PV+    A M
Sbjct  605  GLVGPMRIFGPGGNYGAVNWFFLIGAAGPVIVYALHRVFPSQSWIPLINLPVLFGATASM  664

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G IFN+FVF+YRK WW +YNY+LSA LDAG AFM VLL+F+L  ++
Sbjct  665  PPATAVNYNSWLLVGTIFNFFVFRYRKRWWTRYNYILSAGLDAGVAFMGVLLYFSLTMQN  724

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  113
            K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  725  KSIDWWGTAGEHCPLAKCPTAKGVDLGDGVCPVF  758



>ref|XP_008677393.1| PREDICTED: oligopeptide transporter 4 isoform X1 [Zea mays]
 gb|ACN26883.1| unknown [Zea mays]
 gb|AFW63464.1| oligopeptide transporter 4 [Zea mays]
Length=760

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ Q VGT+V+G VN+   WW+LGSI+ IC +D+L P+SPWTCP  RV FDASVIW
Sbjct  548  PKSMFLVQFVGTIVAGTVNIGTAWWLLGSIDGIC-SDSLPPDSPWTCPNDRVFFDASVIW  606

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W FLIGA  PV V+ L + FP ++WIPLIN+PV+    A M
Sbjct  607  GLVGPRRIFGPDGNYGALNWFFLIGAAGPVIVYALHRTFPGQRWIPLINLPVLFGATAYM  666

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G +FN+FVF+YRK WW +YNY+LSAALDAG AFM V+L+F+L  ++
Sbjct  667  PPATAVNYNSWLLVGTVFNFFVFRYRKKWWTRYNYILSAALDAGVAFMGVVLYFSLTMQN  726

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEG--CPVF  113
            K + WWG+  +HCPLA CPTA G+ +    CPVF
Sbjct  727  KSIDWWGTAGEHCPLARCPTAKGVDLGDGVCPVF  760



>ref|XP_006847459.1| hypothetical protein AMTR_s03508p00001080 [Amborella trichopoda]
 gb|ERN09040.1| hypothetical protein AMTR_s03508p00001080 [Amborella trichopoda]
Length=368

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 147/205 (72%), Gaps = 0/205 (0%)
 Frame = -1

Query  730  AQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIWGLIGPK  551
             Q +GT+++G +NL V WW+L SIENIC+  AL   SPWTCP  RV FDASVIWGL+GPK
Sbjct  163  GQFIGTVIAGTINLGVAWWLLESIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPK  222

Query  550  RLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGMPPATPT  371
            R+FGP G Y  L W FL G + PV VW+L K FP + WIPLIN+PV+      MPPAT  
Sbjct  223  RIFGPLGAYPALNWFFLGGVLGPVLVWLLHKAFPSQTWIPLINLPVLLGATNYMPPATAL  282

Query  370  NIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEHKELKWW  191
            N  +W+  G +FN+FVF+YRK WWQ+YNYVLSA LDAG AFM VLL+F L  E+    WW
Sbjct  283  NYNAWVAVGTVFNFFVFRYRKSWWQRYNYVLSAGLDAGVAFMGVLLYFLLSMENNSFNWW  342

Query  190  GSELDHCPLASCPTAPGIVVEGCPV  116
            G++ +HC  A CPTA G++ +GCPV
Sbjct  343  GTDGEHCDFAVCPTAKGVIAKGCPV  367



>ref|XP_006472404.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=755

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 156/216 (72%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L S+E+IC    L  NSPWTCP  RV FDASVIW
Sbjct  539  PRSMFLVQFIGTIIAGTINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDASVIW  598

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W FL G + P  VW+L K FP + WIPLIN+PV+    A M
Sbjct  599  GLVGPRRIFGSQGNYGALNWFFLGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGATAYM  658

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VLL+ +L  E 
Sbjct  659  PPATALNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLGLEG  718

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
              L WWGS  D    HC LA+CPTA G+ V+GCPVF
Sbjct  719  VNLHWWGSNPDIDPEHCDLATCPTAKGVAVDGCPVF  754



>ref|XP_004136414.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 gb|KGN60283.1| hypothetical protein Csa_3G893330 [Cucumis sativus]
Length=743

