BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045K13

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617474.1|  PREDICTED: transcription factor ILR3-like          247   9e-78   Nicotiana tomentosiformis
ref|XP_009772342.1|  PREDICTED: transcription factor ILR3-like          244   5e-77   Nicotiana sylvestris
ref|XP_004232754.1|  PREDICTED: transcription factor ILR3               235   4e-73   Solanum lycopersicum
ref|XP_006365882.1|  PREDICTED: transcription factor ILR3-like          234   8e-73   Solanum tuberosum [potatoes]
ref|XP_008224874.1|  PREDICTED: transcription factor ILR3-like          214   4e-65   Prunus mume [ume]
emb|CDO99702.1|  unnamed protein product                                214   7e-65   Coffea canephora [robusta coffee]
ref|XP_007211937.1|  hypothetical protein PRUPE_ppa010730mg             211   8e-64   Prunus persica
gb|KDP20820.1|  hypothetical protein JCGZ_21291                         205   2e-61   Jatropha curcas
ref|XP_002273184.2|  PREDICTED: transcription factor ILR3-like is...    204   6e-61   Vitis vinifera
ref|XP_010267809.1|  PREDICTED: transcription factor ILR3               200   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_002316706.2|  hypothetical protein POPTR_0011s03360g             200   2e-59   
ref|XP_009366840.1|  PREDICTED: transcription factor ILR3-like          199   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_007025918.1|  DNA binding protein, putative isoform 2            198   5e-59   
ref|XP_002274829.2|  PREDICTED: transcription factor ILR3-like is...    197   2e-58   Vitis vinifera
ref|XP_010247015.1|  PREDICTED: transcription factor ILR3-like          194   2e-57   Nelumbo nucifera [Indian lotus]
ref|XP_002518568.1|  DNA binding protein, putative                      194   3e-57   Ricinus communis
ref|XP_008441610.1|  PREDICTED: transcription factor ILR3-like          194   3e-57   Cucumis melo [Oriental melon]
ref|XP_004145091.1|  PREDICTED: transcription factor ILR3-like          193   9e-57   Cucumis sativus [cucumbers]
ref|XP_010999542.1|  PREDICTED: transcription factor ILR3-like          193   1e-56   Populus euphratica
ref|XP_004309656.1|  PREDICTED: transcription factor ILR3-like          192   2e-56   Fragaria vesca subsp. vesca
ref|XP_010647172.1|  PREDICTED: transcription factor ILR3-like is...    191   2e-56   
ref|XP_010647170.1|  PREDICTED: transcription factor ILR3-like is...    191   3e-56   Vitis vinifera
ref|XP_010657331.1|  PREDICTED: transcription factor ILR3-like is...    192   4e-56   Vitis vinifera
ref|XP_006449136.1|  hypothetical protein CICLE_v10016511mg             189   4e-55   Citrus clementina [clementine]
gb|KJB57696.1|  hypothetical protein B456_009G176000                    189   4e-55   Gossypium raimondii
ref|XP_006467957.1|  PREDICTED: transcription factor ILR3-like          187   9e-55   Citrus sinensis [apfelsine]
ref|XP_007025917.1|  Basic helix-loop-helix DNA-binding superfami...    189   1e-54   
gb|EYU19205.1|  hypothetical protein MIMGU_mgv1a012900mg                187   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_010647171.1|  PREDICTED: transcription factor ILR3-like is...    186   3e-54   Vitis vinifera
emb|CBI28976.3|  unnamed protein product                                186   5e-54   Vitis vinifera
gb|KHG15485.1|  Transcription factor ILR3 -like protein                 186   1e-53   Gossypium arboreum [tree cotton]
emb|CDP05806.1|  unnamed protein product                                184   4e-53   Coffea canephora [robusta coffee]
ref|XP_008371203.1|  PREDICTED: transcription factor ILR3-like          179   2e-52   
gb|AEJ88330.1|  putative MYC protein                                    181   2e-52   Tamarix hispida
ref|XP_010035617.1|  PREDICTED: transcription factor ILR3-like          180   1e-51   Eucalyptus grandis [rose gum]
ref|XP_011097928.1|  PREDICTED: transcription factor ILR3-like          179   3e-51   Sesamum indicum [beniseed]
ref|XP_011003406.1|  PREDICTED: transcription factor ILR3-like          179   3e-51   Populus euphratica
ref|XP_006360579.1|  PREDICTED: transcription factor ILR3-like is...    179   4e-51   Solanum tuberosum [potatoes]
ref|XP_002282727.1|  PREDICTED: transcription factor ILR3               178   6e-51   Vitis vinifera
ref|XP_007043353.1|  Basic helix-loop-helix DNA-binding superfami...    177   1e-50   
ref|XP_002522828.1|  DNA binding protein, putative                      177   2e-50   Ricinus communis
ref|XP_009764628.1|  PREDICTED: transcription factor ILR3-like          177   2e-50   Nicotiana sylvestris
ref|XP_006352486.1|  PREDICTED: transcription factor ILR3-like          176   2e-50   Solanum tuberosum [potatoes]
ref|XP_009612610.1|  PREDICTED: transcription factor ILR3-like          176   3e-50   Nicotiana tomentosiformis
ref|XP_002304984.1|  hypothetical protein POPTR_0004s03190g             176   4e-50   
ref|XP_010931430.1|  PREDICTED: transcription factor ILR3-like          176   4e-50   
ref|XP_009355579.1|  PREDICTED: transcription factor ILR3-like          175   6e-50   Pyrus x bretschneideri [bai li]
ref|XP_010323806.1|  PREDICTED: transcription factor ILR3 isoform X1    176   6e-50   Solanum lycopersicum
ref|XP_008365724.1|  PREDICTED: transcription factor ILR3               175   7e-50   Malus domestica [apple tree]
ref|XP_011095314.1|  PREDICTED: transcription factor ILR3-like          174   1e-49   Sesamum indicum [beniseed]
ref|XP_009358090.1|  PREDICTED: transcription factor ILR3-like          174   2e-49   Pyrus x bretschneideri [bai li]
ref|XP_006360098.1|  PREDICTED: transcription factor ILR3-like          174   2e-49   Solanum tuberosum [potatoes]
ref|XP_004244159.1|  PREDICTED: transcription factor ILR3               172   5e-49   Solanum lycopersicum
gb|KDO59874.1|  hypothetical protein CISIN_1g026646mg                   172   7e-49   Citrus sinensis [apfelsine]
ref|XP_006447466.1|  hypothetical protein CICLE_v10016381mg             172   8e-49   Citrus clementina [clementine]
gb|EYU33597.1|  hypothetical protein MIMGU_mgv1a013092mg                171   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_007211667.1|  hypothetical protein PRUPE_ppa009077mg             173   4e-48   Prunus persica
ref|XP_004505433.1|  PREDICTED: transcription factor ILR3-like          171   4e-48   Cicer arietinum [garbanzo]
ref|XP_010909862.1|  PREDICTED: transcription factor ILR3-like          171   5e-48   Elaeis guineensis
ref|XP_004248337.1|  PREDICTED: transcription factor ILR3-like          169   1e-47   Solanum lycopersicum
ref|XP_009383663.1|  PREDICTED: transcription factor ILR3-like          169   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW70120.1|  hypothetical protein EUGRSUZ_F03420                     168   3e-47   Eucalyptus grandis [rose gum]
ref|XP_007132981.1|  hypothetical protein PHAVU_011G141300g             167   8e-47   Phaseolus vulgaris [French bean]
ref|XP_009791575.1|  PREDICTED: transcription factor ILR3-like          167   9e-47   Nicotiana sylvestris
ref|XP_003607701.1|  Transcription factor ILR3                          166   2e-46   Medicago truncatula
gb|ADL36593.1|  BHLH domain class transcription factor                  166   3e-46   Malus domestica [apple tree]
ref|XP_007149692.1|  hypothetical protein PHAVU_005G091000g             166   3e-46   Phaseolus vulgaris [French bean]
ref|XP_010062960.1|  PREDICTED: transcription factor ILR3-like          165   4e-46   Eucalyptus grandis [rose gum]
ref|XP_008349949.1|  PREDICTED: transcription factor ILR3-like          165   5e-46   
ref|XP_008793739.1|  PREDICTED: transcription factor ILR3               165   6e-46   Phoenix dactylifera
ref|XP_009792846.1|  PREDICTED: transcription factor ILR3-like          165   6e-46   Nicotiana sylvestris
ref|XP_009630429.1|  PREDICTED: transcription factor ILR3-like          165   7e-46   Nicotiana tomentosiformis
ref|XP_010323807.1|  PREDICTED: transcription factor ILR3 isoform X2    164   1e-45   
ref|XP_009393337.1|  PREDICTED: transcription factor ILR3-like          164   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK48825.1|  unknown                                                 164   2e-45   Lotus japonicus
ref|XP_008800495.1|  PREDICTED: transcription factor ILR3-like          162   6e-45   Phoenix dactylifera
gb|KDP39043.1|  hypothetical protein JCGZ_00800                         162   8e-45   Jatropha curcas
ref|XP_006447467.1|  hypothetical protein CICLE_v10016381mg             162   1e-44   
ref|XP_003540036.1|  PREDICTED: transcription factor ILR3               161   1e-44   
ref|XP_003527314.1|  PREDICTED: transcription factor ILR3-like is...    160   2e-44   Glycine max [soybeans]
ref|XP_008244399.1|  PREDICTED: transcription factor ILR3               162   3e-44   
ref|XP_009597422.1|  PREDICTED: transcription factor ILR3-like          160   4e-44   Nicotiana tomentosiformis
ref|XP_003596613.1|  Transcription factor ILR3                          159   7e-44   Medicago truncatula
gb|ACU23766.1|  unknown                                                 159   9e-44   Glycine max [soybeans]
ref|XP_010923988.1|  PREDICTED: transcription factor ILR3-like          159   1e-43   Elaeis guineensis
ref|XP_008455829.1|  PREDICTED: transcription factor ILR3-like          158   2e-43   Cucumis melo [Oriental melon]
ref|XP_010092311.1|  hypothetical protein L484_021173                   158   3e-43   
ref|XP_008454561.1|  PREDICTED: transcription factor ILR3-like          158   3e-43   Cucumis melo [Oriental melon]
ref|XP_003607702.1|  Transcription factor ILR3                          159   3e-43   
ref|XP_004151873.1|  PREDICTED: transcription factor ILR3-like          157   8e-43   Cucumis sativus [cucumbers]
gb|AEI83428.1|  bHLH transcription factor 1                             157   8e-43   Camellia sinensis [black tea]
gb|KGN57970.1|  hypothetical protein Csa_3G416140                       156   1e-42   Cucumis sativus [cucumbers]
gb|KGN57965.1|  hypothetical protein Csa_3G415100                       156   1e-42   Cucumis sativus [cucumbers]
gb|KHG29871.1|  Transcription factor ILR3 -like protein                 156   1e-42   Gossypium arboreum [tree cotton]
gb|AES89899.2|  BHLH domain class transcription factor                  155   2e-42   Medicago truncatula
ref|XP_004151959.1|  PREDICTED: transcription factor ILR3-like          156   2e-42   
ref|XP_003547112.1|  PREDICTED: transcription factor ILR3-like          155   2e-42   Glycine max [soybeans]
ref|XP_006475303.1|  PREDICTED: transcription factor ILR3-like          155   3e-42   Citrus sinensis [apfelsine]
gb|KJB12415.1|  hypothetical protein B456_002G016500                    154   5e-42   Gossypium raimondii
gb|KJB81834.1|  hypothetical protein B456_013G164100                    155   5e-42   Gossypium raimondii
ref|XP_004151962.1|  PREDICTED: transcription factor ILR3-like          154   6e-42   
ref|XP_004173321.1|  PREDICTED: transcription factor ILR3-like          154   7e-42   
ref|XP_008454558.1|  PREDICTED: transcription factor ILR3-like is...    154   1e-41   Cucumis melo [Oriental melon]
ref|XP_010443048.1|  PREDICTED: transcription factor ILR3               153   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010482878.1|  PREDICTED: transcription factor ILR3-like          153   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011096123.1|  PREDICTED: transcription factor ILR3-like          152   2e-41   
ref|XP_004294336.1|  PREDICTED: transcription factor ILR3-like          153   2e-41   Fragaria vesca subsp. vesca
ref|XP_004156771.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    152   3e-41   
ref|XP_006401546.1|  hypothetical protein EUTSA_v10014564mg             152   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_009127072.1|  PREDICTED: transcription factor ILR3               152   4e-41   Brassica rapa
ref|XP_010694263.1|  PREDICTED: transcription factor ILR3               152   5e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004487616.1|  PREDICTED: transcription factor ILR3-like          152   6e-41   Cicer arietinum [garbanzo]
ref|XP_007148298.1|  hypothetical protein PHAVU_006G196600g             151   7e-41   Phaseolus vulgaris [French bean]
ref|XP_010448513.1|  PREDICTED: transcription factor ILR3-like          152   8e-41   Camelina sativa [gold-of-pleasure]
ref|XP_007149945.1|  hypothetical protein PHAVU_005G112500g             151   8e-41   Phaseolus vulgaris [French bean]
ref|NP_175518.1|  transcription factor bHLH115                          151   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006452147.1|  hypothetical protein CICLE_v10009354mg             151   1e-40   Citrus clementina [clementine]
ref|XP_003543375.1|  PREDICTED: transcription factor ILR3-like is...    151   1e-40   Glycine max [soybeans]
ref|XP_002891614.1|  basic helix-loop-helix family protein              150   2e-40   
gb|KJB45598.1|  hypothetical protein B456_007G314800                    150   2e-40   Gossypium raimondii
ref|XP_006393084.1|  hypothetical protein EUTSA_v10011752mg             150   2e-40   Eutrema salsugineum [saltwater cress]
emb|CDY41004.1|  BnaA02g27940D                                          150   2e-40   Brassica napus [oilseed rape]
gb|KJB81836.1|  hypothetical protein B456_013G164100                    150   2e-40   Gossypium raimondii
emb|CDY28758.1|  BnaA02g09500D                                          150   3e-40   Brassica napus [oilseed rape]
ref|XP_008776472.1|  PREDICTED: transcription factor ILR3-like          149   5e-40   Phoenix dactylifera
ref|XP_010500676.1|  PREDICTED: transcription factor bHLH115-like       149   6e-40   Camelina sativa [gold-of-pleasure]
gb|AAM64276.1|  bHLH transcription factor, putative                     149   7e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200279.1|  transcription factor ILR3                             149   7e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34442.1|  unknown                                                 149   8e-40   Lotus japonicus
emb|CAN70830.1|  hypothetical protein VITISV_005283                     152   9e-40   Vitis vinifera
ref|XP_009132430.1|  PREDICTED: transcription factor ILR3-like          149   9e-40   Brassica rapa
emb|CDY43028.1|  BnaA03g11750D                                          149   1e-39   Brassica napus [oilseed rape]
gb|KJB13568.1|  hypothetical protein B456_002G081900                    148   1e-39   Gossypium raimondii
gb|KFK35883.1|  hypothetical protein AALP_AA4G049100                    148   1e-39   Arabis alpina [alpine rockcress]
emb|CDY43809.1|  BnaC03g14420D                                          148   2e-39   Brassica napus [oilseed rape]
gb|AHZ94970.1|  helix-loop-helix-like protein                           146   2e-39   Lilium regale
ref|XP_006659812.1|  PREDICTED: transcription factor ILR3-like          148   2e-39   Oryza brachyantha
emb|CDY47456.1|  BnaC09g31010D                                          147   2e-39   Brassica napus [oilseed rape]
ref|XP_006280790.1|  hypothetical protein CARUB_v10026758mg             150   2e-39   
ref|XP_007021087.1|  DNA binding protein, putative                      147   3e-39   
ref|XP_006847910.1|  hypothetical protein AMTR_s00029p00112130          147   4e-39   Amborella trichopoda
ref|XP_010062961.1|  PREDICTED: transcription factor ILR3-like is...    147   5e-39   Eucalyptus grandis [rose gum]
ref|NP_001242620.1|  uncharacterized protein LOC100806838               146   7e-39   
dbj|BAK03093.1|  predicted protein                                      146   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ41459.1|  hypothetical protein OsJ_25981                          146   1e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDY71937.1|  BnaA05g35780D                                          145   2e-38   Brassica napus [oilseed rape]
ref|XP_006304584.1|  hypothetical protein CARUB_v10011628mg             145   2e-38   Capsella rubella
ref|NP_001060960.1|  Os08g0138500                                       145   3e-38   
ref|XP_006594652.1|  PREDICTED: transcription factor ILR3-like          142   3e-38   Glycine max [soybeans]
gb|AFN84533.1|  BHLH domain class transcription factor                  145   3e-38   Fragaria x ananassa
ref|XP_009144925.1|  PREDICTED: transcription factor bHLH115            144   3e-38   Brassica rapa
ref|XP_010479562.1|  PREDICTED: transcription factor bHLH115-like       144   3e-38   Camelina sativa [gold-of-pleasure]
gb|EAZ05534.1|  hypothetical protein OsI_27750                          145   4e-38   Oryza sativa Indica Group [Indian rice]
gb|EEC82221.1|  hypothetical protein OsI_26369                          145   4e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001059905.1|  Os07g0543000                                       145   4e-38   
ref|XP_006658659.1|  PREDICTED: transcription factor ILR3-like          144   4e-38   
gb|AAO72577.1|  helix-loop-helix-like protein                           144   5e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDY42475.1|  BnaA10g08510D                                          144   7e-38   Brassica napus [oilseed rape]
ref|XP_009120001.1|  PREDICTED: transcription factor ILR3-like          143   9e-38   Brassica rapa
ref|XP_003573355.1|  PREDICTED: transcription factor ILR3-like          144   1e-37   Brachypodium distachyon [annual false brome]
gb|KHN36564.1|  Transcription factor bHLH115                            143   1e-37   Glycine soja [wild soybean]
gb|ADC33137.1|  helix-loop-helix-like protein                           143   2e-37   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009414543.1|  PREDICTED: transcription factor ILR3               142   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW70124.1|  hypothetical protein EUGRSUZ_F03420                     142   2e-37   Eucalyptus grandis [rose gum]
ref|XP_004972892.1|  PREDICTED: transcription factor ILR3-like          143   2e-37   Setaria italica
gb|EPS70109.1|  hypothetical protein M569_04652                         142   5e-37   Genlisea aurea
gb|KHN25765.1|  Transcription factor ILR3                               141   6e-37   Glycine soja [wild soybean]
gb|KFK27081.1|  hypothetical protein AALP_AA8G331500                    141   8e-37   Arabis alpina [alpine rockcress]
gb|ACG38605.1|  bHLH transcription factor                               141   8e-37   Zea mays [maize]
gb|AJO70790.1|  bHLH transcription factor bHLH57                        141   9e-37   Eleusine coracana
emb|CDY35576.1|  BnaC05g27050D                                          140   1e-36   Brassica napus [oilseed rape]
ref|XP_010461939.1|  PREDICTED: transcription factor bHLH115            140   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002316971.1|  basic helix-loop-helix family protein              140   2e-36   Populus trichocarpa [western balsam poplar]
ref|NP_001146503.1|  uncharacterized protein LOC100280093               140   2e-36   
ref|XP_003597042.1|  Transcription factor ILR3                          140   2e-36   Medicago truncatula
ref|NP_001185192.1|  transcription factor bHLH115                       141   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AFW57417.1|  putative HLH DNA-binding domain superfamily protein     140   4e-36   
gb|EMS54079.1|  Transcription factor ILR3                               139   4e-36   Triticum urartu
ref|XP_010092690.1|  hypothetical protein L484_019764                   138   5e-36   
ref|XP_008677332.1|  PREDICTED: LOC100284429 isoform X1                 139   5e-36   
ref|XP_011030891.1|  PREDICTED: transcription factor ILR3-like          139   5e-36   Populus euphratica
ref|XP_004957936.1|  PREDICTED: transcription factor ILR3-like is...    139   9e-36   Setaria italica
ref|XP_004957935.1|  PREDICTED: transcription factor ILR3-like is...    139   9e-36   Setaria italica
ref|XP_010935491.1|  PREDICTED: transcription factor bHLH115-like       137   1e-35   Elaeis guineensis
gb|ABK96448.1|  unknown                                                 138   2e-35   Populus trichocarpa x Populus deltoides
ref|XP_006370611.1|  basic helix-loop-helix family protein              138   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006493504.1|  PREDICTED: transcription factor ILR3-like          135   2e-35   
gb|KHN27978.1|  Transcription factor ILR3                               136   5e-35   Glycine soja [wild soybean]
ref|XP_004172808.1|  PREDICTED: transcription factor ILR3-like          133   1e-34   
gb|EMT27826.1|  Transcription factor ILR3                               134   2e-34   
gb|KHG21334.1|  Transcription factor ILR3 -like protein                 135   2e-34   Gossypium arboreum [tree cotton]
ref|XP_011048283.1|  PREDICTED: transcription factor ILR3-like          136   2e-34   Populus euphratica
ref|XP_003562971.1|  PREDICTED: transcription factor ILR3-like          135   2e-34   Brachypodium distachyon [annual false brome]
ref|XP_010940315.1|  PREDICTED: transcription factor ILR3-like is...    132   4e-34   Elaeis guineensis
ref|XP_004487368.1|  PREDICTED: transcription factor bHLH115-like       134   4e-34   Cicer arietinum [garbanzo]
ref|XP_010940314.1|  PREDICTED: transcription factor ILR3-like is...    134   5e-34   Elaeis guineensis
ref|XP_008803703.1|  PREDICTED: transcription factor bHLH115-like       133   7e-34   Phoenix dactylifera
ref|XP_009420541.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    130   8e-34   
ref|XP_002462974.1|  hypothetical protein SORBIDRAFT_02g035580          134   9e-34   Sorghum bicolor [broomcorn]
gb|ACN40301.1|  unknown                                                 133   1e-33   Picea sitchensis
gb|KDO50387.1|  hypothetical protein CISIN_1g032672mg                   129   2e-33   Citrus sinensis [apfelsine]
ref|NP_001150796.1|  LOC100284429                                       132   2e-33   
ref|XP_008454559.1|  PREDICTED: transcription factor ILR3-like is...    131   2e-33   Cucumis melo [Oriental melon]
ref|NP_001239799.1|  uncharacterized protein LOC100813088               132   3e-33   Glycine max [soybeans]
ref|XP_010539274.1|  PREDICTED: transcription factor ILR3               131   3e-33   Tarenaya hassleriana [spider flower]
ref|XP_006837018.1|  hypothetical protein AMTR_s00098p00170370          131   4e-33   Amborella trichopoda
ref|XP_010109550.1|  hypothetical protein L484_018285                   132   7e-33   
gb|AFW61272.1|  putative HLH DNA-binding domain superfamily protein     130   1e-32   
gb|ACL54160.1|  unknown                                                 128   1e-32   Zea mays [maize]
ref|XP_010274798.1|  PREDICTED: transcription factor bHLH104-like       129   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008813306.1|  PREDICTED: transcription factor ILR3-like is...    129   2e-32   
ref|XP_008813314.1|  PREDICTED: transcription factor ILR3-like is...    129   2e-32   Phoenix dactylifera
ref|XP_008651109.1|  PREDICTED: uncharacterized protein LOC100273...    130   2e-32   
ref|XP_008651108.1|  PREDICTED: uncharacterized protein LOC100273...    130   3e-32   Zea mays [maize]
gb|KHN19061.1|  Transcription factor ILR3                               125   6e-32   Glycine soja [wild soybean]
ref|XP_002962528.1|  hypothetical protein SELMODRAFT_165556             128   9e-32   Selaginella moellendorffii
gb|KHN36734.1|  Transcription factor ILR3                               127   1e-31   Glycine soja [wild soybean]
ref|XP_003543288.1|  PREDICTED: transcription factor ILR3-like is...    127   2e-31   Glycine max [soybeans]
ref|XP_010262298.1|  PREDICTED: transcription factor bHLH104-like       126   2e-31   Nelumbo nucifera [Indian lotus]
dbj|BAJ40866.1|  bHLH transcriptional factor                            125   5e-31   Coptis japonica
ref|XP_011030516.1|  PREDICTED: transcription factor bHLH104-like       125   5e-31   Populus euphratica
ref|XP_010062962.1|  PREDICTED: transcription factor ILR3-like is...    125   8e-31   Eucalyptus grandis [rose gum]
gb|KHN33610.1|  Transcription factor ILR3                               121   2e-30   Glycine soja [wild soybean]
dbj|BAK01217.1|  predicted protein                                      124   2e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009408169.1|  PREDICTED: transcription factor ILR3-like is...    124   3e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001778884.1|  predicted protein                                  124   3e-30   
gb|KHG04921.1|  Transcription factor protein                            123   3e-30   Gossypium arboreum [tree cotton]
gb|ACG27921.1|  DNA binding protein                                     123   4e-30   Zea mays [maize]
ref|XP_008676877.1|  PREDICTED: uncharacterized protein LOC100274...    122   7e-30   
gb|AFW66775.1|  putative HLH DNA-binding domain superfamily protein     122   8e-30   
ref|XP_009378999.1|  PREDICTED: transcription factor bHLH104-like       122   8e-30   Pyrus x bretschneideri [bai li]
ref|XP_001777933.1|  predicted protein                                  120   9e-30   
gb|EMT07811.1|  Transcription factor ILR3                               124   1e-29   
ref|XP_010241997.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    119   1e-29   Nelumbo nucifera [Indian lotus]
gb|ACN40263.1|  unknown                                                 122   1e-29   Picea sitchensis
ref|XP_009408170.1|  PREDICTED: transcription factor ILR3-like is...    120   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK23190.1|  unknown                                                 121   2e-29   Picea sitchensis
gb|KJB81835.1|  hypothetical protein B456_013G164100                    120   2e-29   Gossypium raimondii
ref|XP_008224372.1|  PREDICTED: transcription factor bHLH104            121   2e-29   Prunus mume [ume]
ref|XP_006378346.1|  hypothetical protein POPTR_0010s08360g             120   4e-29   
ref|XP_002314636.1|  basic helix-loop-helix family protein              120   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_001754335.1|  predicted protein                                  119   6e-29   
gb|KJB72343.1|  hypothetical protein B456_011G172500                    119   6e-29   Gossypium raimondii
ref|XP_008391189.1|  PREDICTED: transcription factor bHLH104-like       120   7e-29   
gb|KJB72345.1|  hypothetical protein B456_011G172500                    119   8e-29   Gossypium raimondii
gb|KJB72344.1|  hypothetical protein B456_011G172500                    119   8e-29   Gossypium raimondii
ref|XP_004134070.1|  PREDICTED: transcription factor bHLH104-like       119   1e-28   Cucumis sativus [cucumbers]
ref|XP_009409051.1|  PREDICTED: transcription factor ILR3-like is...    119   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150072.1|  DNA binding protein                                119   2e-28   Zea mays [maize]
ref|XP_009388594.1|  PREDICTED: transcription factor bHLH115-like       118   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008438540.1|  PREDICTED: transcription factor bHLH104-like       118   4e-28   Cucumis melo [Oriental melon]
ref|XP_006379889.1|  hypothetical protein POPTR_0008s16560g             117   5e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006827502.1|  hypothetical protein AMTR_s00009p00175450          117   5e-28   Amborella trichopoda
ref|XP_007223393.1|  hypothetical protein PRUPE_ppa011217mg             117   5e-28   
ref|XP_010544248.1|  PREDICTED: transcription factor bHLH115            117   6e-28   Tarenaya hassleriana [spider flower]
gb|KJB13569.1|  hypothetical protein B456_002G081900                    116   1e-27   Gossypium raimondii
ref|XP_006420196.1|  hypothetical protein CICLE_v10005872mg             116   1e-27   
ref|XP_006489749.1|  PREDICTED: transcription factor bHLH104-like...    116   1e-27   
ref|XP_006420195.1|  hypothetical protein CICLE_v10005872mg             116   1e-27   Citrus clementina [clementine]
ref|XP_006489748.1|  PREDICTED: transcription factor bHLH104-like...    116   2e-27   Citrus sinensis [apfelsine]
ref|XP_009381065.1|  PREDICTED: transcription factor bHLH115-like       115   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006594877.1|  PREDICTED: transcription factor ILR3-like is...    115   3e-27   
ref|XP_002268590.2|  PREDICTED: transcription factor bHLH104-like       115   3e-27   Vitis vinifera
ref|XP_009395404.1|  PREDICTED: transcription factor ILR3-like          115   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803141.1|  PREDICTED: transcription factor bHLH115-like       113   2e-26   Phoenix dactylifera
ref|XP_009409049.1|  PREDICTED: transcription factor bHLH115-like...    113   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937539.1|  PREDICTED: transcription factor ILR3-like is...    113   2e-26   Elaeis guineensis
ref|XP_010937538.1|  PREDICTED: transcription factor bHLH115-like...    113   3e-26   Elaeis guineensis
gb|KDP40313.1|  hypothetical protein JCGZ_02311                         112   4e-26   Jatropha curcas
ref|XP_004952164.1|  PREDICTED: transcription factor ILR3-like          112   4e-26   Setaria italica
ref|XP_011073517.1|  PREDICTED: transcription factor bHLH104            112   7e-26   Sesamum indicum [beniseed]
ref|NP_849383.1|  transcription factor bHLH104                          112   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567431.1|  transcription factor bHLH104                          112   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395406.1|  PREDICTED: transcription factor ILR3-like          111   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148890.1|  DNA binding protein                                110   4e-25   
ref|XP_010650065.1|  PREDICTED: transcription factor bHLH104 isof...    109   4e-25   Vitis vinifera
ref|XP_004296358.1|  PREDICTED: transcription factor bHLH104            109   5e-25   Fragaria vesca subsp. vesca
ref|XP_002280987.2|  PREDICTED: transcription factor bHLH104 isof...    109   6e-25   Vitis vinifera
ref|NP_001142225.1|  uncharacterized protein LOC100274393               107   8e-25   
gb|KHG15573.1|  Transcription factor ILR3 -like protein                 106   1e-24   
ref|XP_009419715.1|  PREDICTED: transcription factor ILR3-like          108   1e-24   
emb|CBI23608.3|  unnamed protein product                                108   1e-24   
ref|XP_002870316.1|  basic helix-loop-helix family protein              108   2e-24   
ref|XP_006447465.1|  hypothetical protein CICLE_v10016381mg             106   2e-24   
ref|XP_010937540.1|  PREDICTED: transcription factor ILR3-like is...    107   2e-24   
ref|XP_010532633.1|  PREDICTED: transcription factor bHLH104            109   3e-24   
ref|XP_010450041.1|  PREDICTED: transcription factor bHLH104-like       108   4e-24   
ref|XP_010674918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    104   7e-24   
gb|KFK39609.1|  hypothetical protein AALP_AA3G266100                    107   9e-24   
ref|XP_006284189.1|  hypothetical protein CARUB_v10005335mg             107   1e-23   
ref|XP_010069141.1|  PREDICTED: transcription factor bHLH104-like       106   1e-23   
ref|XP_003568328.1|  PREDICTED: transcription factor ILR3-like          105   1e-23   
ref|XP_002881143.1|  predicted protein                                  102   2e-23   
ref|XP_010435125.1|  PREDICTED: transcription factor bHLH104            106   2e-23   
ref|XP_006648231.1|  PREDICTED: transcription factor ILR3-like          105   2e-23   
ref|XP_003590056.1|  Transcription factor bHLH104                       105   2e-23   
gb|AFW87276.1|  putative HLH DNA-binding domain superfamily protein     104   4e-23   
ref|XP_010440465.1|  PREDICTED: transcription factor bHLH104-like       105   4e-23   
ref|XP_011091209.1|  PREDICTED: transcription factor bHLH104            104   5e-23   
ref|XP_011029840.1|  PREDICTED: transcription factor bHLH104-like...    103   6e-23   
emb|CDO99218.1|  unnamed protein product                                103   8e-23   
emb|CDY12770.1|  BnaC04g28710D                                          104   9e-23   
ref|XP_009775135.1|  PREDICTED: transcription factor bHLH104 isof...    103   1e-22   
ref|XP_006298151.1|  hypothetical protein CARUB_v10014200mg             104   2e-22   
ref|XP_009124105.1|  PREDICTED: transcription factor bHLH104 isof...    103   2e-22   
emb|CDY49420.1|  BnaCnng17300D                                          103   2e-22   
ref|XP_009124106.1|  PREDICTED: transcription factor bHLH104 isof...    103   2e-22   
ref|XP_002862580.1|  hypothetical protein ARALYDRAFT_920517           99.4    3e-22   
ref|NP_001045680.1|  Os02g0116600                                       102   3e-22   
ref|XP_004497838.1|  PREDICTED: transcription factor bHLH104-like       101   3e-22   
ref|XP_009609911.1|  PREDICTED: transcription factor bHLH104-like       102   4e-22   
gb|AAM10939.1|AF488573_1  putative bHLH transcription factor            102   4e-22   
ref|NP_188962.2|  transcription factor bHLH34                           102   6e-22   
gb|KFK23754.1|  hypothetical protein AALP_AAs74096U000300               102   8e-22   
gb|EMS59404.1|  Transcription factor ILR3                               102   9e-22   
gb|ACF81377.1|  unknown                                                 100   1e-21   
ref|XP_010326757.1|  PREDICTED: transcription factor bHLH104            100   1e-21   
ref|XP_002885559.1|  basic helix-loop-helix family protein              102   1e-21   
ref|XP_006354504.1|  PREDICTED: transcription factor bHLH104-like       100   1e-21   
ref|XP_010093421.1|  hypothetical protein L484_012819                 99.4    3e-21   
ref|XP_006414711.1|  hypothetical protein EUTSA_v10025927mg             100   3e-21   
ref|XP_011029839.1|  PREDICTED: transcription factor bHLH104-like...  98.2    7e-21   
ref|XP_003535811.1|  PREDICTED: transcription factor bHLH104-like     97.4    1e-20   
ref|XP_010512182.1|  PREDICTED: transcription factor bHLH34-like      99.0    1e-20   
gb|ACN37104.1|  unknown                                               96.3    1e-20   
ref|XP_007035086.1|  Basic helix-loop-helix DNA-binding superfami...  97.1    1e-20   
ref|XP_009775141.1|  PREDICTED: transcription factor bHLH104 isof...  97.1    2e-20   
ref|XP_002439907.1|  hypothetical protein SORBIDRAFT_09g022280        97.1    3e-20   
ref|XP_004961887.1|  PREDICTED: transcription factor ILR3-like        96.7    3e-20   
ref|XP_010466638.1|  PREDICTED: transcription factor bHLH34-like      97.4    4e-20   
ref|XP_003555760.1|  PREDICTED: transcription factor bHLH104-like     95.9    4e-20   
dbj|BAK00374.1|  predicted protein                                    95.9    6e-20   
ref|XP_010488368.1|  PREDICTED: transcription factor bHLH34-like      96.7    7e-20   
ref|XP_002529295.1|  DNA binding protein, putative                    95.1    8e-20   
gb|EYU25978.1|  hypothetical protein MIMGU_mgv1a0142551mg             93.6    9e-20   
ref|XP_010256783.1|  PREDICTED: transcription factor ILR3-like        95.1    1e-19   
gb|ACU18977.1|  unknown                                               94.7    1e-19   
ref|XP_007035087.1|  Basic helix-loop-helix DNA-binding superfami...  94.4    1e-19   
ref|XP_008660879.1|  PREDICTED: transcription factor ILR3-like        93.6    1e-19   
ref|XP_007145840.1|  hypothetical protein PHAVU_007G272600g           93.6    3e-19   
ref|XP_010671056.1|  PREDICTED: transcription factor bHLH104          94.0    3e-19   
gb|EPS62474.1|  hypothetical protein M569_12315                       92.0    5e-19   
gb|KHN00301.1|  Transcription factor bHLH104                          92.8    5e-19   
gb|EMT29974.1|  Transcription factor ILR3                             92.4    1e-18   
gb|EMT28781.1|  Transcription factor ILR3                             90.9    2e-18   
gb|EYU32540.1|  hypothetical protein MIMGU_mgv1a012843mg              91.7    2e-18   
gb|KHN22198.1|  Transcription factor bHLH104                          91.3    2e-18   
gb|EMS59536.1|  Transcription factor ILR3                             90.5    5e-18   
dbj|BAJ87023.1|  predicted protein                                    90.1    5e-18   
ref|XP_006406065.1|  hypothetical protein EUTSA_v10021177mg           90.9    7e-18   
ref|XP_003573308.1|  PREDICTED: transcription factor ILR3-like        89.7    9e-18   
emb|CAN61035.1|  hypothetical protein VITISV_041750                   88.2    2e-17   
emb|CDX77539.1|  BnaA07g06770D                                        88.2    5e-17   
ref|XP_009102650.1|  PREDICTED: transcription factor bHLH34           87.8    6e-17   
emb|CBI35161.3|  unnamed protein product                              85.1    9e-17   
ref|XP_008350013.1|  PREDICTED: transcription factor bHLH34-like      84.3    1e-16   
ref|XP_002993147.1|  hypothetical protein SELMODRAFT_431241           85.5    2e-16   
ref|XP_010650066.1|  PREDICTED: transcription factor ILR3 isoform X3  84.7    2e-16   
gb|KHN33607.1|  Transcription factor ILR3                             80.9    4e-16   
gb|AFW66778.1|  putative HLH DNA-binding domain superfamily protein   83.2    4e-16   
gb|ACU17812.1|  unknown                                               81.6    7e-16   
emb|CDX85069.1|  BnaC07g08370D                                        84.0    1e-15   
emb|CDY08983.1|  BnaC01g31080D                                        84.0    1e-15   
ref|XP_008361598.1|  PREDICTED: transcription factor bHLH34-like      81.3    1e-15   
gb|ACU21182.1|  unknown                                               80.9    4e-15   
ref|XP_002964160.1|  hypothetical protein SELMODRAFT_405883           78.2    2e-14   
emb|CDY35510.1|  BnaA01g24020D                                        79.7    4e-14   
ref|XP_008813250.1|  PREDICTED: transcription factor bHLH104-like     77.0    7e-14   
ref|XP_010497553.1|  PREDICTED: transcription factor bHLH115-like     75.5    1e-13   
gb|EAY98281.1|  hypothetical protein OsI_20189                        72.0    8e-12   
ref|XP_010918791.1|  PREDICTED: transcription factor bHLH104-like...  70.1    1e-11   
gb|EEE63953.1|  hypothetical protein OsJ_18778                        69.7    6e-11   
gb|ABA27067.1|  TO91-1rc                                              65.1    3e-10   
gb|EEC73066.1|  hypothetical protein OsI_07026                        68.9    3e-10   
ref|NP_001046730.1|  Os02g0433600                                     68.6    5e-10   
ref|XP_001758113.1|  predicted protein                                68.9    6e-10   
ref|XP_010548277.1|  PREDICTED: transcription factor bHLH11           65.9    5e-09   
ref|XP_006665082.1|  PREDICTED: transcription factor bHLH121-like     65.5    7e-09   
ref|XP_011396941.1|  Transcription factor                             62.4    1e-08   
ref|XP_007133432.1|  hypothetical protein PHAVU_011G178100g           63.9    1e-08   
gb|KIZ04759.1|  Transcription factor bHLH34                           64.3    2e-08   
ref|NP_001152439.1|  LOC100286079                                     63.5    2e-08   
ref|XP_002458163.1|  hypothetical protein SORBIDRAFT_03g028030        63.5    3e-08   
ref|XP_003059710.1|  predicted protein                                63.2    3e-08   
ref|XP_001771284.1|  predicted protein                                63.9    3e-08   
ref|XP_004952384.1|  PREDICTED: transcription factor bHLH121-like     63.2    4e-08   
emb|CDO96948.1|  unnamed protein product                              62.8    5e-08   
ref|XP_010090287.1|  hypothetical protein L484_024952                 62.8    5e-08   
ref|XP_002505435.1|  predicted protein                                62.0    5e-08   
ref|XP_006851964.1|  hypothetical protein AMTR_s00041p00193340        62.4    6e-08   
ref|XP_003531414.1|  PREDICTED: transcription factor bHLH121-like     62.0    6e-08   
ref|XP_003529225.1|  PREDICTED: transcription factor bHLH121 isof...  62.4    7e-08   
ref|XP_003573201.1|  PREDICTED: transcription factor bHLH121-like     62.4    8e-08   
emb|CDY33424.1|  BnaC01g33010D                                        62.0    9e-08   
ref|XP_008440819.1|  PREDICTED: transcription factor bHLH121          62.0    1e-07   
gb|KGN48915.1|  hypothetical protein Csa_6G505920                     62.0    1e-07   
ref|XP_007153217.1|  hypothetical protein PHAVU_003G016700g           61.6    1e-07   
ref|XP_002521657.1|  DNA binding protein, putative                    61.6    1e-07   
ref|XP_004134862.1|  PREDICTED: transcription factor bHLH121-like     61.6    1e-07   
gb|EPS66403.1|  hypothetical protein M569_08377                       60.8    1e-07   
ref|XP_004158905.1|  PREDICTED: transcription factor bHLH121-like     61.2    1e-07   
ref|XP_006859207.1|  hypothetical protein AMTR_s00070p00188780        61.6    2e-07   
emb|CEG02114.1|  Myc-type, basic helix-loop-helix (bHLH) domain       60.8    2e-07   
ref|XP_006583728.1|  PREDICTED: transcription factor bHLH121 isof...  60.8    2e-07   
ref|XP_010487939.1|  PREDICTED: transcription factor bHLH121-like     60.8    2e-07   
ref|XP_006391636.1|  hypothetical protein EUTSA_v10023630mg           60.8    2e-07   
ref|XP_003083024.1|  unnamed protein product                          60.1    2e-07   
ref|XP_010466150.1|  PREDICTED: transcription factor bHLH121          60.5    2e-07   
ref|XP_010679934.1|  PREDICTED: transcription factor bHLH121          60.8    2e-07   
gb|KEH30588.1|  transcription factor                                  60.5    2e-07   
ref|NP_188620.1|  transcription factor bHLH121                        60.5    2e-07   
ref|NP_001030729.1|  transcription factor bHLH121                     60.8    2e-07   
ref|XP_002885338.1|  basic helix-loop-helix family protein            60.5    3e-07   
ref|XP_003546649.1|  PREDICTED: transcription factor bHLH121 isof...  60.5    3e-07   
ref|XP_010526564.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|XP_004289841.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|XP_011092862.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|XP_010113346.1|  hypothetical protein L484_026678                 60.5    3e-07   
ref|XP_010261279.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
gb|KDP27585.1|  hypothetical protein JCGZ_19590                       60.5    3e-07   
ref|XP_010920215.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
gb|KDP46754.1|  hypothetical protein JCGZ_06542                       60.1    4e-07   
ref|XP_006487406.1|  PREDICTED: transcription factor bHLH121-like...  60.1    4e-07   
gb|KEH30589.1|  transcription factor                                  60.1    4e-07   
ref|XP_006423595.1|  hypothetical protein CICLE_v10028783mg           60.1    4e-07   
gb|ACU18754.1|  unknown                                               57.0    5e-07   
ref|XP_004505689.1|  PREDICTED: transcription factor bHLH121-like...  59.7    5e-07   
ref|XP_002529247.1|  DNA binding protein, putative                    59.7    5e-07   
ref|XP_008236198.1|  PREDICTED: transcription factor bHLH121          59.7    5e-07   
gb|KDO39039.1|  hypothetical protein CISIN_1g022288mg                 59.7    5e-07   
ref|XP_006406448.1|  hypothetical protein EUTSA_v10021271mg           59.3    5e-07   
ref|XP_009383990.1|  PREDICTED: transcription factor bHLH121          59.3    7e-07   
ref|XP_008457648.1|  PREDICTED: transcription factor bHLH121 isof...  59.3    7e-07   
ref|XP_010508140.1|  PREDICTED: transcription factor bHLH121-like     59.3    7e-07   
ref|XP_007200377.1|  hypothetical protein PRUPE_ppa008347mg           59.3    7e-07   
gb|KHN05467.1|  Transcription factor bHLH121                          58.9    7e-07   
ref|XP_009610672.1|  PREDICTED: transcription factor bHLH121-like...  59.3    8e-07   
emb|CAN74571.1|  hypothetical protein VITISV_018451                   59.3    8e-07   
ref|XP_004147018.1|  PREDICTED: transcription factor bHLH121-like     58.9    1e-06   
ref|XP_002277206.2|  PREDICTED: transcription factor bHLH121          58.9    1e-06   
ref|XP_004158392.1|  PREDICTED: transcription factor bHLH121-like     58.5    1e-06   
ref|XP_007046692.1|  Basic helix-loop-helix DNA-binding superfami...  58.9    1e-06   
ref|XP_009610673.1|  PREDICTED: transcription factor bHLH121-like...  58.5    1e-06   
gb|KEH40640.1|  transcription factor                                  58.9    1e-06   
ref|XP_010029678.1|  PREDICTED: transcription factor bHLH121 isof...  58.9    1e-06   
ref|XP_009111465.1|  PREDICTED: transcription factor bHLH121          58.2    1e-06   
ref|XP_008336910.1|  PREDICTED: transcription factor bHLH121-like     57.0    2e-06   
ref|XP_009783164.1|  PREDICTED: transcription factor bHLH121-like     58.2    2e-06   
ref|XP_006359649.1|  PREDICTED: transcription factor bHLH121-like...  58.2    2e-06   
gb|KCW56632.1|  hypothetical protein EUGRSUZ_I02346                   58.2    2e-06   
ref|XP_006359650.1|  PREDICTED: transcription factor bHLH121-like...  58.2    2e-06   
ref|XP_004230930.1|  PREDICTED: transcription factor bHLH121          58.2    2e-06   
emb|CDY42214.1|  BnaA01g25810D                                        58.2    2e-06   
ref|XP_007041927.1|  Basic helix-loop-helix DNA-binding superfami...  58.2    2e-06   
ref|XP_011037263.1|  PREDICTED: transcription factor bHLH121-like     58.2    2e-06   
ref|XP_009788103.1|  PREDICTED: transcription factor bHLH121          57.8    2e-06   
gb|AAL91266.1|  AT4g36060/T19K4_190                                   57.4    2e-06   
ref|XP_010029679.1|  PREDICTED: transcription factor bHLH121 isof...  57.8    3e-06   
ref|XP_007131595.1|  hypothetical protein PHAVU_011G026500g           57.4    3e-06   
ref|XP_008788364.1|  PREDICTED: transcription factor bHLH121 isof...  57.8    3e-06   
ref|NP_195330.2|  transcription factor bHLH11                         57.4    3e-06   
ref|NP_849566.1|  transcription factor bHLH11                         57.4    3e-06   
ref|XP_002306170.1|  hypothetical protein POPTR_0004s17540g           57.4    3e-06   
ref|XP_006383101.1|  hypothetical protein POPTR_0005s11550g           57.4    3e-06   
ref|XP_008788362.1|  PREDICTED: transcription factor bHLH121 isof...  57.4    3e-06   
ref|XP_002312979.2|  hypothetical protein POPTR_0009s13220g           57.0    4e-06   
ref|XP_006359651.1|  PREDICTED: transcription factor bHLH121-like...  57.0    4e-06   
emb|CBI17374.3|  unnamed protein product                              57.0    5e-06   
ref|XP_002265960.1|  PREDICTED: transcription factor bHLH121          57.0    5e-06   
ref|XP_002984127.1|  hypothetical protein SELMODRAFT_445783           56.6    5e-06   
ref|XP_010690442.1|  PREDICTED: transcription factor bHLH121-like     56.6    6e-06   
emb|CAA18500.1|  putative Myc-type transcription factor               56.2    6e-06   
ref|NP_001141709.1|  uncharacterized protein LOC100273838             53.9    7e-06   
ref|XP_010446832.1|  PREDICTED: transcription factor bHLH11-like      56.2    7e-06   
ref|XP_011043188.1|  PREDICTED: transcription factor bHLH121-like     56.2    7e-06   
ref|XP_010066253.1|  PREDICTED: transcription factor bHLH121-like     56.2    8e-06   
gb|KJB32632.1|  hypothetical protein B456_005G252200                  55.8    1e-05   
ref|XP_008241823.1|  PREDICTED: transcription factor bHLH121          55.8    1e-05   
ref|XP_009363493.1|  PREDICTED: transcription factor bHLH121-like     55.8    1e-05   
ref|XP_009346632.1|  PREDICTED: transcription factor bHLH121          55.8    1e-05   
ref|XP_004287813.1|  PREDICTED: transcription factor bHLH121          55.5    1e-05   
gb|KJB32629.1|  hypothetical protein B456_005G252200                  55.5    1e-05   
gb|KJB32630.1|  hypothetical protein B456_005G252200                  55.5    2e-05   
ref|XP_011046795.1|  PREDICTED: transcription factor bHLH121-like     55.5    2e-05   
ref|XP_006406447.1|  hypothetical protein EUTSA_v10021271mg           55.1    2e-05   
ref|XP_010437386.1|  PREDICTED: transcription factor bHLH11-like ...  54.7    2e-05   
ref|XP_009379403.1|  PREDICTED: transcription factor bHLH121-like     54.7    3e-05   
emb|CAN69664.1|  hypothetical protein VITISV_029413                   55.1    3e-05   
ref|XP_007204901.1|  hypothetical protein PRUPE_ppa008596mg           54.7    3e-05   
gb|KHG29974.1|  Transcription factor protein                          54.7    3e-05   
ref|XP_010437385.1|  PREDICTED: transcription factor bHLH11-like ...  54.3    3e-05   
gb|KJB43326.1|  hypothetical protein B456_007G194400                  53.9    4e-05   
gb|KJB43327.1|  hypothetical protein B456_007G194400                  53.5    4e-05   
ref|XP_005646379.1|  hypothetical protein COCSUDRAFT_42874            53.5    5e-05   
ref|XP_006412028.1|  hypothetical protein EUTSA_v10026039mg           53.5    5e-05   
gb|KFK30238.1|  hypothetical protein AALP_AA7G235400                  53.1    8e-05   
gb|KDP44874.1|  hypothetical protein JCGZ_01374                       52.0    8e-05   
ref|XP_006285497.1|  hypothetical protein CARUB_v10006934mg           52.4    1e-04   
tpg|DAA58568.1|  TPA: putative HLH DNA-binding domain superfamily...  52.4    1e-04   
ref|NP_001242300.1|  uncharacterized protein LOC100817000             52.0    2e-04   