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 158/215 (73%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G +N++V WW+L S++ IC     S NSPWTCP  RV FDASVIW
Sbjct  530  PRSMFLVQLIGTVIAGTINVSVAWWLLSSVDQICHQSP-SSNSPWTCPGDRVFFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + P  V++L ++FP + WIPLIN+PV+    A M
Sbjct  589  GLVGPKRIFGSQGNYPALNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGATASM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI+ G +FNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ FA     
Sbjct  649  PPATPINYNSWILVGTVFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFGVRD  708

Query  208  KELKWWGS---ELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGS   + DHC LASCPTA G+V +GCPVF
Sbjct  709  VHMNWWGSNPIDTDHCLLASCPTAKGVVADGCPVF  743



>ref|XP_004164894.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=743

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 158/215 (73%), Gaps = 4/215 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G +N++V WW+L S++ IC     S NSPWTCP  RV FDASVIW
Sbjct  530  PRSMFLVQLIGTVIAGTINVSVAWWLLSSVDQICHQSP-SSNSPWTCPGDRVFFDASVIW  588

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL G + P  V++L ++FP + WIPLIN+PV+    A M
Sbjct  589  GLVGPKRIFGSQGNYPALNWFFLAGLLGPSLVYLLHRIFPNQSWIPLINLPVLFGATASM  648

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPATP N  SWI+ G +FNYF+F+YRK WWQ+YNY+LSAALDAG AFMA+L+ FA     
Sbjct  649  PPATPINYNSWILVGTVFNYFLFRYRKKWWQRYNYILSAALDAGVAFMALLIHFAFGVRD  708

Query  208  KELKWWGS---ELDHCPLASCPTAPGIVVEGCPVF  113
              + WWGS   + DHC LASCPTA G+V +GCPVF
Sbjct  709  VHMNWWGSNPIDTDHCLLASCPTAKGVVADGCPVF  743



>ref|XP_006433763.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
 gb|ESR47003.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
Length=728

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 156/216 (72%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G +NL V WW+L S+E+IC    L  NSPWTCP  RV FDASVIW
Sbjct  512  PRSMFLVQFIGTIIAGTINLIVAWWLLNSVEHICQPGLLPKNSPWTCPNDRVFFDASVIW  571

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y  L W F+ G + P  VW+L K FP + WIPLIN+PV+    A M
Sbjct  572  GLVGPRRIFGSQGNYGALNWFFVGGLLGPCAVWLLHKKFPNQSWIPLINLPVLLGATAYM  631

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  +WI+ G IFN+FVF+YRK WWQ+YNY+LSAALDAGTAFM VLL+ +L  E 
Sbjct  632  PPATALNYNAWILVGTIFNFFVFRYRKKWWQRYNYILSAALDAGTAFMTVLLYVSLGLEG  691

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
              L WWGS  D    HC LA+CPTA G+ V+GCPVF
Sbjct  692  VNLHWWGSNPDIDPEHCDLATCPTAKGVAVDGCPVF  727



>dbj|BAD94325.1| hypothetical protein [Arabidopsis thaliana]
Length=308

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 155/214 (72%), Gaps = 2/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++AQ+ GTLV+ VV     WW++  I ++CDT  L  +S WTCP  RV FDASVIW
Sbjct  95   PRSMFMAQVAGTLVAVVVYTGTAWWLMEEIPHLCDTSLLPSDSQWTCPMDRVFFDASVIW  154

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FG  G Y N+ W FL+GA+ P+ VW+ +KMFP + WI  I+IPV+    A M
Sbjct  155  GLVGPRRVFGDLGEYSNVNWFFLVGAIAPLLVWLATKMFPAQTWIAKIHIPVLVGATAMM  214

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++   IF +F+FKYR+ WW KYNYVLS  LDAG+AFM +LLF AL  + 
Sbjct  215  PPATAVNFTSWLIVAFIFGHFIFKYRRVWWTKYNYVLSGGLDAGSAFMTILLFLALGRKG  274

Query  208  KELKWWGS--ELDHCPLASCPTAPGIVVEGCPVF  113
             E++WWG+  + D CPLASCPTA G+VV+GCPVF
Sbjct  275  IEVQWWGNSGDRDTCPLASCPTAKGVVVKGCPVF  308



>ref|XP_007137663.1| hypothetical protein PHAVU_009G145300g [Phaseolus vulgaris]
 gb|ESW09657.1| hypothetical protein PHAVU_009G145300g [Phaseolus vulgaris]
Length=733