>ref|XP_009617474.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=230

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 181/239 (76%), Gaps = 11/239 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            MA  E DGSNWLL+LG  ED+P        LEP  QW S+A   P   S   D+SY   D
Sbjct  1    MAETEEDGSNWLLELGLMEDLP-------SLEPNAQWPSTAFSLPNNLSSGLDDSYDNSD  53

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                C ++KR +SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS ILS
Sbjct  54   SLKDCGSKKRARSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILS  111

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV+QLRDEAQKLKES+++LQE+VNELKAEKNEL+DEKQKLK EKDKLE QLK  N+
Sbjct  112  DAVRMVVQLRDEAQKLKESYDNLQEKVNELKAEKNELRDEKQKLKAEKDKLEQQLKTTNA  171

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLPHPPA A PF  PH +   K++P++GYPGIPMWQF  PA +DT EDH+L PPVA
Sbjct  172  QPGFLPHPPAMASPFSAPHQVYASKMMPYLGYPGIPMWQFVPPAAVDTSEDHALRPPVA  230



>ref|XP_009772342.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=230

 Score =   244 bits (624),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 181/239 (76%), Gaps = 11/239 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            MA  E DGSNWL++LG  ED+P        LEP  QW S+A   P   S   D+SY   D
Sbjct  1    MAETEEDGSNWLIELGLMEDLP-------SLEPNAQWPSTAFSLPNNLSSGLDDSYGNSD  53

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                C ++KR +SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS ILS
Sbjct  54   SLKDCGSKKRARSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILS  111

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV+QLRDEAQKL+ES+++LQE+VNELKAEKNEL+DEKQKLK EKDKLE QLK  N+
Sbjct  112  DAVRMVVQLRDEAQKLRESYDNLQEKVNELKAEKNELRDEKQKLKAEKDKLEQQLKTTNA  171

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLPHPPA A PF  PH +   K++P++GYPGIPMWQF  PA +DT EDH+L PPVA
Sbjct  172  QPGFLPHPPAMASPFSAPHQVYSSKMMPYLGYPGIPMWQFVPPAAVDTSEDHALRPPVA  230



>ref|XP_004232754.1| PREDICTED: transcription factor ILR3 [Solanum lycopersicum]
Length=230

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 178/239 (74%), Gaps = 11/239 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            MA  E DGSNWL++LG  ED+P        LEP  QW S+A   P   S   ++SY   D
Sbjct  1    MAETEEDGSNWLIELGLMEDLP-------SLEPNAQWPSNAFSLPNNLSSGLEDSYGNSD  53

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                C ++KR++SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS IL 
Sbjct  54   SLKECGSKKRVRSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILG  111

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV+QLRDEAQKLKES  +LQE+V ELKAEKNEL+DEKQKLK EKDKLE  LKA+N+
Sbjct  112  DAVRMVVQLRDEAQKLKESNNNLQEKVIELKAEKNELRDEKQKLKAEKDKLEQHLKAMNT  171

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLPHPPA   PF  PH +   K++P++GYPGIPMWQF  PA +DT EDHSL PPVA
Sbjct  172  QPGFLPHPPAMPSPFSAPHQVFASKMMPYIGYPGIPMWQFVPPAAVDTSEDHSLRPPVA  230



>ref|XP_006365882.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=230

 Score =   234 bits (597),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 178/239 (74%), Gaps = 11/239 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            MA  E DGSNWL++LG  ED+P        LEP  QW S+A   P   S   ++SY   D
Sbjct  1    MAETEEDGSNWLIELGLMEDLP-------SLEPNAQWPSNAFSIPNNLSSGLEDSYGNSD  53

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                C ++KR++SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS IL 
Sbjct  54   SLKECGSKKRVRSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILG  111

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV+QLRDEAQKLKES  +LQE+V ELKAEKNEL+DEKQKLK EKDKLE  LKA+N+
Sbjct  112  DAVRMVVQLRDEAQKLKESNNNLQEKVIELKAEKNELRDEKQKLKAEKDKLEQHLKAMNT  171

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLPHPPA   PF  PH +   K++P++GYPGIPMWQF  PA +DT EDHSL PPVA
Sbjct  172  QPGFLPHPPAMPSPFSAPHQVFASKMMPYLGYPGIPMWQFVPPAAVDTSEDHSLRPPVA  230



>ref|XP_008224874.1| PREDICTED: transcription factor ILR3-like [Prunus mume]
Length=238

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 175/231 (76%), Gaps = 4/231 (2%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsIRQDESYVKFDVSNGCSAR  573
            NW+ D G  EDIP+PGG  PPL+ PG+ W S + ++PA PS+  D+S+   D       R
Sbjct  9    NWVFDYGVLEDIPVPGGDLPPLDLPGFTWPSHSFVAPAAPSVDFDDSFGNSDSIKESGCR  68

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR++SG+C+    SKA REKMRR RLNDRF ELS +++PG+PPK DK+AIL DAVR+V Q
Sbjct  69   KRVRSGSCN-VTGSKACREKMRRDRLNDRFLELSSMLEPGRPPKTDKAAILGDAVRVVNQ  127

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR EAQ+LK+S  DLQE++NELKAEKNEL+DEKQ+LK EK+ +E Q+KALN++PGFLPHP
Sbjct  128  LRGEAQQLKDSNGDLQEKINELKAEKNELRDEKQRLKTEKENIERQIKALNTQPGFLPHP  187

Query  212  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             A   PF  P  +VGGKL+PFVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  188  AAIPGPFSAPGQVVGGKLMPFVGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  238



>emb|CDO99702.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   214 bits (545),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 176/249 (71%), Gaps = 16/249 (6%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQ-WHssailspappsIRQDESYVKF  600
            MA+PE D SNW+ D G  EDIP+PGG  PPL+PG+Q W +++  +P    +  D ++   
Sbjct  1    MASPEED-SNWVFDFGLIEDIPVPGGDLPPLDPGFQNWSNNSFYNPNSVEL--DGAFQSS  57

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDR---------FQELSCVMDPGKP  447
                  S+RKR +SG CS A DSKA REKMRR +LNDR         FQELS ++DP +P
Sbjct  58   QSRKEASSRKRARSGPCS-ATDSKAYREKMRRDKLNDRQTLSLSLYLFQELSFLLDPERP  116

Query  446  PKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdk  267
            PK+DKSAIL DA RM++QLRDEA+KLKES+E LQE+VNELKAEKNEL+DEKQK K EKDK
Sbjct  117  PKVDKSAILGDATRMLIQLRDEAEKLKESYERLQEKVNELKAEKNELRDEKQKQKAEKDK  176

Query  266  lelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
            LE QLKAL+S+ GFL +P A   PF  PH +   K+ PFVGYPG  MW F  PA +DT E
Sbjct  177  LEHQLKALSSQTGFLSNPSAILAPFVAPHQVFSSKMTPFVGYPGTSMWHFMPPAAVDTSE  236

Query  86   DHSL-PPVA  63
            DH L PPVA
Sbjct  237  DHVLRPPVA  245



>ref|XP_007211937.1| hypothetical protein PRUPE_ppa010730mg [Prunus persica]
 gb|EMJ13136.1| hypothetical protein PRUPE_ppa010730mg [Prunus persica]
Length=238

 Score =   211 bits (537),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 174/231 (75%), Gaps = 4/231 (2%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsIRQDESYVKFDVSNGCSAR  573
            NW+ D G  EDIP+PGG  PPL+ PG+ W S + ++PA PS+  D+S+   D       R
Sbjct  9    NWVFDYGVLEDIPVPGGDLPPLDLPGFTWPSHSFVAPAAPSVDFDDSFGNSDSIKESGFR  68

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR++SG+C+    SKA REKMRR RLNDRF ELS +++PG+PPK DK+AIL DAVR+V Q
Sbjct  69   KRVRSGSCN-VTGSKACREKMRRDRLNDRFLELSSMLEPGRPPKTDKAAILGDAVRVVNQ  127

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR EAQ+LK+S  DLQE++NELKAEKNEL+DEKQ+LK EK+ +E Q+KALN++PGFLPHP
Sbjct  128  LRGEAQQLKDSNGDLQEKINELKAEKNELRDEKQRLKTEKENIERQIKALNTQPGFLPHP  187

Query  212  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             A   PF  P  +VGGKL+PFVGYPG+ MWQF  PA +DT +DH L  PVA
Sbjct  188  AAIPGPFSAPGQVVGGKLMPFVGYPGVSMWQFMPPAAVDTSQDHVLRSPVA  238



>gb|KDP20820.1| hypothetical protein JCGZ_21291 [Jatropha curcas]
Length=237

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 167/235 (71%), Gaps = 5/235 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLG-FEDIPLPGGKFPPLEP-GYQWHssailspappsIRQDESYVKF  600
            M +P  D +NW+ D     D+P+PGG+ P LEP G  W S+  +  +  S+  D S+ K 
Sbjct  1    MGSPN-DNANWVFDYNMIADVPVPGGELPSLEPAGALWSSTPFIDNSSVSVGLDGSFGKS  59

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            DV     +RKR++ G+C+    SKA REKMRR RLNDRF EL  ++DPG PPKMDKS IL
Sbjct  60   DVIEDNGSRKRVRPGSCNSVG-SKACREKMRRDRLNDRFMELGALLDPGMPPKMDKSVIL  118

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
            +DAV+MV QLRDEAQKLKES E LQE++NELK EKNEL+DEKQ+LK EK+ +E Q+K L+
Sbjct  119  ADAVKMVNQLRDEAQKLKESNESLQEKINELKVEKNELRDEKQRLKTEKETIERQVKILS  178

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL  75
            +  GF+PHPPA   PF TP  + G KLVP+VGYPG+PMWQ  +PA +DT +D  L
Sbjct  179  APTGFMPHPPAIPAPF-TPSQVFGSKLVPYVGYPGVPMWQVMSPATLDTSQDPVL  232



>ref|XP_002273184.2| PREDICTED: transcription factor ILR3-like isoform X1 [Vitis vinifera]
Length=232

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 168/239 (70%), Gaps = 9/239 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE D  NW+ D G  +D+P+P      L+  + W S    + A   +  D+S V  D
Sbjct  1    MVSPEED-PNWIFDYGLIDDVPVPS-----LQATFNWPSHDFTASAALGVEFDDSPVNLD  54

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  +RKRM+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPKMDK+ ILS
Sbjct  55   DVKENHSRKRMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILS  113

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ +  Q+KAL+S
Sbjct  114  DALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSS  173

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            + GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  174  QAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  232



>ref|XP_010267809.1| PREDICTED: transcription factor ILR3 [Nelumbo nucifera]
Length=237

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 164/240 (68%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  +DI +PGG F     G+ W+S  +      S+  D S+   D
Sbjct  1    MVSPE--NPNWLYDYGLMDDISVPGGDFTASTAGFHWNSQPLNGSTSVSLEADGSFGNSD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR+++ +CS A  SKA REKMRR RLND+F EL  ++DPG+PPKMDK+AILS
Sbjct  59   GLKEMGSKKRVRTASCS-AVGSKACREKMRRDRLNDKFVELGSILDPGRPPKMDKAAILS  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLKES E LQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+K L++
Sbjct  118  DAVRMVTQLRSEAQKLKESNESLQEKIKELKAEKNELRDEKQRLKVEKEKLEQQIKTLSA  177

Query  236  RP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +P  FLPHP      FP      G KL+PF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  QPTSFLPHPSTIPAAFPAQGQAAGNKLMPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_002316706.2| hypothetical protein POPTR_0011s03360g [Populus trichocarpa]
 gb|EEE97318.2| hypothetical protein POPTR_0011s03360g [Populus trichocarpa]
Length=243

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 165/245 (67%), Gaps = 10/245 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsIRQDE  615
            M +P  +  NW+ D G  EDI +PGG    LE       G  W S      A  S+  + 
Sbjct  1    MVSPN-ENDNWVFDCGLIEDISVPGGDLLGLESLDETPNGSLWSSHNFTDSAFLSVEFNN  59

Query  614  SYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  435
            SY   D      +RKR++ G+ S A  SKA REKMRR RLNDRF EL  ++DPG+PPK+D
Sbjct  60   SYENLDGHKESGSRKRVRPGS-SNATGSKACREKMRRDRLNDRFTELGALLDPGRPPKVD  118

Query  434  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  255
            KSAIL DA RMV QLRDE+QKLKES   LQE+++ELKAEKNEL+DEKQ+LK EK+ LE Q
Sbjct  119  KSAILVDAARMVTQLRDESQKLKESNVSLQEKIDELKAEKNELRDEKQRLKTEKENLERQ  178

Query  254  lkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL  75
            +KAL++ P FLPHP A   PF  P  +VG KL+PFVGYPGI MWQF  PAV+DT +DH L
Sbjct  179  VKALSTPPNFLPHPSAIPAPFSAPGQVVGSKLMPFVGYPGISMWQFMPPAVVDTSQDHVL  238

Query  74   -PPVA  63
             PPVA
Sbjct  239  RPPVA  243



>ref|XP_009366840.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=238

 Score =   199 bits (506),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 163/231 (71%), Gaps = 4/231 (2%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPGGKFPPLEP-GYQWHssailspappsIRQDESYVKFDVSNGCSAR  573
            NW+ D G  EDI +PGG+ P L+P G+ W   +   P  PS   D+S+   D       R
Sbjct  9    NWVFDYGVIEDILVPGGELPSLDPPGFSWPDHSFAGPTAPSTEFDDSFGNPDSMKETGLR  68

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR ++G+ S  + SKA REKMRR RLNDRF ELS +++PG+PPK DK AIL DAVRMV Q
Sbjct  69   KRARTGSSS-VSGSKACREKMRRDRLNDRFVELSSILEPGRPPKTDKVAILGDAVRMVTQ  127

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR EA +LKES  +LQE +NELKAEKNEL+DEKQ+LK EKD +E Q+KAL ++P FLPHP
Sbjct  128  LRGEALQLKESSANLQETINELKAEKNELRDEKQRLKVEKDNIERQIKALGTQPSFLPHP  187

Query  212  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             A   PF  P  +VGGK++PFVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  188  AAIPTPFSAPGQVVGGKMMPFVGYPGMSMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_007025918.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY28540.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
Length=229

 Score =   198 bits (504),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 161/233 (69%), Gaps = 25/233 (11%)
 Frame = -2

Query  749  SNWLLD-LGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSA  576
            S W+ D  G  EDIP+PGG  P L+P                     + +    S  CS 
Sbjct  18   SGWIFDDYGLLEDIPVPGGDLPSLDPA--------------------APIWSSQSLTCST  57

Query  575  RK-RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
               R +SG+CS A+ SKA REKMRR RLNDRF EL  ++DPG+P K+DK+ IL DAVRMV
Sbjct  58   PPLRARSGSCS-ASGSKACREKMRRDRLNDRFLELGSILDPGRPLKVDKAVILVDAVRMV  116

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLRDEAQKL+ES E LQE++NELKAEKNEL+DEKQ+LK EK+ LE Q+KAL ++PGFLP
Sbjct  117  TQLRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKENLEQQVKALGTQPGFLP  176

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            HPPA   PF TP  +VGGKLVPFVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  177  HPPAIPTPFSTPGQVVGGKLVPFVGYPGVSMWQFLPPASVDTSQDHILRPPVA  229



>ref|XP_002274829.2| PREDICTED: transcription factor ILR3-like isoform X2 [Vitis vinifera]
Length=240

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 167/241 (69%), Gaps = 5/241 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPG--YQWHssailspappsIRQDESYVK  603
            MA    + SNWL D G  EDI +PGG+FP   PG  + W S A+ S +  S+  D S+  
Sbjct  1    MALDSSENSNWLFDYGLMEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGD  60

Query  602  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             D       RKR+K  +C GA  +KA REK+RR RLN+RF EL  +++PG+PPK DK+AI
Sbjct  61   SDGLKELGPRKRLKHESC-GATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAI  119

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            LSDAVRMV QLR EAQKLKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA+
Sbjct  120  LSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVKAI  179

Query  242  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPV  66
            +++PGFLPHP A    F       G KL+PF+GYP + MWQF  PA +DT +DH L PPV
Sbjct  180  SAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHVLRPPV  239

Query  65   A  63
            A
Sbjct  240  A  240



>ref|XP_010247015.1| PREDICTED: transcription factor ILR3-like [Nelumbo nucifera]
Length=236

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 162/239 (68%), Gaps = 5/239 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   SNWL + G  +DI +PGG +     G+QW+S  +      ++  D S+   D
Sbjct  1    MGSPE--NSNWLYEYGLMDDITVPGGDYTAPATGFQWNSQPLNGSTNVNVEIDCSFGDSD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  +RKR+++ +CS A  SKA REKMRR RLNDRF EL  +++PG+PPKMDK+AILS
Sbjct  59   GFKEVGSRKRVRTESCS-AVGSKACREKMRRDRLNDRFLELGSILEPGRPPKMDKAAILS  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLKES E L E++ ELKAEKNEL+DEKQ+LK E++KLE Q+K L++
Sbjct  118  DAVRMVTQLRSEAQKLKESNESLLEKIKELKAEKNELRDEKQRLKTEREKLEQQVKTLSA  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P FLPHP      F       G KL+PF+GYPG+ MWQF  PA +DT +DH L  PVA
Sbjct  178  PPSFLPHPTTIPAAFTAQGQAAGNKLMPFIGYPGVAMWQFMPPAAVDTSQDHVLRSPVA  236



>ref|XP_002518568.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43955.1| DNA binding protein, putative [Ricinus communis]
Length=229

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 163/241 (68%), Gaps = 25/241 (10%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +P  D +NW  D G  EDIP+PGG  P L+P   W S ++              V+FD
Sbjct  1    MVSPS-DNANWAFDYGLIEDIPVPGGDLPSLDP--LWSSPSLS-------------VEFD  44

Query  596  VSNGCS-------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  438
             S G S       +RKR++ G+CSG   SKA REKMRR +LNDRF EL  ++DPG+PPKM
Sbjct  45   DSLGSSQCLRDNGSRKRVRPGSCSGLG-SKACREKMRRDKLNDRFMELGALLDPGRPPKM  103

Query  437  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  258
            DKS IL+DA++MV QLR EAQKLKES E+LQE+VNELK EKNEL+DEKQ+LK EK+ +E 
Sbjct  104  DKSVILADAMKMVNQLRAEAQKLKESNENLQEKVNELKVEKNELRDEKQRLKTEKESIER  163

Query  257  qlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            Q+ AL++   FLPH PA   PF +P  ++G KLVP VGYPG+PMWQ   PA +DT +D  
Sbjct  164  QVNALSASARFLPHLPAIPAPFSSPSQVIGSKLVPIVGYPGVPMWQLMPPATVDTSQDPV  223

Query  77   L  75
            L
Sbjct  224  L  224



>ref|XP_008441610.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=234

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 167/240 (70%), Gaps = 9/240 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsIRQDESYVKF  600
            M +PE+  ++W+ D G  ED P+PGG  P L+ P +        S        DE     
Sbjct  1    MGSPEI--TDWVFDYGVIEDFPVPGGDLPSLDLPSFTLPCDFTASFRADF---DEPLGMA  55

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            +      +RKRM SG+ S A +SKA++EKMRR +LNDRF EL+ +++ G+PPK+DKSAIL
Sbjct  56   EDVKESGSRKRMSSGS-SNAFESKARKEKMRRDKLNDRFLELNSILNHGRPPKLDKSAIL  114

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRM++QLRDEAQKLKES E   E++NE+KAEKNEL+DEKQ+LKE KD LE ++KA N
Sbjct  115  GDAVRMIIQLRDEAQKLKESNESSLEKINEMKAEKNELRDEKQRLKEAKDGLEKKMKAFN  174

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FLPHPPA    F +P+ +VGGKLVP +GYPG+ MWQF  P  IDT +DH L PPVA
Sbjct  175  TQPSFLPHPPAIPPGFSSPNQIVGGKLVPVIGYPGVSMWQFMPPGAIDTSQDHVLRPPVA  234



>ref|XP_004145091.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 ref|XP_004154169.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 ref|XP_004167401.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 gb|KGN64576.1| hypothetical protein Csa_1G065960 [Cucumis sativus]
Length=235

 Score =   193 bits (490),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 127/240 (53%), Positives = 168/240 (70%), Gaps = 8/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsIRQDESYVKF  600
            M +PE+  ++W+ D G  E+IP+PGG  P L+ P +   S    +        DE     
Sbjct  1    MGSPEL--TDWVFDYGVIENIPVPGGDLPSLDLPSFTLPSCDFTASFREDF--DEPLGME  56

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            +      +RKRM SG+ S A +SKA++EK+RR +LNDRF EL+ +++ G+PPK+DKSAIL
Sbjct  57   EDVKESRSRKRMSSGS-SNAFESKARKEKIRRDKLNDRFLELNSILNHGRPPKIDKSAIL  115

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRM++QLRDEAQKLKES E   E++NE+KAEKNEL+DEKQ+LKE KD LE ++K  N
Sbjct  116  GDAVRMIIQLRDEAQKLKESNESSLEKINEMKAEKNELRDEKQRLKEAKDSLEKKMKGFN  175

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FLPHPPA    F +P+ +VGGKLVP +GYPG+ MWQF  P  IDT +DH L PPVA
Sbjct  176  TQPTFLPHPPAIPAGFSSPNQIVGGKLVPVIGYPGVSMWQFMPPGAIDTSQDHVLRPPVA  235



>ref|XP_010999542.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
 ref|XP_011012469.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=243

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 159/239 (67%), Gaps = 9/239 (4%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsIRQDESYVKFD  597
            +  NW+ D G  EDI +PGG    LE       G  W S      A  S+  + SY   D
Sbjct  6    ENDNWVFDCGLIEDISVPGGDLLGLESLDETPNGSLWSSHNFTDSAFLSVEFNNSYENSD  65

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                   RKR++ G+ S A  SKA REK+RR RLNDRF EL  ++DPG+PPK+DKSAIL 
Sbjct  66   GHKDSGCRKRVRPGS-SNATGSKACREKLRRDRLNDRFMELGALLDPGRPPKVDKSAILV  124

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA RMV QLRDE+QKLKES   LQE+++ELKAEKNEL+DEKQ+LK EK+ LE Q+KAL +
Sbjct  125  DAARMVTQLRDESQKLKESNVSLQEKIDELKAEKNELRDEKQRLKTEKENLERQVKALRT  184

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P FLPHP A   PF  P  + G KL+PFVGYPGI MWQF  PAV+DT +DH L PPVA
Sbjct  185  PPNFLPHPSAIPAPFSAPGQVGGSKLMPFVGYPGISMWQFMPPAVVDTSQDHVLRPPVA  243



>ref|XP_004309656.1| PREDICTED: transcription factor ILR3-like [Fragaria vesca subsp. 
vesca]
Length=245

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/246 (54%), Positives = 169/246 (69%), Gaps = 10/246 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP-GYQWHssailspappsIRQDESYVKF  600
            MAA      NW+ D    E I +PGG  P L+P G+ W S +  +P  PS+  D S+   
Sbjct  1    MAAASSPPQNWVFDYDLIESISVPGGDLPSLDPPGFSWGSDSFAAPTAPSVDFDGSFGNS  60

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            ++     + KR++SG+C+  + SKA REKMRR RLND+F ELS +++PG+PPK DK+AIL
Sbjct  61   EIMKETGSNKRVRSGSCN-VSSSKACREKMRRDRLNDKFLELSTILEPGRPPKTDKAAIL  119

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR EAQ LK+S E LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+KAL 
Sbjct  120  VDAVRMVNQLRGEAQNLKDSSESLQEKITELKAEKNELRDEKQRLKAEKENLERQIKALG  179

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFV------GYPGIPMWQFAAPAVIDTPEDHS  78
            ++PGFLPHP A   PF  P  +VGGKL+PF+      GYPG+ MWQF   A +DT +DH 
Sbjct  180  TQPGFLPHPAAIPAPFSAPGQVVGGKLMPFMGYPGVSGYPGVSMWQFMPQAAVDTSQDHV  239

Query  77   L-PPVA  63
            L PPVA
Sbjct  240  LRPPVA  245



>ref|XP_010647172.1| PREDICTED: transcription factor ILR3-like isoform X4 [Vitis vinifera]
Length=199

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D+S V  D      +RKRM+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPK
Sbjct  14   DDSPVNLDDVKENHSRKRMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPK  72

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
            MDK+ ILSDA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ + 
Sbjct  73   MDKAVILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIV  132

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
             Q+KAL+S+ GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF  PA +DT +DH
Sbjct  133  QQIKALSSQAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQFMPPAAVDTSQDH  192

Query  80   SL-PPVA  63
             L PPVA
Sbjct  193  VLRPPVA  199



>ref|XP_010647170.1| PREDICTED: transcription factor ILR3-like isoform X2 [Vitis vinifera]
 emb|CBI33226.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D+S V  D      +RKRM+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPK
Sbjct  40   DDSPVNLDDVKENHSRKRMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPK  98

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
            MDK+ ILSDA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ + 
Sbjct  99   MDKAVILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIV  158

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
             Q+KAL+S+ GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF  PA +DT +DH
Sbjct  159  QQIKALSSQAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQFMPPAAVDTSQDH  218

Query  80   SL-PPVA  63
             L PPVA
Sbjct  219  VLRPPVA  225



>ref|XP_010657331.1| PREDICTED: transcription factor ILR3-like isoform X1 [Vitis vinifera]
Length=244

 Score =   192 bits (487),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 167/245 (68%), Gaps = 9/245 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPG--YQWHssailspappsIRQDESYVK  603
            MA    + SNWL D G  EDI +PGG+FP   PG  + W S A+ S +  S+  D S+  
Sbjct  1    MALDSSENSNWLFDYGLMEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGD  60

Query  602  FDVSNGCSARKR----MKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  435
             D       RKR    +K  +C GA  +KA REK+RR RLN+RF EL  +++PG+PPK D
Sbjct  61   SDGLKELGPRKRCFYRLKHESC-GATGTKACREKLRRDRLNERFLELGSILEPGRPPKTD  119

Query  434  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  255
            K+AILSDAVRMV QLR EAQKLKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q
Sbjct  120  KAAILSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQ  179

Query  254  lkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL  75
            +KA++++PGFLPHP A    F       G KL+PF+GYP + MWQF  PA +DT +DH L
Sbjct  180  VKAISAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHVL  239

Query  74   -PPVA  63
             PPVA
Sbjct  240  RPPVA  244



>ref|XP_006449136.1| hypothetical protein CICLE_v10016511mg [Citrus clementina]
 gb|ESR62376.1| hypothetical protein CICLE_v10016511mg [Citrus clementina]
Length=235

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 164/232 (71%), Gaps = 6/232 (3%)
 Frame = -2

Query  749  SNWLLDLGFED-IPLPGGKFPPLEP-GYQWHssailspappsIRQDESYVKFDVSNGCSA  576
            SNW+ D G  D I + GG  P L+P    W SS    P       D+S+   D      +
Sbjct  7    SNWIFDCGLLDGIGVSGGDLPSLDPPEVLWSSSTSNPPLSAEF--DDSFGNLDAFKETGS  64

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR++SG+CS A+ SKA REKMRR RLNDRF EL+ ++DPG+PPKMDK+ +L+DAV+MV 
Sbjct  65   RKRVRSGSCS-ASGSKACREKMRRDRLNDRFMELASILDPGRPPKMDKTVLLADAVQMVT  123

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH  216
            QLRDEAQKLK S E+L  ++NELK EKNEL+DEKQ+LK EK+ LE Q+KAL+S+P FLPH
Sbjct  124  QLRDEAQKLKVSNENLLGKINELKCEKNELRDEKQRLKNEKENLERQVKALSSQPAFLPH  183

Query  215  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PP    PF  P  +VGGKLVP VGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  184  PPPVPAPFSAPGQVVGGKLVPLVGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  235



>gb|KJB57696.1| hypothetical protein B456_009G176000 [Gossypium raimondii]
Length=250

 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 164/231 (71%), Gaps = 5/231 (2%)
 Frame = -2

Query  743  WLLD-LGF-EDIPLPGGKFPPLEPGY-QWHssailspappsIRQDESYVKFDVSNGCSAR  573
            W+ D  G  EDIP+PGG  P L+P    W S ++    P S+   ES+   D  N   +R
Sbjct  21   WIFDDYGLLEDIPVPGGDLPSLDPSAPIWSSPSLTCSTPLSVEFTESFGNSDNLNETGSR  80