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 163/212 (77%), Gaps = 1/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q++GTL++G V++ V WW+LGSI+NIC  D L  NSPWTCP   V FDASVIW
Sbjct  523  PRSMFIVQVIGTLIAGSVDVGVAWWLLGSIKNICKQDLLPENSPWTCPGDHVFFDASVIW  582

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y+ L W FLIGAV PV +W L K+FP++ WI LI++PV+    A M
Sbjct  583  GLVGPKRIFGTLGKYQKLNWFFLIGAVGPVVIWALRKLFPKQHWISLIHLPVLLGATANM  642

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPA+  N  SWIV G IFNYFVFKYRK WWQ+YNYVL+AALDAG AFM VLL+FA+  E 
Sbjct  643  PPASTVNFNSWIVVGTIFNYFVFKYRKNWWQRYNYVLAAALDAGLAFMTVLLYFAVTMEG  702

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
            K ++WWG+  +HCPLA CPTA G+V + CP+F
Sbjct  703  KGIEWWGTG-EHCPLAKCPTAKGVVADACPLF  733



>ref|XP_010064240.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=748

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 161/216 (75%), Gaps = 4/216 (2%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+V+G VNL V WW+L SI NIC  + L PNSPWTCP  RV FDASVIW
Sbjct  533  PRSMFLVQFIGTIVAGTVNLGVAWWLLDSITNICHKNVLPPNSPWTCPSDRVFFDASVIW  592

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G+Y+ L W FL G + PV VW+L K F ++ WIPLIN+PV+    A M
Sbjct  593  GLVGPKRIFGSEGVYKALNWFFLGGLLGPVAVWLLHKSFRKQSWIPLINLPVLLGATAAM  652

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWIV G IFN+F+F+YRK WWQ+YNY+LSAALDAG AFMAV+++FA   E 
Sbjct  653  PPATALNYNSWIVVGTIFNFFIFRYRKRWWQRYNYILSAALDAGVAFMAVVIYFAFGIED  712

Query  208  KELKWWGSELD----HCPLASCPTAPGIVVEGCPVF  113
            + L WWGS  D    HC LA+CPTA GI ++GCPVF
Sbjct  713  RNLHWWGSNPDVDPEHCGLATCPTAKGISIDGCPVF  748



>gb|EAY75055.1| hypothetical protein OsI_02950 [Oryza sativa Indica Group]
Length=755

 Score =   266 bits (681),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 160/214 (75%), Gaps = 3/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ QLVGT+V+  VNL V +W+LGSI NIC    L  +SPWTCP  RV FDASVIW
Sbjct  540  PKSMFLVQLVGTVVASTVNLVVAYWLLGSIPNICQDALLPADSPWTCPNDRVFFDASVIW  599

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y    W FL GAV PV V++L + FP K WIP+IN+PV+    + M
Sbjct  600  GLVGPRRIFGPLGNYGAFNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYM  659

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G+IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  660  PPATAVNYNSWLIIGIIFNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMEN  719

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEG---CPV  116
            + + WWG+  +HCPLASCPTA GI +     CPV
Sbjct  720  RSISWWGTAGEHCPLASCPTAKGINLGADSVCPV  753



>dbj|BAB89477.1| isp4 protein-like [Oryza sativa Japonica Group]
 gb|EAZ12783.1| hypothetical protein OsJ_02700 [Oryza sativa Japonica Group]
Length=755

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            P+SM++ +LVGT+V+  VNL V +W+LGSI NIC    L  +SPWTCP  RV FDASVIW
Sbjct  540  PKSMFLVKLVGTVVASTVNLVVAYWLLGSIPNICQDALLPADSPWTCPNDRVFFDASVIW  599

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GP+R+FGP G Y  L W FL GAV PV V++L + FP K WIP+IN+PV+    + M
Sbjct  600  GLVGPRRIFGPLGNYGALNWFFLAGAVGPVIVYLLHRAFPSKTWIPMINLPVLIGATSYM  659

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SW++ G+IFN+FVF+YRK WW++YNY+LSAALDAG AFMAVLL+F+L  E+
Sbjct  660  PPATAVNYNSWLIIGIIFNFFVFRYRKLWWKRYNYILSAALDAGVAFMAVLLYFSLSMEN  719

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEG---CPV  116
            + + WWG+  +HCPLASCPTA GI +     CPV
Sbjct  720  RSISWWGTAGEHCPLASCPTAKGINLGADSVCPV  753



>ref|XP_004288877.2| PREDICTED: oligopeptide transporter 2-like [Fragaria vesca subsp. 
vesca]
Length=782

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 152/212 (72%), Gaps = 0/212 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ QL+GT+++G VN+ V WW+L ++ENIC  + L PNSPWTCP  RV FDASV+W
Sbjct  571  PRSMFIVQLIGTVIAGTVNIGVAWWLLSTMENICQHELLPPNSPWTCPNDRVFFDASVLW  630

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+FG  G Y  L W FL+GA  P+ VW+L + FP  KWI LIN+ V+      M
Sbjct  631  GLVGPKRMFGSLGNYPALNWFFLLGAFGPLLVWLLHRAFPSHKWIQLINLLVLLGATTNM  690

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   WI+TG IF YFVF+YRK  W +YNYVLSAALD G AFMAVLL+F L    
Sbjct  691  PPATAVNYNCWIITGTIFGYFVFRYRKARWLRYNYVLSAALDVGVAFMAVLLYFTLTMNE  750

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPVF  113
              + WWG+  +HC L +CPT  GIVV+GCPV+
Sbjct  751  TSVSWWGANGEHCELVTCPTTKGIVVDGCPVY  782



>gb|KHG27447.1| Oligopeptide transporter 2 -like protein [Gossypium arboreum]
Length=237

 Score =   252 bits (643),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 143/195 (73%), Gaps = 0/195 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM+V Q +GT+++G VNLAV WW+L ++EN+C    L PNSPWTCP  RV FDASVIW
Sbjct  43   PRSMFVVQSIGTVIAGTVNLAVAWWLLTTVENVCQDHLLPPNSPWTCPCDRVFFDASVIW  102

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL+GPKR+F P G Y  L W FL GA+ PV VW+  K FP +KWIPL N+PV+    A M
Sbjct  103  GLVGPKRIFSPLGNYSALNWFFLGGALGPVVVWLFHKAFPNQKWIPLTNLPVLLGATAAM  162

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N   W++ G IFNY+VFKYRKGWWQ+YNYVLSAALDAG AFM VLL+F L    
Sbjct  163  PPATSLNFNCWLIIGFIFNYYVFKYRKGWWQRYNYVLSAALDAGLAFMGVLLYFTLTMHG  222

Query  208  KELKWWGSELDHCPL  164
              + WWGS+ +HC L
Sbjct  223  ISISWWGSDGEHCDL  237



>ref|XP_008348885.1| PREDICTED: oligopeptide transporter 4-like [Malus domestica]
Length=253

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -1

Query  748  PRSMYVAQLVGTLVSGVVNLAVCWWMLGSIENICDTDALSPNSPWTCPKFRVTFDASVIW  569
            PRSM++ Q +GT+++G VNLAV  W+L SI+N+C  D  S +SPWTCP  RV FDAS IW
Sbjct  43   PRSMFLVQFIGTILAGTVNLAVAHWLLNSIKNMCVDDPHS-DSPWTCPNDRVFFDASXIW  101

Query  568  GLIGPKRLFGPGGLYRNLVWLFLIGAVLPVPVWVLSKMFPEKKWIPLINIPVISYGFAGM  389
            GL GPK +FG  G Y  + W FL GAV PV VWV  K +P++ WI LIN+PV+      M
Sbjct  102  GLAGPKXIFGSLGNYGAMNWFFLGGAVGPVIVWVXHKAYPKQHWIRLINLPVLLGATGLM  161

Query  388  PPATPTNIGSWIVTGLIFNYFVFKYRKGWWQKYNYVLSAALDAGTAFMAVLLFFALQNEH  209
            PPAT  N  SWI+ G IFN+FVF+YRK WWQ+YN +LSAA+DAG AFM VLL+ ++  E+
Sbjct  162  PPATALNYNSWIIVGTIFNFFVFRYRKNWWQRYNXILSAAMDAGVAFMXVLLYLSVGMEN  221

Query  208  KELKWWGSELDHCPLASCPTAPGIVVEGCPV  116
            K L WWG+  +HC LA+CPTA GI V+GCPV
Sbjct  222  KSLTWWGANGEHCDLATCPTAKGIAVDGCPV  252



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630