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KRM+SG+ S +  SKA REKMRR +LNDRF EL  +++PG+  K+DK+ IL DA RMV Q
Sbjct  81   KRMRSGSSSASG-SKACREKMRRDKLNDRFLELGSILEPGRSSKVDKAVILVDAARMVTQ  139

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LRDEAQKL+ES E LQE++NELKAEKNEL+DEKQ+LK EKD LE Q+KAL S+PGF+P  
Sbjct  140  LRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKDNLERQVKALGSQPGFIPQA  199

Query  212  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PA   PF T   +VGGKLVPFVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  200  PAIPTPFSTSSQVVGGKLVPFVGYPGVSMWQFLPPAAVDTSQDHMLRPPVA  250



>ref|XP_006467957.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|KDO75607.1| hypothetical protein CISIN_1g026702mg [Citrus sinensis]
Length=235

 Score =   187 bits (476),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 164/233 (70%), Gaps = 6/233 (3%)
 Frame = -2

Query  752  GSNWLLDLGF-EDIPLPGGKFPPLEP-GYQWHssailspappsIRQDESYVKFDVSNGCS  579
             SNW+ D G  +DI + GG  P L+P    W SS    P       ++S+   D      
Sbjct  6    NSNWIFDCGLLDDIGVSGGDLPSLDPPEVLWSSSTSNPPLSAEF--NDSFGNLDAFKETG  63

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            +RKR++SG+CS A+ SKA REKMRR RLNDRF EL+ ++DPG+PPKMDK+ +L+DAV+MV
Sbjct  64   SRKRVRSGSCS-ASGSKACREKMRRDRLNDRFMELASILDPGRPPKMDKTVLLADAVQMV  122

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLRDEAQKLK S E L  ++NELK EKNEL+DEKQ+LK EK+ LE Q+KAL+S+P FLP
Sbjct  123  TQLRDEAQKLKVSNEKLLGKINELKCEKNELRDEKQRLKNEKENLERQVKALSSQPAFLP  182

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            HPP    PF  P  +VGGKLVP VGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  183  HPPPVPAPFSAPGQVVGGKLVPLVGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_007025917.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28539.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=287

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 171/271 (63%), Gaps = 43/271 (16%)
 Frame = -2

Query  749  SNWLLD-LGF-EDIPLPGGKFPPLEPGY-QWHssailspappsIRQ-DESYVKFDVSNGC  582
            S W+ D  G  EDIP+PGG  P L+P    W S ++    PP   + +ES+   D  N  
Sbjct  18   SGWIFDDYGLLEDIPVPGGDLPSLDPAAPIWSSQSLTCSTPPLSVEFNESFGNSDSLNET  77

Query  581  SARKRM----------------------------------KSGACSGAADSKAQREKMRR  504
              RKR                                   +SG+CS A+ SKA REKMRR
Sbjct  78   GFRKRYTATQPLTFFYCFPLLCFRNAVSALASAPIYCFRARSGSCS-ASGSKACREKMRR  136

Query  503  YRLNDR---FQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  333
             RLNDR   F EL  ++DPG+P K+DK+ IL DAVRMV QLRDEAQKL+ES E LQE++N
Sbjct  137  DRLNDRHVLFLELGSILDPGRPLKVDKAVILVDAVRMVTQLRDEAQKLRESNESLQEKIN  196

Query  332  ELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVP  153
            ELKAEKNEL+DEKQ+LK EK+ LE Q+KAL ++PGFLPHPPA   PF TP  +VGGKLVP
Sbjct  197  ELKAEKNELRDEKQRLKTEKENLEQQVKALGTQPGFLPHPPAIPTPFSTPGQVVGGKLVP  256

Query  152  FVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            FVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  257  FVGYPGVSMWQFLPPASVDTSQDHILRPPVA  287



>gb|EYU19205.1| hypothetical protein MIMGU_mgv1a012900mg [Erythranthe guttata]
Length=236

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 162/239 (68%), Gaps = 5/239 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GFED P+P   F     G+ W    +   +  S++ D S  + D+
Sbjct  1    MVSPE--NTNWLYDYGFEDNPVPDVNFSAPSAGFSWPMQTLNGSSNVSLQIDGSSGESDM  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR ++ AC+ ++ SKA REK RR +LND+F EL  +++PG+PPK DK+AIL D
Sbjct  59   QKEAGSKKRTRTEACAPSS-SKACREKQRRDKLNDKFMELGALLEPGRPPKTDKAAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-  237
            AVRMV QLR +AQKLK+S  +LQE++ ELKAEK EL+DEKQ+LK EKDKLE QLK +N+ 
Sbjct  118  AVRMVTQLRSDAQKLKDSNLNLQEKIKELKAEKTELRDEKQRLKAEKDKLEQQLKTMNTP  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLP PPA    F   +  VG K+VP + YPG+ MWQF  PA IDT +DH L PPVA
Sbjct  178  QPGFLPAPPAIPTAFAAQNQAVGNKMVPIISYPGVAMWQFMPPASIDTSQDHVLRPPVA  236



>ref|XP_010647171.1| PREDICTED: transcription factor ILR3-like isoform X3 [Vitis vinifera]
Length=211

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 158/239 (66%), Gaps = 30/239 (13%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE D  NW+ D G  +D+P+P      L+  + W S                     
Sbjct  1    MVSPEED-PNWIFDYGLIDDVPVPS-----LQATFNWPSHDFT-----------------  37

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                 SA   M+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPKMDK+ ILS
Sbjct  38   ----ASAALGMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILS  92

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ +  Q+KAL+S
Sbjct  93   DALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSS  152

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            + GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  153  QAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQFMPPAAVDTSQDHVLRPPVA  211



>emb|CBI28976.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 158/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPG--YQWHssailspappsIRQDESYVKFDVSNGCSARKRMKSGA  552
             EDI +PGG+FP   PG  + W S A+ S +  S+  D S+   D       RKR+K  +
Sbjct  1    MEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGDSDGLKELGPRKRLKHES  60

Query  551  CSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQK  372
            C GA  +KA REK+RR RLN+RF EL  +++PG+PPK DK+AILSDAVRMV QLR EAQK
Sbjct  61   C-GATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAILSDAVRMVTQLRSEAQK  119

Query  371  LKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPF  192
            LKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA++++PGFLPHP A    F
Sbjct  120  LKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVKAISAQPGFLPHPSAMPAAF  179

Query  191  PTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                   G KL+PF+GYP + MWQF  PA +DT +DH L PPVA
Sbjct  180  AAQGRAPGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHVLRPPVA  223



>gb|KHG15485.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=253

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 165/234 (71%), Gaps = 8/234 (3%)
 Frame = -2

Query  743  WLLD-LGF-EDIPLPGGKFPPLEPGY-QWHssailspappsIRQDESYVKFDVSNGCSAR  573
            W+ D  G  EDIP+PGG  P L+P    W S ++    P S+   ES+   D  N   +R
Sbjct  21   WIFDDYGLLEDIPVPGGDLPSLDPSAPIWSSPSLTCSTPLSVEFTESFGNSDSLNETGSR  80

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDR---FQELSCVMDPGKPPKMDKSAILSDAVRM  402
            KRM+SG+ S +  SKA REKMRR +LNDR   F EL  +++PG+  K+DK+ IL DA RM
Sbjct  81   KRMRSGSSSASG-SKACREKMRRDKLNDRHVLFLELGSILEPGRSSKVDKAVILVDAARM  139

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V QLRDEAQKL+ES E LQE++NELKAEKNEL+DEKQ+LK EKD LE Q+KAL S+PGF+
Sbjct  140  VTQLRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKDNLERQVKALGSQPGFV  199

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P  PA   PF TP  +VGGKLVPFVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  200  PQAPAIPTPFSTPSQVVGGKLVPFVGYPGVSMWQFLPPAAVDTSQDHMLRPPVA  253



>emb|CDP05806.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 156/238 (66%), Gaps = 5/238 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D  FEDI +P G FP    G+ W    +   +  S+  D S    D 
Sbjct  1    MVSPE--NTNWLYDYAFEDIAVPDGNFPASASGFNWPVQTLNGSSNVSVEIDGSLGDSDG  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 +RKR+++ +C+  + SKA REK RR RLND+F EL  ++DPG+PPK DK+AIL D
Sbjct  59   PKETGSRKRLRTESCASTS-SKACREKQRRDRLNDKFVELGALLDPGRPPKTDKAAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVR+V QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N++
Sbjct  118  AVRIVTQLRTEAQKLKDSNLSLQEKIKELKAEKNELRDEKQRLKGEKEKLEQQLKTVNTQ  177

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
              F+P PP    PF       G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  ASFMP-PPTMPAPFAAQGQAPGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_008371203.1| PREDICTED: transcription factor ILR3-like [Malus domestica]
Length=177

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = -2

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR ++G+ S  + SKA REKMRR RLNDRF ELS +++PG+PPK DK AIL DAVRMV 
Sbjct  7    RKRARTGSNS-VSGSKACREKMRRDRLNDRFAELSSILEPGRPPKTDKVAILGDAVRMVT  65

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH  216
            QLR EAQ+LKES  +LQE +NELKAEKNEL+DEKQ+LK EKD +E Q+KAL ++P FLPH
Sbjct  66   QLRGEAQQLKESSANLQETINELKAEKNELRDEKQRLKAEKDNIERQIKALGTQPSFLPH  125

Query  215  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P A   PF  P  +VGGK++PFVGYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  126  PAAIPTPFSAPGQVVGGKMMPFVGYPGMSMWQFMPPAAVDTSQDHVLRPPVA  177



>gb|AEJ88330.1| putative MYC protein [Tamarix hispida]
Length=238

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (69%), Gaps = 5/236 (2%)
 Frame = -2

Query  758  VDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS  579
            ++ SNW+ D   EDIPLP   +     G+ W   A+  P+  S+  D ++   +V+    
Sbjct  4    LENSNWIFDYPLEDIPLPVANYDAPNSGFNWPVPALNGPSNVSVEGDGTFRDSEVAKENG  63

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
             +KR +S +C G ++SKA REK+RR RLND+F EL+ +++PG+PPK DK+AIL+DAVRMV
Sbjct  64   LKKRGRSESC-GLSNSKACREKLRRDRLNDKFVELAAILEPGRPPKTDKAAILTDAVRMV  122

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR E+QKLK++  DLQE++ ELK+EKNEL+DEKQ+ K EK+KLE QLK++NS+PG+LP
Sbjct  123  TQLRSESQKLKDTNSDLQEKIKELKSEKNELRDEKQRFKAEKEKLEQQLKSVNSQPGYLP  182

Query  218  HPPA---TAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             PP                G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  183  PPPTMPAAYAAQAPQFQTGGSKLVPFMGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_010035617.1| PREDICTED: transcription factor ILR3-like [Eucalyptus grandis]
 gb|KCW47065.1| hypothetical protein EUGRSUZ_K00871 [Eucalyptus grandis]
Length=237

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 153/234 (65%), Gaps = 6/234 (3%)
 Frame = -2

Query  755  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSN--GC  582
            D SNWL+D G  D+    G   P   G+ W S +    +  +  +       D  N  G 
Sbjct  7    DNSNWLVDYGLADVS--AGDVLPSAGGFAWSSPSFDVSSSNASIEVNCASTRDSENLKGK  64

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
            S  KR+KS +C  +  SKA REK+RR RLN+RF EL  +++PG+PPK DKSAILSDAVRM
Sbjct  65   SCHKRLKSESCLSSG-SKACREKLRRDRLNERFLELGSILEPGRPPKTDKSAILSDAVRM  123

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V QLR EAQKLKES E+LQE++ ELKAEKNEL+DEKQ+LK +K+KLE QLK  +  P F 
Sbjct  124  VTQLRTEAQKLKESNEELQEKIKELKAEKNELRDEKQRLKADKEKLEQQLKVSSFHPVFP  183

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PHP   + PF       G KL+P++G+PG+ MWQF  P+ +DT +DH L PPVA
Sbjct  184  PHPSVVSTPFAAQERAGGNKLMPYIGFPGVAMWQFMPPSTVDTSQDHVLRPPVA  237



>ref|XP_011097928.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=234

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 160/239 (67%), Gaps = 7/239 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GFEDI +  G F     G  W   A+   +  S+  D S  + D+
Sbjct  1    MVSPE--NTNWLYDYGFEDIAVHDGNFAAHNSGLSWPMQALNGSSNASVEIDGSLGESDL  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR ++  C+ ++ SKA REK RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  59   QKEAGSKKRCRTEPCAPSS-SKACREKQRRDRLNDKFMELGALLEPGRPPKTDKAAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-  237
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N+ 
Sbjct  118  AVRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNTP  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFL  PPA    F T +   G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  QPGFL--PPAIPAAFATQNQGAGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_011003406.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=243

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 168/245 (69%), Gaps = 10/245 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsIRQDE  615
            M +P  D ++W+ D G  ED+P+PGG+   LE       G  W S +    A  S   + 
Sbjct  1    MVSPN-DNASWVFDCGLIEDVPVPGGEQLCLESLDETPNGSLWSSHSFNDTAFLSAEFNN  59

Query  614  SYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  435
            S+   D       RKR++ G+   A  SKA REKMRR RLNDRF E++ ++DPG+PPK+D
Sbjct  60   SFENSDGLKEIGFRKRVRHGS-GNAPGSKACREKMRRDRLNDRFMEMAALLDPGRPPKVD  118

Query  434  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  255
            KSAIL DA RMV QLRDE+QKLKES E LQE+++ELKAEKNEL+DEKQKLK EK+ LE Q
Sbjct  119  KSAILVDAARMVTQLRDESQKLKESNESLQEKIDELKAEKNELRDEKQKLKTEKENLEWQ  178

Query  254  lkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL  75
            LKAL+  P +LP PPA   PF +P  +VG KL+PFVGYPGI MWQF  PAV+DT +DH L
Sbjct  179  LKALSPPPTYLPQPPAIPAPFSSPGQVVGSKLMPFVGYPGISMWQFMPPAVVDTSQDHVL  238

Query  74   -PPVA  63
             PPVA
Sbjct  239  HPPVA  243



>ref|XP_006360579.1| PREDICTED: transcription factor ILR3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360580.1| PREDICTED: transcription factor ILR3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006360581.1| PREDICTED: transcription factor ILR3-like isoform X3 [Solanum 
tuberosum]
Length=244

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 158/244 (65%), Gaps = 12/244 (5%)
 Frame = -2

Query  761  EVDGS---NWLLDLGF-EDIPLPGGKF-----PPLEPGYQWHssailspappsIRQDESY  609
            EVD S   NWL D     DI             P    + W +  I + +      D ++
Sbjct  2    EVDSSGNPNWLFDYELITDITSAASVTVTDFQSPATIDFSWPAQTIYASSNLIAETDYTF  61

Query  608  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  429
               +VS   S+RKR+KS  CS +  SKA REK+RR RLN+RF ELS V+DPG+PPK +K 
Sbjct  62   ADSEVSKEASSRKRLKSEWCS-SPRSKACREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  428  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  249
            AILSDA RM+++LR E QKLKES E+LQE++ ELKAEKNEL+DEK++LKEEK+ LE Q+K
Sbjct  121  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKRRLKEEKENLEQQVK  180

Query  248  aLNSRPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-  75
            +L S+PGFL HP A    F     +  G KL+PF+GYP + MWQF  PAV+DT +DH L 
Sbjct  181  SLASKPGFLSHPSAVGAAFTAQGQVAAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHVLR  240

Query  74   PPVA  63
            PPVA
Sbjct  241  PPVA  244



>ref|XP_002282727.1| PREDICTED: transcription factor ILR3 [Vitis vinifera]
 emb|CBI20499.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 161/240 (67%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKF  600
            M +PE   +NWL + G  EDIP+P   F     G+ W     L+ +     + D S+   
Sbjct  1    MVSPE--ATNWLYEYGLIEDIPVPDSNFANTNSGFAWTPVQALNTSANVSGEIDGSFGDS  58

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D      ++KR++S +C GA+ SKA REK+RR RLND+F EL  +++PG+PPK DKS+IL
Sbjct  59   DGIKETGSKKRVRSESC-GASSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSSIL  117

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR E+QKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  118  IDAVRMVTQLRGESQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKAMN  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FLP  P+    F       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  AQPSFLPPVPSIPAAFAAQGQAGGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_007043353.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX99184.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=231

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 156/233 (67%), Gaps = 10/233 (4%)
 Frame = -2

Query  755  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWH-ssailspappsIRQDESYVKFDVSNGCS  579
            + +NWLLD G  D P P         GY W   + + + +  S   D S+   D     +
Sbjct  7    ENTNWLLDYGIPDFPRPAA-------GYGWPPQTTLDARSNLSAAVDCSFPDSDSLKEVA  59

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            +RKR+KS +C  A+ SKA REK+RR +LNDRF EL  +++PG+PPK DK AIL  AV+MV
Sbjct  60   SRKRLKSESCY-ASGSKACREKLRRNKLNDRFLELGAILEPGRPPKADKVAILIVAVKMV  118

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR EAQKLKE  E+LQ ++ ELKAEKNEL+DEKQ+LK +K+KLE Q+ A+++RPGFLP
Sbjct  119  HQLRSEAQKLKELNEELQAKIKELKAEKNELRDEKQRLKADKEKLEQQVNAMSTRPGFLP  178

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            HP   A  F +     G KL+P++G+PG+ MWQF  PA +DT +DH L PPVA
Sbjct  179  HPTPMAAAFASQGQAAGNKLMPYIGFPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_002522828.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF39526.1| DNA binding protein, putative [Ricinus communis]
Length=235

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 163/239 (68%), Gaps = 6/239 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWL++ G  +DIP+P   F     G+ W    +   +  S+  D S+   D
Sbjct  1    MVSPE--NTNWLIEYGLIDDIPVPDANFSVPVTGFSWPVQTLNGSSNVSVEIDGSFGNAD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                 +++KR +S +C  A+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  59   TQKDSTSKKRGRSDSC--ASSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILI  116

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  117  DAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKVEKEKLEQQLKAVNA  176

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +P FLP PPA   PF       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  177  QPSFLPPPPAIPAPFAAQGQAPGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_009764628.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=243

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 154/243 (63%), Gaps = 11/243 (5%)
 Frame = -2

Query  761  EVDGS---NWLLDLGF-EDIPLPGGKF-----PPLEPGYQWHssailspappsIRQDESY  609
            E+D S   NWL D     DI             P    + W +  I + +      D ++
Sbjct  2    EIDSSGNPNWLFDYELMTDITSAASVAVTDFQSPATIDFSWPAQTIYASSNLIAETDYTF  61

Query  608  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  429
               +VS   S+RKR +   CS +  SKA REK+RR RLN+RF ELS V+DPG+PPK +K 
Sbjct  62   DDSEVSKEASSRKRSRIECCS-SPRSKASREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  428  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  249
            AILSDA +M+++LR E QKLKES E+LQE++ ELKAEK EL+DEKQ+LKEEK+ LE Q+K
Sbjct  121  AILSDAQKMLIELRTETQKLKESNEELQEKIKELKAEKIELRDEKQRLKEEKENLEQQVK  180

Query  248  aLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
             L S+PGFL HP A    F     + G KL+PF+GYP + MWQF  PAV+DT +DH L P
Sbjct  181  TLASKPGFLSHPSAMGAAFTAQGQVAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHVLRP  240

Query  71   PVA  63
            PVA
Sbjct  241  PVA  243



>ref|XP_006352486.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=231

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 155/238 (65%), Gaps = 8/238 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M  PE   +NWL D  +EDI  P   F     GY W           S+  D S  + D 
Sbjct  1    MVLPE--NTNWLYDYNYEDIVSPDVNFSV--SGYSWSMQGFNGSTNASVDIDGSLGESDC  56

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                S +KR ++ +C+ ++ SKA REK+RR +LND+F EL+ +++PG+PPK DKS IL D
Sbjct  57   LKESSCKKRTRAESCTSSS-SKACREKLRREKLNDKFMELAVLLEPGRPPKTDKSGILVD  115

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVR+V QLRDEAQKLK+S  DLQE++ ELK EKNEL+DEKQ+LK +K+KLE QLK ++++
Sbjct  116  AVRVVTQLRDEAQKLKDSNLDLQEKIKELKVEKNELRDEKQRLKSQKEKLEQQLKTMSAQ  175

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P FL  PPA    F +P    G KLVP + YPG+ MWQF  PA IDT +DH L PPVA
Sbjct  176  PSFL--PPAMPGAFASPIQAAGTKLVPIISYPGVAMWQFMPPAAIDTSQDHVLRPPVA  231



>ref|XP_009612610.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=243

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 156/243 (64%), Gaps = 11/243 (5%)
 Frame = -2

Query  761  EVDGS---NWLLDLGF-EDIP----LPGGKF-PPLEPGYQWHssailspappsIRQDESY  609
            E+D S   NWL D     DI     +    F  P    + W +  I + +      D ++
Sbjct  2    EIDSSGNPNWLFDYELITDITSAASVAVADFQSPATIDFSWPAQTIYASSNLIAETDYTF  61

Query  608  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  429
               +VS   S+RKR +   C  +  SKA REK+RR RLN+RF ELS V+DPG+PPK +K 
Sbjct  62   DDSEVSKEASSRKRSRIECC-NSPRSKASREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  428  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  249
            AILSDA +M+++LR E QKLKES E+LQE++ ELKAEKNEL+DEKQ LKEEK+ LE Q+K
Sbjct  121  AILSDAQKMLIELRAETQKLKESNEELQEKIKELKAEKNELRDEKQSLKEEKENLEQQVK  180

Query  248  aLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
             L+S+PGFL HP A    F     + G KL+PF+GYP + MWQF  PAV+DT +DH L P
Sbjct  181  NLSSKPGFLSHPSAMGAAFTAQGQVAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHVLRP  240

Query  71   PVA  63
            PVA
Sbjct  241  PVA  243



>ref|XP_002304984.1| hypothetical protein POPTR_0004s03190g [Populus trichocarpa]
 gb|EEE85495.1| hypothetical protein POPTR_0004s03190g [Populus trichocarpa]
Length=243

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 164/245 (67%), Gaps = 10/245 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsIRQDE  615
            M +P  D +NW+ D G  ED+P+P G+   LE       G  W S +    A  S   + 
Sbjct  1    MVSPN-DNANWVFDCGLIEDVPVPVGEQLCLESLDETPNGSLWSSHSFNDTAFLSAEFNN  59

Query  614  SYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  435
            S+   D       RKR++ G+   A  SKA REKMRR RLNDRF EL  ++DPG+PPK+D
Sbjct  60   SFENSDGLKEIGFRKRVRHGS-GNAPGSKACREKMRRDRLNDRFMELGALLDPGRPPKVD  118

Query  434  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  255
            KSA+L DA RMV QLRDE+QKLKES E LQE+++ELKAEKNEL+DEKQKLK EK+ LE Q
Sbjct  119  KSAMLVDAARMVTQLRDESQKLKESIESLQEKIDELKAEKNELRDEKQKLKMEKENLEWQ  178

Query  254  lkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL  75
             KAL+  P +LPHPPA   PF  P  +VG KL+PFVGYPGI MWQF  P V+DT +DH L
Sbjct  179  QKALSPPPTYLPHPPAIPAPFSAPGQVVGSKLMPFVGYPGISMWQFMPPTVVDTSQDHVL  238

Query  74   -PPVA  63
             PPVA
Sbjct  239  RPPVA  243



>ref|XP_010931430.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=237

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 158/240 (66%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   SNW+ D    +D+ + GG FP    G+ W    I S +  S+    S+V   
Sbjct  1    MGSPE--NSNWVFDCPLIDDMSVAGGDFPAPGTGFYWTPQGINSTSNSSVEISGSFVDSA  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
              N   ++KR++S + S    SKA REKMRR +LN+RF EL  +++PGKPPKMDK+AILS
Sbjct  59   GINESGSKKRVRSESSSQPG-SKACREKMRRDKLNNRFLELGSILEPGKPPKMDKAAILS  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S EDLQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+
Sbjct  118  DAVRMVTQLRSEAQKLKDSNEDLQEKIKELKAEKNELRDEKQRLKAEKENLEQQIKILNA  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            RP F+ HPP     F         KL +P +GYPG PMWQF  PA +DT +D  S PPVA
Sbjct  178  RPSFVAHPPVIPAAFAPQGQTAAHKLMMPVIGYPGFPMWQFMPPADVDTSQDAESCPPVA  237



>ref|XP_009355579.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=229

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 157/239 (66%), Gaps = 12/239 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWL D G  +D P+ GG F        W    I   +  S+  D S    +
Sbjct  1    MVSPE--NTNWLFDYGLIDDTPVLGGNF-------AWPVQPIAGSSSVSVELDGSLGDAE  51

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR+++ +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  52   GLKESGSKKRVRTESCSGTS-SKACREKLRRDRLNDKFVELGTILEPGRPPKTDKAAILV  110

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR E QKLK++   LQE++ ELKAEKNEL+DEK +LK EK+KLE QLK++N 
Sbjct  111  DAVRMVNQLRGEGQKLKDTNSGLQEKIKELKAEKNELRDEKLRLKLEKEKLEQQLKSMNV  170

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLP PPA    F       G K+VPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  171  QPGFLPPPPAIPSSFTAQGQARGNKMVPFIGYPGVAMWQFLPPAAVDTSQDHVLRPPVA  229



>ref|XP_010323806.1| PREDICTED: transcription factor ILR3 isoform X1 [Solanum lycopersicum]
Length=244

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 159/244 (65%), Gaps = 12/244 (5%)
 Frame = -2

Query  761  EVDGS---NWLLDLGF-EDIP----LPGGKF-PPLEPGYQWHssailspappsIRQDESY  609
            EVD S   NWL D     DI     +   +F  P    + W +  I + +      D ++
Sbjct  2    EVDSSGNPNWLFDYELMTDITSAASVTVAEFQSPATIDFSWPAQTIYASSNLITETDYTF  61

Query  608  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  429
               +VS   S+RKR+KS  CS +  SKA REK+RR RLN+RF  LS V+DPG+PPK +K 
Sbjct  62   ADSEVSKEASSRKRLKSECCS-SPRSKACREKLRRDRLNERFLALSSVLDPGRPPKTEKV  120

Query  428  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  249
            AILSDA RM+++LR E QKLKES E+LQE++ ELKAEKNEL+DEKQ+LKEEKD LE Q+K
Sbjct  121  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKQRLKEEKDNLEQQVK  180

Query  248  aLNSRPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-  75
            +L S+ GFL HP A    F     +  G KL+PF+GYP + MWQF  PAV+DT +DH L 
Sbjct  181  SLASKAGFLSHPSAMGAAFTAQGQVAAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHVLR  240

Query  74   PPVA  63
            PPVA
Sbjct  241  PPVA  244



>ref|XP_008365724.1| PREDICTED: transcription factor ILR3 [Malus domestica]
Length=229

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 156/238 (66%), Gaps = 10/238 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D G  D        P L+  + W    +   A  S+  D S    + 
Sbjct  1    MVSPE--NTNWLFDYGLID------DTPVLDGNFTWPVQPVAGSASVSVELDGSLGDAEG  52

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR++S +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRSESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++N++
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKSEKEKLEQQLKSMNAQ  171

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PGFLP PP     F       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  172  PGFLPPPPGIPAAFAAQGQAHGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_011095314.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=236

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 161/239 (67%), Gaps = 5/239 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GF+DI +P G F     G+ W   A+   +  S+  D S+ + DV
Sbjct  1    MVSPE--NTNWLYDYGFDDIHVPDGNFSAPASGFSWPVQALNGSSNVSVEIDGSFGESDV  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR ++  C+ ++ SKA REK RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  59   QKETGSKKRARTEPCAPSS-SKACREKQRRDRLNDKFMELGALLEPGRPPKTDKAAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-  237
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N+ 
Sbjct  118  AVRMVTQLRGEAQKLKDSNSNLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNAP  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFL  PPA    F       G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  QPGFLSAPPAIPAAFAAQSQAAGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_009358090.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=229

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 155/238 (65%), Gaps = 10/238 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D G  D        P L+  + W    I   A  S+  D S    + 
Sbjct  1    MVSPE--NTNWLFDYGLID------DTPVLDGNFTWPVQPIAGSASVSVELDGSLGDAEA  52

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR++S +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRSESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++ ++
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKSEKEKLEQQLKSMTAQ  171

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PGFLP PP     F       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  172  PGFLPPPPGIPAAFAAQGQAHGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_006360098.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=233

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 151/238 (63%), Gaps = 6/238 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GFED  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--NTNWLYDYGFEDSSVPDSNFSASASGFNWPVQNLNGSRNVSSEIDGSIGESDY  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR +  +C+  + SKA REK+RR +LND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKESGSKKRARVESCAPTS-SKACREKLRRDKLNDKFMELGALLEPGRPPKTDKSAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLRDEAQKLK+S  +LQE++ ELK EK EL+DEKQ+LK EK+KLE QLK  +++
Sbjct  118  AVRMVTQLRDEAQKLKDSNLNLQEKIKELKVEKTELRDEKQRLKAEKEKLEQQLKTTSAQ  177

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P FL  PPA    F       G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  PSFL--PPAIPSAFAAHGQFPGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>ref|XP_004244159.1| PREDICTED: transcription factor ILR3 [Solanum lycopersicum]
Length=233

 Score =   172 bits (437),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 150/238 (63%), Gaps = 6/238 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GFED  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--STNWLYDYGFEDSCVPDSNFSASASGFNWSVQNLNGSRNVSSEIDGSIGESDY  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR +  +C+  + SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKESGSKKRARVESCAPTS-SKACREKLRRDRLNDKFMELGALLEPGRPPKTDKSAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVR+V QLRDEAQKLK+S  +LQE++ ELK EK EL+DEK +LK EK+KLE QLK  +++
Sbjct  118  AVRLVTQLRDEAQKLKDSNLNLQEKIKELKVEKTELRDEKHRLKAEKEKLEQQLKTTSAQ  177

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P +L  PPA    F       G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  PSYL--PPAIPSAFAAHGQFPGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>gb|KDO59874.1| hypothetical protein CISIN_1g026646mg [Citrus sinensis]
Length=235

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 159/244 (65%), Gaps = 16/244 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  596  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELKAEKNEL+DEKQ+LK +K+KLE Q+
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLEQQV  171

Query  251  kaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-  75
            KA+++  GFLPHP + +  F     + G KLVPF+GYPG+ MWQF  PA +DT +DH L 
Sbjct  172  KAMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLR  231

Query  74   PPVA  63
            PPVA
Sbjct  232  PPVA  235



>ref|XP_006447466.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 ref|XP_006469731.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|ESR60706.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=235

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 158/244 (65%), Gaps = 16/244 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  596  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELKAEKNEL+DEKQ+LK +K+KL+ Q+
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLQQQV  171

Query  251  kaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-  75
            K +++  GFLPHP + +  F     + G KLVPF+GYPG+ MWQF  PA +DT +DH L 
Sbjct  172  KVMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLR  231

Query  74   PPVA  63
            PPVA
Sbjct  232  PPVA  235



>gb|EYU33597.1| hypothetical protein MIMGU_mgv1a013092mg [Erythranthe guttata]
Length=230

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 158/242 (65%), Gaps = 17/242 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQW--HssailspappsIRQDESYVKF  600
            M  PE   +NWL D GFEDI +P G      PG+ W          +  S+  D S  + 
Sbjct  1    MVTPE--NTNWLYDYGFEDITVPVGNLSSPSPGFSWPVQQPLNGGSSNASVEIDGSLGES  58

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            DV     ++KR ++ +C+  +++KA REK RR RLND+F EL  +++PG+PPK DKSAIL
Sbjct  59   DVQKETGSKKRARTESCA-PSNTKACREKQRRDRLNDKFMELGAILEPGRPPKTDKSAIL  117

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
            SDA+RMV QLR EAQKLK++  +LQE++ ELKAEKNEL+DEKQ+LK EK+K+E QLK +N
Sbjct  118  SDALRMVTQLRTEAQKLKDANLNLQEKIKELKAEKNELRDEKQRLKAEKEKVEQQLKTVN  177

Query  239  S--RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
               +PGFLP     A+P        G KLVP + YPG+ MWQF  PA +DT +DH L PP
Sbjct  178  GAPQPGFLPA--HQAMPG-------GNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPP  228

Query  68   VA  63
            VA
Sbjct  229  VA  230



>ref|XP_007211667.1| hypothetical protein PRUPE_ppa009077mg [Prunus persica]
 gb|EMJ12866.1| hypothetical protein PRUPE_ppa009077mg [Prunus persica]
Length=307

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 126/239 (53%), Positives = 163/239 (68%), Gaps = 5/239 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWL D G  +D P+  G FP    G+ W    +   +  S+  D S    +
Sbjct  72   MVSPE--NTNWLFDYGLIDDAPVLDGNFPVSSSGFTWPVQPLAGSSSVSVEIDGSLGDAE  129

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR+++ +CSG++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  130  GVKESGSKKRVRTESCSGSS-SKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILV  188

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  189  DAVRMVNQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKLEKEKLEQQLKAMNA  248

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLP PPA    F       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  249  QPGFLPPPPAIPAAFAAQGQAHGNKLVPFIGYPGVAMWQFMPPASVDTSQDHVLRPPVA  307



>ref|XP_004505433.1| PREDICTED: transcription factor ILR3-like [Cicer arietinum]
Length=237

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 151/234 (65%), Gaps = 4/234 (2%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFP-PLEPGYQWHssailspappsIRQDESYVKFDVSNGC  582
            + +NWL D G  +DIP+P   F  P      W +      +      D S    D     
Sbjct  5    ENTNWLFDYGLIDDIPVPDPTFAVPSSTLLTWPTHPFNISSNVGAEIDGSLGDSDSLKES  64

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
             ++KR++S +C+ A  SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRM
Sbjct  65   GSKKRVRSESCA-ATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVRM  123

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK++N++P FL
Sbjct  124  VTQLRGEAQKLKDSNTGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKSMNAQPSFL  183

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  184  PTPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_010909862.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=237

 Score =   171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 155/240 (65%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   SNW LD    +D+P+PG  F     G+ W+          S     S   FD
Sbjct  1    MGSPE--QSNWFLDCPLIDDMPVPGTDFAAPTGGFNWNPQGFNPYPDVSGEIHGSIANFD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KRM+S +CSG + SKA REKMRR RLN+RF ELS ++DPGKPPKMDK+ ILS
Sbjct  59   GHKEPGSQKRMRSESCSGPS-SKACREKMRRDRLNERFLELSSILDPGKPPKMDKATILS  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAV MV QLR EAQKLK+S + L+E++ ELKAEK+EL+DEKQ+LK EK+ LE QLK LNS
Sbjct  118  DAVHMVTQLRTEAQKLKQSNDSLEEKIKELKAEKSELRDEKQRLKVEKESLEQQLKLLNS  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            RP ++P PP     F       G KL +P +GYPG PMWQF  P  +DT +D  + PPVA
Sbjct  178  RPSYVPPPPVIPTAFAAQGQAAGQKLMMPVIGYPGFPMWQFMPPTDVDTSKDTETCPPVA  237



>ref|XP_004248337.1| PREDICTED: transcription factor ILR3-like [Solanum lycopersicum]
Length=231

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 153/238 (64%), Gaps = 8/238 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M  PE   +NWL D  +EDI  P   F     GY W           S+  D S  + D 
Sbjct  1    MVLPE--NTNWLYDYHYEDIVTPDVNFSV--SGYSWSMQGFNGSTNASVDIDGSLGESDC  56

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                  +KR ++ +C+ ++ SKA REK+RR +LN++F EL+ +++P +PPK DKSAIL D
Sbjct  57   VKESGCKKRTRAESCTSSS-SKACREKLRREKLNEKFMELAVLLEPSRPPKTDKSAILVD  115

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVR+V QLR EAQKLK+S  DLQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK ++++
Sbjct  116  AVRVVTQLRGEAQKLKDSNLDLQEKIKELKVEKNELRDEKQRLKSEKEKLEQQLKTMSAQ  175

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P FL  PPA    F +P    G KLVP + YPG+ MWQF  PA IDT +DH L PPVA
Sbjct  176  PSFL--PPAMPGAFASPVQAAGTKLVPIISYPGVAMWQFMPPAAIDTSQDHVLRPPVA  231



>ref|XP_009383663.1| PREDICTED: transcription factor ILR3-like [Musa acuminata subsp. 
malaccensis]
Length=238

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 151/232 (65%), Gaps = 5/232 (2%)
 Frame = -2

Query  746  NWLLDLGF-EDIPLPGGKFPPLEPG-YQWHssailspappsIRQDESYVKFDVSNGCSAR  573
            NW LD    +DIP  GG F   + G   W      + +  S+  D  +V  D      + 
Sbjct  8    NWFLDCSLIDDIPHAGGDFAANDVGGLCWPPQGFNTSSGVSVDIDSPFVNSDGLKEPGSA  67

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR++S +CS  A SKA REKMRR +LNDRF ELS ++DPG PPK DK+AILSDA R+V+Q
Sbjct  68   KRVRSESCSRPA-SKACREKMRREKLNDRFMELSSLLDPGNPPKTDKAAILSDAARVVIQ  126

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR+EAQKLK+S E LQE++ ELKAEKNEL++EKQKLK EK+ LE Q+K LN+RP F+P P
Sbjct  127  LRNEAQKLKDSNESLQEKIKELKAEKNELREEKQKLKAEKESLEQQVKLLNARPSFVPQP  186

Query  212  PATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            P     FP      G KL VP VGYP  PMWQF  PA +DT +D    PPVA
Sbjct  187  PLVPSLFPAQGQAAGHKLMVPVVGYPSFPMWQFMPPADVDTSQDADKCPPVA  238



>gb|KCW70120.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
 gb|KCW70121.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=237

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 160/240 (67%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED--IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKF  600
            M +PE   +NW+ D G  D    +  G F     GY W    +   +  S   D S+ + 
Sbjct  1    MVSPE--HTNWIYDCGLIDDIAAVADGDFQVSGSGYTWPVQPLNGSSIFSTEIDGSFGES  58

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D      ++KR+++ +C G + SKA REK+RR RLND+F EL+ +++PG+PPK DK+AIL
Sbjct  59   DGVKENGSKKRVRTESC-GTSSSKACREKLRRDRLNDKFLELASLLEPGRPPKADKAAIL  117

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  118  IDAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKAMN  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FLP PPA    F T     G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  AQPSFLPPPPAIPAAFATQGQAPGNKLVPFIGYPGVAMWQFMPPATVDTSQDHVLRPPVA  237



>ref|XP_007132981.1| hypothetical protein PHAVU_011G141300g [Phaseolus vulgaris]
 gb|ESW04975.1| hypothetical protein PHAVU_011G141300g [Phaseolus vulgaris]
Length=237

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 153/233 (66%), Gaps = 2/233 (1%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS  579
            + +NWL D G  +DIP+P   F      + W  +A+ + +   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDASFTVPSSAFTWPPNALNATSNVGVEIDGSLADSDGLKEAG  64

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ++KR++S  C+ A  SKA REK+RR +LND+F EL  +++P +P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSETCAAATSSKACREKLRRDKLNDKFVELGSILEPERPTKTDKAAILIDAVRMV  124

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR EAQKLK+S + LQE++ ELKAEKNEL+DEKQ LK EK+KLE QLK+LN++P F+P
Sbjct  125  TQLRGEAQKLKDSNQGLQEKIKELKAEKNELRDEKQMLKAEKEKLEQQLKSLNAQPNFMP  184

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  185  PPAAIPAAFAAQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_009791575.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
 gb|ACG60665.1| basic helix-loop-helix protein [Nicotiana tabacum]
Length=233

 Score =   167 bits (423),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 153/239 (64%), Gaps = 8/239 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GFE+  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--NTNWLYDYGFEESAVPDSNFSATASGFNWPMQNLNGSRNVSAEVDGSIGESDY  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR +  +C+  + SKA REK RR RLND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKENGSKKRARVESCAPTS-SKACREKQRRDRLNDKFTELGALLEPGRPPKTDKSAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQKLK EK+KLE QLK  N++
Sbjct  118  AVRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQKLKAEKEKLEQQLKTTNAQ  177

Query  233  PGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PGFLP     A     PH  V G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  PGFLPPAIPAAF---APHGQVPGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>ref|XP_003607701.1| Transcription factor ILR3 [Medicago truncatula]
 gb|ACJ84233.1| unknown [Medicago truncatula]
 gb|AES89898.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK34575.1| unknown [Medicago truncatula]
Length=237

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 152/234 (65%), Gaps = 4/234 (2%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKFDVSNGC  582
            + +NW+ D GF +DIP+P   F      + W +    + +     + D S    D     
Sbjct  5    ENTNWINDYGFYDDIPVPDSTFALPSSAFTWPTQPPFNLSSNVSAEVDGSLGDSDGLKES  64

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
             ++KR++S +C+ A  SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRM
Sbjct  65   GSKKRVRSESCA-ATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVRM  123

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++N+ P FL
Sbjct  124  VTQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQLKSMNAPPSFL  183

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  184  PTPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>gb|ADL36593.1| BHLH domain class transcription factor [Malus domestica]
Length=229

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 158/238 (66%), Gaps = 10/238 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            MA+PE   +NWL D G  D        P L+  + W    I   +  S+  D S    + 
Sbjct  1    MASPE--NTNWLFDYGLID------DTPVLDGNFAWPVQPIAGSSSASVELDGSLGDAEG  52

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR+++ +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRTESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK++   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK++N +
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKAEKNELRDEKQRLKSEKEKLEQQLKSMNVQ  171

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PGFLP PPA    F       G K+VPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  172  PGFLPPPPAIPAAFAAQSQARGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_007149692.1| hypothetical protein PHAVU_005G091000g [Phaseolus vulgaris]
 gb|AGZ15364.1| transcription factor ILR3 [Phaseolus vulgaris]
 gb|ESW21686.1| hypothetical protein PHAVU_005G091000g [Phaseolus vulgaris]
Length=231

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 153/240 (64%), Gaps = 12/240 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLD--LGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKF  600
            M +PE   SNWL D  L  +DI +  G F      + W               D S V  
Sbjct  1    MVSPE--NSNWLFDYPLIDDDITVGDGSF--TVSAFSWPPPPSNVSVEI----DASLVDS  52

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D     + +KR +S  C+ A+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL
Sbjct  53   DGLKDPALKKRGRSDLCT-ASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAIL  111

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLRDEAQKLKES   LQE++ ELK EKNEL+DEKQ+LK EK+KLELQ+K++N
Sbjct  112  IDAVRMVTQLRDEAQKLKESNTGLQEKIKELKTEKNELRDEKQRLKVEKEKLELQVKSMN  171

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FLP P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  172  AQPAFLPPPSAIPAAFAPQGQAPGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_010062960.1| PREDICTED: transcription factor ILR3-like [Eucalyptus grandis]
Length=237

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 159/240 (66%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED--IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKF  600
            M +PE   +NW+ D G  D    +  G F     GY W    +   +  S   D S+ + 
Sbjct  1    MVSPE--HTNWIYDCGLIDDIAAVADGDFQVSGSGYTWPVQPLNGSSIFSTEIDGSFGES  58

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D      ++KR+++ +C G + SKA REK+RR RLND+F EL+ +++PG+PPK DK+AIL
Sbjct  59   DGVKENGSKKRVRTESC-GTSSSKACREKLRRDRLNDKFLELASLLEPGRPPKADKAAIL  117

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA +
Sbjct  118  IDAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKATS  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FLP PPA    F T     G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  AQPNFLPPPPAMPAAFATQGQAPGNKLVPFLGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>ref|XP_008349949.1| PREDICTED: transcription factor ILR3-like [Malus domestica]
Length=229

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 122/238 (51%), Positives = 158/238 (66%), Gaps = 10/238 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            MA+PE   +NWL D G  D        P L+  + W    I   +  S+  D S    + 
Sbjct  1    MASPE--NTNWLFDYGLID------DTPVLDGNFAWPVQPIAGSSSASVELDGSLGDAEG  52

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR+++ +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRTESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK++   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK++N +
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKAEKNELRDEKQRLKSEKEKLEQQLKSMNIQ  171

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PGFLP PPA    F       G K+VPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  172  PGFLPPPPAIPAAFAAQGQARGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  229



>ref|XP_008793739.1| PREDICTED: transcription factor ILR3 [Phoenix dactylifera]
Length=237

 Score =   165 bits (418),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 157/240 (65%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NW+ D    +D+ +  G FP    G+ W+S  I S +  S+    S+V   
Sbjct  1    MGSPE--NTNWVFDCPLIDDMSVASGDFPAPGTGFYWNSQGINSSSNSSVEISGSFVDSA  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S + S    SKA REKMRR +LN++F EL  +++PGKPPKMDK+AILS
Sbjct  59   GIKESDSKKRVRSES-SCQPGSKACREKMRRDKLNNKFLELGSILEPGKPPKMDKAAILS  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S EDLQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+
Sbjct  118  DAVRMVTQLRSEAQKLKDSNEDLQEKIKELKAEKNELRDEKQRLKAEKENLEQQIKILNA  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            R  ++ HPP     F         KL +P +GYPG PMWQF  PA +DT +D  S PPVA
Sbjct  178  RASYVAHPPVIPAAFAAQGQTAAHKLMMPVIGYPGFPMWQFMPPADVDTSQDAESCPPVA  237



>ref|XP_009792846.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=235

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 154/240 (64%), Gaps = 8/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGG-KFPPLEPGYQWHss-ailspappsIRQDESYVKF  600
            MA+PE   +NWL D  FEDI +     F     G+ W       S    S+  D S  + 
Sbjct  1    MASPET--TNWLYDYNFEDITVSVDPNFSNSTTGFSWSMQPFNGSTTNISVDIDGSIGES  58

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D      ++KR ++ +C+ ++ SKA REK+RR +LND+F EL  +++PG+ PK DKSA+L
Sbjct  59   DCLKESGSKKRARAESCTSSS-SKACREKLRREKLNDKFMELGALLEPGRTPKTDKSALL  117

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV  LR EA+KLK+S  +LQE++ ELKAEKNEL+DEKQ+LK +K+KLE QLK +N
Sbjct  118  VDAVRMVTHLRGEAEKLKDSNLNLQEKIKELKAEKNELRDEKQRLKADKEKLEQQLKTMN  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++PGF   PP     F  P    G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  AQPGFF--PPVVPGAFAAPGQAAGSKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  235



>ref|XP_009630429.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=233

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 153/239 (64%), Gaps = 8/239 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D GFE+  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--NTNWLYDYGFEESAVPDSNFSATASGFNWPMQNLNGSRNVSAEVDGSIGESDC  58

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR +  +C+  + SKA REK RR RLND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKENGSKKRARVESCAPTS-SKACREKQRRDRLNDKFTELGALLEPGRPPKTDKSAILVD  117

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQKLK EK+KLE QLK ++++
Sbjct  118  AVRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQKLKAEKEKLEQQLKTMSAQ  177

Query  233  PGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PGFLP     A      H  V G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  PGFLPPAIPAAF---AAHGQVPGSKLVPIMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  233



>ref|XP_010323807.1| PREDICTED: transcription factor ILR3 isoform X2 [Solanum lycopersicum]
Length=237

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 154/245 (63%), Gaps = 21/245 (9%)
 Frame = -2

Query  761  EVDGS---NWLLDLGF-EDIP----LPGGKF-PPLEPGYQWHssailspappsIRQDESY  609
            EVD S   NWL D     DI     +   +F  P    + W +  I + +      D ++
Sbjct  2    EVDSSGNPNWLFDYELMTDITSAASVTVAEFQSPATIDFSWPAQTIYASSNLITETDYTF  61

Query  608  VKFDVSNGCSARKRM-KSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
               +VS   S+RKR  +S AC         REK+RR RLN+RF  LS V+DPG+PPK +K
Sbjct  62   ADSEVSKEASSRKRSPRSKAC---------REKLRRDRLNERFLALSSVLDPGRPPKTEK  112

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
             AILSDA RM+++LR E QKLKES E+LQE++ ELKAEKNEL+DEKQ+LKEEKD LE Q+
Sbjct  113  VAILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKQRLKEEKDNLEQQV  172

Query  251  kaLNSRPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQFAAPAVIDTPEDHSL  75
            K+L S+ GFL HP A    F     +  G KL+PF+GYP + MWQF  PAV+DT +DH L
Sbjct  173  KSLASKAGFLSHPSAMGAAFTAQGQVAAGNKLMPFIGYPSVAMWQFMQPAVVDTSQDHVL  232

Query  74   -PPVA  63
             PPVA
Sbjct  233  RPPVA  237



>ref|XP_009393337.1| PREDICTED: transcription factor ILR3-like [Musa acuminata subsp. 
malaccensis]
Length=230

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 143/223 (64%), Gaps = 10/223 (4%)
 Frame = -2

Query  746  NWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSARK  570
            NW LD    +DIP  G  F        W+       +  S+  D S+V  D      + K
Sbjct  8    NWFLDCSLIDDIPDAGADF-------GWNPQGFDPASSVSVEIDSSFVNSDGLKEPGSAK  60

Query  569  RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQL  390
            R +S +CS  A SKA REKMRR RLNDRF EL+ ++DPG PPKMDK+AILSDA R+V QL
Sbjct  61   RSRSESCSNPA-SKACREKMRRERLNDRFLELNSLLDPGNPPKMDKAAILSDAARLVTQL  119

Query  389  RDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPP  210
            R+EAQKLKES E LQE++ ELKAEKNEL+DEKQKLK E+  LE Q+K LN+R  ++P PP
Sbjct  120  RNEAQKLKESNESLQEKIKELKAEKNELRDEKQKLKAERGSLEQQVKLLNARSSYVPQPP  179

Query  209  ATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED  84
                P+       G KL VP +G+PG PMWQ+  P+ +DT +D
Sbjct  180  LVPTPYGAQGQAAGHKLMVPIIGFPGFPMWQYMPPSDVDTSQD  222



>gb|AFK48825.1| unknown [Lotus japonicus]
Length=238

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 150/235 (64%), Gaps = 5/235 (2%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQW--HssailspappsIRQDESYVKFDVSNG  585
            + +NWL D G  +DIP P   F     G+ W        S     +  D S    D    
Sbjct  5    ENTNWLFDYGLIDDIPAPEVTFTVPPSGFTWPSSQPLNSSSNVVGVEIDGSLGDSDSLKE  64

Query  584  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  405
              ++KR++S +CS A  SKA REK+RR +LND+F EL  +++PG+PPK DK+AIL DAVR
Sbjct  65   PGSKKRVRSESCS-ATSSKACREKLRRDKLNDKFVELGSILEPGRPPKTDKAAILIDAVR  123

Query  404  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGF  225
            MV QLR EAQK+K++   LQE++ ELK EKNEL+DEKQ+LK EK++LE QLK++N++P F
Sbjct  124  MVTQLRGEAQKMKDTNMGLQEKIKELKTEKNELRDEKQRLKTEKERLEQQLKSMNAQPSF  183

Query  224  LPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +P P A    F       G KLVPF+ YPG+ MWQF  PA  DT +DH L PPVA
Sbjct  184  MPPPQALPAAFAAQGQAHGNKLVPFISYPGVAMWQFLPPAARDTSQDHELRPPVA  238



>ref|XP_008800495.1| PREDICTED: transcription factor ILR3-like [Phoenix dactylifera]
Length=231

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 150/239 (63%), Gaps = 10/239 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   SNW+ D      PL        E G+ W    I S +  S+    S+V    
Sbjct  1    MVSPE--NSNWVFD-----CPLIDDDMSAPETGFYWTPQGINSSSNASVEISGSFVDSGG  53

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR++S + S    SKA REK+RR RLNDRF EL  +++PGKPPKMDK+AILSD
Sbjct  54   IKDSGSKKRVRSESSSQPG-SKACREKLRRDRLNDRFLELGSILEPGKPPKMDKAAILSD  112

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK+S E+LQE++ ELKAEKNEL++EKQ+LK EK+ LE Q+K LN+R
Sbjct  113  AVRMVTQLRSEAQKLKDSNENLQEKIKELKAEKNELREEKQRLKAEKENLEQQIKMLNTR  172

Query  233  PGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
              F+ HPP     F         KL +P + YPG PMWQF  PA +DT +D  S PPVA
Sbjct  173  ASFVAHPPVIPAAFAAQGQTAAHKLMMPVISYPGFPMWQFMPPADVDTSKDAESCPPVA  231



>gb|KDP39043.1| hypothetical protein JCGZ_00800 [Jatropha curcas]
Length=236

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 152/239 (64%), Gaps = 5/239 (2%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED-IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  D  P+    F     G+ W    +   +   +  D  +   +
Sbjct  1    MVSPE--NMNWLADYGLIDETPVLDANFSVPVSGFSWPVQTLNGSSDAGVEIDGPFGNSE  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                 S++KR +S +C GA+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  59   AQKESSSKKRGRSESC-GASSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA+R V QLR EAQ LK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA NS
Sbjct  118  DAIRRVTQLRGEAQTLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKAANS  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +  FLP PPA    F       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  QTSFLPPPPAIPAAFAAQGQASGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_006447467.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 gb|ESR60707.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=250

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 158/259 (61%), Gaps = 31/259 (12%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  596  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELK---------------Aeknelkde  297
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELK               AEKNEL+DE
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKGLDDHVQLSCCLSMQAEKNELRDE  171

Query  296  kqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  117
            KQ+LK +K+KL+ Q+K +++  GFLPHP + +  F     + G KLVPF+GYPG+ MWQF
Sbjct  172  KQRLKADKEKLQQQVKVMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQF  231

Query  116  AAPAVIDTPEDHSL-PPVA  63
              PA +DT +DH L PPVA
Sbjct  232  MPPAAVDTSQDHVLRPPVA  250



>ref|XP_003540036.1| PREDICTED: transcription factor ILR3 [Glycine max]
 gb|KHN20440.1| Transcription factor ILR3 [Glycine soja]
Length=236

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 157/233 (67%), Gaps = 3/233 (1%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS  579
            + +NWL D G  +DIP+P   F      + W  +A+ +P+   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDATFGVNSSAFTWPPNALDAPSNVGVDIDGSLGDSDGLKESG  64

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSESCA-ASSSKACREKLRRDRLNDKFVELGSILEPGRPAKTDKTAILIDAVRMV  123

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR EAQKLK++ + LQE++ +LKAEKNEL+D+KQ+LK EK+KLE QLK+LN +P F+P
Sbjct  124  TQLRGEAQKLKDTNQGLQEKIKDLKAEKNELRDQKQRLKAEKEKLEQQLKSLNGQPSFMP  183

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  184  PPAAIPAAFAVQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_003527314.1| PREDICTED: transcription factor ILR3-like isoform 1 [Glycine 
max]
 gb|KHN47843.1| Transcription factor ILR3 [Glycine soja]
Length=236

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 157/233 (67%), Gaps = 3/233 (1%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS  579
            + +NWL D G  +DIP+P   F      + W  +A+ + +   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDATFGVNSSAFTWPPNALNASSNVGVEIDGSLGDSDSLKESG  64

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSESCA-ASGSKACREKLRRDRLNDKFVELGAILEPGRPAKTDKAAILIDAVRMV  123

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR EAQKLK++ + LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK+LN++P F+P
Sbjct  124  TQLRGEAQKLKDTNQGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKSLNAQPSFMP  183

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  184  PPAAMPAAFAAQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  236



>ref|XP_008244399.1| PREDICTED: transcription factor ILR3 [Prunus mume]
Length=295

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 153/239 (64%), Gaps = 17/239 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWL D G  +D P+  G FP    G+ W    +   +  S+  D S    +
Sbjct  72   MVSPE--NTNWLFDYGLIDDTPVLDGNFPVSSSGFTWPVQPLAGSSSVSVEIDGSLGDAE  129

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR+++ +CSG++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  130  GVKESGSKKRVRTESCSGSS-SKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILV  188

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+L  EK+KLE QLKA N 
Sbjct  189  DAVRMVNQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLTLEKEKLEQQLKARN-  247

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                    PA    F       G KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  248  --------PAA---FAAQGQAHGNKLVPFIGYPGVAMWQFMPPASVDTSQDHVLRPPVA  295



>ref|XP_009597422.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=234

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 152/239 (64%), Gaps = 7/239 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGG-KFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            MA+PE   +NWL D  FED+ +     F     G+ W           S+  D S  + D
Sbjct  1    MASPET--TNWLYDYNFEDMAVSVDPNFSNSTSGFSWSMQPFNGSTNVSVDIDGSIGESD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR ++ +C+ ++ SKA REK+RR RLND+F EL  +++PG+ P+ DKSAIL 
Sbjct  59   CLKESGSKKRARAESCTSSS-SKACREKLRRERLNDKFLELGALLEPGRTPRTDKSAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EA+KLK+S  +LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N+
Sbjct  118  DAVRMVTQLRGEAEKLKDSNLNLQEKITELKAEKNELRDEKQRLKAEKEKLEQQLKTMNA  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +P F   PP        P    G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  178  QPSFF--PPGIPAAIAAPGQAAGSKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  234



>ref|XP_003596613.1| Transcription factor ILR3 [Medicago truncatula]
 gb|ACJ84355.1| unknown [Medicago truncatula]
 gb|AES66864.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK47306.1| unknown [Medicago truncatula]
Length=230

 Score =   159 bits (403),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 152/240 (63%), Gaps = 13/240 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED-IPLP-GGKFPPLEPGYQWHssailspappsIRQDESYVKF  600
            M +PE   +NWL D    D IP+   G F      + W               D S V  
Sbjct  1    MVSPE--NTNWLFDYPLIDEIPVSVDGSF-----AFTW--PPPHLSNGGIEMDDSSLVDS  51

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D      ++KR +S +C+ ++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL
Sbjct  52   DGIKEPGSKKRGRSDSCAPSS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAIL  110

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR EAQKLK+S   LQE++ ELK EKNEL+DEKQ+LK EK+KLE Q+K++N
Sbjct  111  IDAVRMVTQLRGEAQKLKDSNSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQVKSMN  170

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++PGFL HPPA    F         KL+PF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  171  TQPGFLTHPPAIPAAFAHQGQAPSNKLMPFMSYPGVAMWQFMPPAAVDTSQDHVLRPPVA  230



>gb|ACU23766.1| unknown [Glycine max]
Length=236

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 156/233 (67%), Gaps = 3/233 (1%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS  579
            + +NWL D G  +DIP+P   F      + W  +A+ + +   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDATFGVNSSAFTWPPNALNASSNVGVEIDGSLGDSDSLKESG  64

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSESCA-ASGSKACREKLRRDRLNDKFVELGAILEPGRPAKTDKAAILIDAVRMV  123

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR EAQKLK++ + LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK+LN++P F+P
Sbjct  124  TQLRGEAQKLKDTSQGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKSLNAQPSFMP  183

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH   PPVA
Sbjct  184  PPAAMPAAFAAQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVFRPPVA  236



>ref|XP_010923988.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=230

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 150/240 (63%), Gaps = 13/240 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M  PE   SNW+ D    +D+  PG        G+ W    I S +  S+    S+V   
Sbjct  1    MVLPE--NSNWVFDGSLIDDMSAPG-------TGFYWTPQGINSSSNASVEISGSFVDSG  51

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S + S    SKA REK+RR RLNDRF EL  +++PGKPPKMDK+AILS
Sbjct  52   GIKESGSKKRVRSESSSQPG-SKACREKLRRDRLNDRFLELGSILEPGKPPKMDKAAILS  110

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S E+LQE++ ELK EKNEL+DEKQ+LK EK+ LE Q+K LN+
Sbjct  111  DAVRMVTQLRSEAQKLKDSNENLQEKIKELKVEKNELRDEKQRLKAEKENLEQQIKMLNT  170

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            R  F+ HPP     F         KL +P + YPG PMWQF  PA +DT +D  S PPVA
Sbjct  171  RASFVAHPPVIPAAFAAQGQTAAHKLMMPVISYPGFPMWQFMPPADVDTSKDAESCPPVA  230



>ref|XP_008455829.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=238

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 153/232 (66%), Gaps = 6/232 (3%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPGGKF-PPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSAR  573
            NWL D    +D+ +   +F PP    + W + +I   +  S+  D SY   D +     R
Sbjct  9    NWLFDCSTMDDLAVVDPRFSPPQSISFSWSNPSISFVSKDSLEVDCSYEDLDSTKEV-GR  67

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR++ G  S A+ SKA REK RR +LN+RF EL+ V++PGKPPK DK AILSDA+RM+  
Sbjct  68   KRLR-GETSAASTSKACREKQRRDKLNERFLELAAVLEPGKPPKTDKVAILSDAIRMMTD  126

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            L+ E QKL+ES EDL+ ++ ELK EKNEL+DEKQ+L+ EK+KLELQ++A+N+R   + HP
Sbjct  127  LQCETQKLRESKEDLKAKIKELKVEKNELRDEKQRLRAEKEKLELQIRAVNTRAADVQHP  186

Query  212  PAT-AVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P T +  F       G KL+PF+GYPGI MWQF  PA +D  +DH L PPVA
Sbjct  187  PPTLSAAFTAQGQAAGNKLMPFIGYPGIAMWQFLPPAAVDISQDHVLRPPVA  238



>ref|XP_010092311.1| hypothetical protein L484_021173 [Morus notabilis]
 gb|EXB50945.1| hypothetical protein L484_021173 [Morus notabilis]
Length=239

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 146/242 (60%), Gaps = 8/242 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWL D G  +DIP+P   F     G+ W    +   +  S   D S    +
Sbjct  1    MVSPE--NTNWLFDYGLIDDIPVPDANFSVSSSGFTWPVQPLNGSSAVSAEIDGSLGDSE  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S   +GA+ SKA REK RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  59   GPKESGSKKRVRS-ESNGASSSKACREKQRRDRLNDKFVELGSILEPGRPPKTDKAAILI  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL--  243
            DAVRMV QLR EAQKLK+S   LQE++ ELKA   + +   +K + + +K +L+L+    
Sbjct  118  DAVRMVNQLRGEAQKLKDSNLSLQEKIKELKARVEKNELRDEKQRLKGEKEKLELQLKGM  177

Query  242  NSRP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            N++P GFLP P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PP
Sbjct  178  NAQPAGFLPPPAAIPAAFAAQGQAPGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPP  237

Query  68   VA  63
            VA
Sbjct  238  VA  239



>ref|XP_008454561.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=235

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 154/241 (64%), Gaps = 10/241 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWAIQTFNGAHDTGVEIDGSLADLD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL-N  240
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++  
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +PGFLP P  T   FP      G KL PF+GY P + MWQF  PA +DT +DH L PPV
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHILRPPV  234

Query  65   A  63
            A
Sbjct  235  A  235



>ref|XP_003607702.1| Transcription factor ILR3 [Medicago truncatula]
Length=261

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 155/258 (60%), Gaps = 28/258 (11%)
 Frame = -2

Query  755  DGSNWLLDLGF-EDIPLPGGKFP--------PLEPGYQWHssailspappsIRQ------  621
            + +NW+ D GF +DIP+P   F         P +P +   S+        + +Q      
Sbjct  5    ENTNWINDYGFYDDIPVPDSTFALPSSAFTWPTQPPFNLSSNVRSGVRCSNFKQCNFPWT  64

Query  620  -----------DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQEL  474
                       D S    D      ++KR++S +C+ A  SKA REK+RR RLND+F EL
Sbjct  65   DAVDMRMGAEVDGSLGDSDGLKESGSKKRVRSESCA-ATSSKACREKLRRDRLNDKFIEL  123

Query  473  SCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdek  294
              +++PG+P K DK+AIL DAVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEK
Sbjct  124  GSILEPGRPAKTDKAAILIDAVRMVTQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEK  183

Query  293  qklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFA  114
            Q+LK EK+KLE QLK++N+ P FLP P A    F       G KLVPF+ YPG+ MWQF 
Sbjct  184  QRLKAEKEKLEQQLKSMNAPPSFLPTPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQFM  243

Query  113  APAVIDTPEDHSL-PPVA  63
             PA +DT +DH L PPVA
Sbjct  244  PPAAVDTSQDHVLRPPVA  261



>ref|XP_004151873.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 gb|KGN63279.1| hypothetical protein Csa_2G423590 [Cucumis sativus]
Length=238

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 153/232 (66%), Gaps = 6/232 (3%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPGGKF-PPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSAR  573
            NWL D    +D+ +   +F PP    + W + +I   +  S+  D SY   D +     R
Sbjct  9    NWLFDYSTVDDLAVVDPRFSPPQSISFSWSNPSINFLSKDSLEVDCSYEDLDSTKEV-GR  67

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR++ G  S A+ SKA REK RR +LN+RF EL+ V++PGKPPK DK AILSDA+RM+  
Sbjct  68   KRLR-GETSAASTSKACREKQRRDKLNERFLELAAVLEPGKPPKSDKVAILSDAIRMMTD  126

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            L+ E QKL+ES EDL+ ++ ELK EKNEL+DEKQ+L+ EK+KLELQ++A+N+R   + HP
Sbjct  127  LQCETQKLRESKEDLKAKIKELKVEKNELRDEKQRLRAEKEKLELQIRAVNTRAADVQHP  186

Query  212  PAT-AVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P T +  F       G KL+PF+GYPGI MWQF  PA +D  +DH L PPVA
Sbjct  187  PPTLSAAFTAQGQSAGNKLMPFIGYPGIAMWQFLPPAAVDISQDHVLRPPVA  238



>gb|AEI83428.1| bHLH transcription factor 1 [Camellia sinensis]
Length=235

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 155/240 (65%), Gaps = 8/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWL D G  EDI +P   F     G+ W  +A  S        D S+   D
Sbjct  1    MVSPE--HTNWLFDYGLIEDISVPDPNFSAPTSGFCWPLNASSSVGLEI---DGSFGDSD  55

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR +  +C  ++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  56   SRKETGSKKRPRPESCGASSSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILV  115

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            +A+R+V+QLR +AQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK++LE QLK +N 
Sbjct  116  EAIRLVIQLRGDAQKLKDSNLTLQEKIKELKAEKNELRDEKQRLKAEKERLEQQLKTVNV  175

Query  236  RPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGF+P PPA            GG KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  176  QPGFMPPPPAIPATAFAAQGQAGGNKLVPIISYPGVAMWQFMPPASVDTSQDHVLRPPVA  235



>gb|KGN57970.1| hypothetical protein Csa_3G416140 [Cucumis sativus]
Length=230

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/240 (47%), Positives = 142/240 (59%), Gaps = 13/240 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNE +  K   +  + +++        
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNEKQRLKADKERLEQQVKSIPA---Q  174

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PGFLP P  T   FP      G KLVPF+GY P + MWQF  PA +DT +DH L PPVA
Sbjct  175  QPGFLPPPIPT---FPA-QGQAGNKLVPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  230



>gb|KGN57965.1| hypothetical protein Csa_3G415100 [Cucumis sativus]
Length=235

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 154/241 (64%), Gaps = 10/241 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GHLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL-N  240
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++  
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +PGFLP P  T   FP      G KL PF+GY P + MWQF  PA +DT +DH L PPV
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPV  234

Query  65   A  63
            A
Sbjct  235  A  235



>gb|KHG29871.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=237

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 149/224 (67%), Gaps = 8/224 (4%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQW-HssailspappsIRQDESYVKFDVSNGCSARKRMKSGAC  549
              DIP P G +     G+ W   +   S    S+  D S+   D      ++KR++S +C
Sbjct  19   INDIPAPDGPYS----GFSWPTQAINASSNVFSVDIDGSFEDSDGLKESGSKKRVRSESC  74

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            +  + SKA REK+RR RLN++F EL+ +++P +PPK DK+AIL DAVRMV QLR EAQKL
Sbjct  75   N-VSSSKACREKLRRDRLNEKFMELTSILEPERPPKTDKAAILVDAVRMVTQLRGEAQKL  133

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP  189
            K+S   L +++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N++P F+P  PA    F 
Sbjct  134  KDSNSSLHDRIKELKAEKNELRDEKQRLKAEKEKLEQQLKAMNAQPSFMPPAPAFPTAFA  193

Query  188  TPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            T    V G KLVPF GYPG+ MWQF  PA +DT EDH L PPVA
Sbjct  194  TAQGQVPGNKLVPFFGYPGVAMWQFMPPASVDTSEDHVLRPPVA  237



>gb|AES89899.2| BHLH domain class transcription factor [Medicago truncatula]
Length=193

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 128/173 (74%), Gaps = 2/173 (1%)
 Frame = -2

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ++KR++S +C+ A  SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  22   SKKRVRSESCA-ATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVRMV  80

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++N+ P FLP
Sbjct  81   TQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQLKSMNAPPSFLP  140

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P A    F       G KLVPF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  141  TPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  193



>ref|XP_004151959.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=234

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/241 (51%), Positives = 155/241 (64%), Gaps = 11/241 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL-N  240
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++  
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +PGFLP P  T   FP      G KLVPF+GY P + MWQF  PA +DT +DH L PPV
Sbjct  178  QQPGFLPPPIPT---FPA-QGQAGNKLVPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPV  233

Query  65   A  63
            A
Sbjct  234  A  234



>ref|XP_003547112.1| PREDICTED: transcription factor ILR3-like [Glycine max]
Length=212

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 152/232 (66%), Gaps = 24/232 (10%)
 Frame = -2

Query  752  GSNWLLDLGFED-IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSA  576
             SNW+LD  + D IPL       LEP      S+   P   S+  D+S+   D      +
Sbjct  3    NSNWVLDYDYLDNIPLT-----TLEPPNF-SWSSSSPPPTLSVELDDSFGILDGLKENRS  56

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR++       +DSKA REKMRR RLNDRF EL  ++DP KP KMDK+ ILSDAVR+V 
Sbjct  57   RKRLR------PSDSKACREKMRRDRLNDRFMELGSILDPRKPLKMDKAVILSDAVRVVS  110

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH  216
            QLR+EAQKL+ES E+LQE++N LK EKNEL+DEKQ+LK EK+ LE ++KAL+S+P FL  
Sbjct  111  QLREEAQKLRESTENLQEKINALKDEKNELRDEKQRLKVEKENLEQKVKALSSQPSFL--  168

Query  215  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                         +VG KLVPF+GYPG+ MWQF +PA +DT +DH L PPVA
Sbjct  169  --------AAAGQVVGSKLVPFMGYPGVAMWQFLSPAAVDTSQDHVLRPPVA  212



>ref|XP_006475303.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|KDO46376.1| hypothetical protein CISIN_1g026599mg [Citrus sinensis]
Length=236

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 162/241 (67%), Gaps = 9/241 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDL-GFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWLLD    +DI +P G F     G+ W     ++       + +S   F 
Sbjct  1    MVSPE--NTNWLLDYPLIDDITVPDGNFSVSASGFTWTVQPPINGPSNGCVEIDSA--FG  56

Query  596  VSNGC--SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             SNG   S++KR++S +C  ++ SKA REK+RR RLND+F EL+ +++PG+PPK DK+AI
Sbjct  57   DSNGLKESSKKRVRSESCGSSS-SKACREKLRRDRLNDKFVELASILEPGRPPKTDKAAI  115

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            L DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+K+E QLKA+
Sbjct  116  LIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAM  175

Query  242  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPV  66
            +++P FL  PPA    F       G KL+PF+ YPG+ MWQF  PA +DT +DH L PPV
Sbjct  176  STQPSFLTPPPAIPAAFAAQGQAPGNKLMPFISYPGVAMWQFMPPAAVDTSQDHVLRPPV  235

Query  65   A  63
            A
Sbjct  236  A  236



>gb|KJB12415.1| hypothetical protein B456_002G016500 [Gossypium raimondii]
Length=231

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 133/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S+   D      +RKR+KS +C G+  SKA REK+RR RLNDRF EL  V++P +P K
Sbjct  46   DCSFADSDCLKDVVSRKRLKSESCGGSG-SKAWREKLRRDRLNDRFLELGAVLEPERPMK  104

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK AILSDAVRMV QLR EAQ+LK+S E+LQ ++ ELK EKNEL+DEKQ+LK +K++LE
Sbjct  105  ADKVAILSDAVRMVRQLRSEAQRLKDSNEELQAKIKELKEEKNELRDEKQRLKADKEQLE  164

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
             Q+KA++++PGFL  PP+ +          G KL+P +G+P + MWQF  PA +DT +DH
Sbjct  165  QQVKAMSAQPGFLTQPPSISAALAAQRQAAGNKLMPVIGFPSLAMWQFMPPAAVDTSQDH  224

Query  80   SL-PPVA  63
             L PPVA
Sbjct  225  VLRPPVA  231



>gb|KJB81834.1| hypothetical protein B456_013G164100 [Gossypium raimondii]
Length=239

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 151/226 (67%), Gaps = 10/226 (4%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKFDVSNGCSARKRMKSGAC  549
             +DIP+P G +     G+ W +    +P+     + D S+   D      ++KR +S +C
Sbjct  19   IDDIPVPDGPYT----GFSWSTQPTNAPSTAVNVEVDNSFGDLDGLTESGSKKRGRSESC  74

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            + ++ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLRDEAQK+
Sbjct  75   NPSS-SKACREKLRRDRLNDKFMELGAILEPGRPPKTDKSAILVDAVRMVTQLRDEAQKM  133

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP  189
            K+S   LQE++ ELKAEKNEL++EKQ+LK EK+KLE QLK +N++P F+P  PA    F 
Sbjct  134  KDSNSSLQERIKELKAEKNELREEKQRLKAEKEKLEQQLKTMNAQPSFMPPAPAIPSAFA  193

Query  188  TPH---HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                     G KLVPF GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  194  AAAAQGQAHGNKLVPFFGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  239



>ref|XP_004151962.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=235

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 154/241 (64%), Gaps = 10/241 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GHLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL-N  240
            DAVRMV QLR E +KLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++  
Sbjct  118  DAVRMVNQLRGETEKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +PGFLP P  T   FP      G KL PF+GY P + MWQF  PA +DT +DH L PPV
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPV  234

Query  65   A  63
            A
Sbjct  235  A  235



>ref|XP_004173321.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=235

 Score =   154 bits (390),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 154/241 (64%), Gaps = 10/241 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVASSSFSWPIQPFNGAHDSGVEIDGSLADLD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL-N  240
            DAVRMV QLR E +KLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++  
Sbjct  118  DAVRMVNQLRGETEKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +PGFLP P  T   FP      G KL PF+GY P + MWQF  PA +DT +DH L PPV
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPV  234

Query  65   A  63
            A
Sbjct  235  A  235



>ref|XP_008454558.1| PREDICTED: transcription factor ILR3-like isoform X1 [Cucumis 
melo]
Length=234

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 152/241 (63%), Gaps = 11/241 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFTWAIQPFNGAHDTGVEIDGSLADVD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL-N  240
            DAVRMV QLR E  KLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++  
Sbjct  118  DAVRMVNQLRSETHKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +PGFLP  P     FP      G KL PFVGY P + MWQF  PA +DT +DH L PPV
Sbjct  178  QQPGFLPPIPT----FPAQGQAPGNKLFPFVGYHPSVAMWQFMPPAAVDTSQDHVLRPPV  233

Query  65   A  63
            A
Sbjct  234  A  234



>ref|XP_010443048.1| PREDICTED: transcription factor ILR3 [Camelina sativa]
Length=234

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 148/246 (60%), Gaps = 21/246 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S V  DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSVGVDV  48

Query  593  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEANKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDK  108

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  251  kaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH 
Sbjct  169  KAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHV  228

Query  77   L-PPVA  63
            L PPVA
Sbjct  229  LRPPVA  234



>ref|XP_010482878.1| PREDICTED: transcription factor ILR3-like [Camelina sativa]
Length=235

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 145/246 (59%), Gaps = 20/246 (8%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ DL   D     G F    PG+ W                 S    DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQQPIGVS-----SNSSAGVDV  49

Query  593  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  50   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDK  109

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  110  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  169

Query  251  kaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH 
Sbjct  170  KAMNAPQPSFFPAPPMMTTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHV  229

Query  77   L-PPVA  63
            L PPVA
Sbjct  230  LRPPVA  235



>ref|XP_011096123.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=221

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 151/222 (68%), Gaps = 11/222 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQD--ESYVK  603
            ++ P    ++W+ D    ED+P       PL+P ++W       P+P ++  +  +S+  
Sbjct  2    VSLPPEHSADWVFDYALLEDMP-------PLDPTFRWPHLQDAFPSPTTLSMEFGDSFGD  54

Query  602  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             D      +RKR++SGA SGA+DSKA +EK+RR RLNDRFQELS +++PG+PPKMDK+ I
Sbjct  55   PDCIKEHGSRKRLRSGA-SGASDSKAYKEKVRRDRLNDRFQELSSILEPGRPPKMDKAGI  113

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            L+DAVR+V+QLR+EAQKLKES ++LQ +VNELK EKNEL+DEK KLK EK+KLE Q+KAL
Sbjct  114  LNDAVRLVIQLREEAQKLKESHDNLQRKVNELKTEKNELRDEKLKLKAEKEKLEEQVKAL  173

Query  242  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  117
            +   GF  HP      F     L+  KLVP   YPGIPMWQF
Sbjct  174  SLPSGFSVHPLPVPASFAATSPLLSSKLVPLFRYPGIPMWQF  215



>ref|XP_004294336.1| PREDICTED: transcription factor ILR3-like [Fragaria vesca subsp. 
vesca]
Length=231

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 150/238 (63%), Gaps = 8/238 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL D G  D       FP     + W    +   +  S+  D S    + 
Sbjct  1    MVSPE--NTNWLYDYGLID----DANFPVSSSAFNWPVQPLPGSSSVSVELDGSLGDVEG  54

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR++  + S A  SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  55   LKESGSKKRVRCESSS-ATSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILID  113

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK+S   LQE++ ELK EK EL+DEKQ+LK EK+KLE QLKA+ ++
Sbjct  114  AVRMVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLKAMTAQ  173

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P F+P PPA    F       G K+VPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  174  PSFMPAPPAIPAAFAAQGQAHGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_004156771.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like 
[Cucumis sativus]
Length=227

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 4/212 (2%)
 Frame = -2

Query  692  PPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREK  513
            PP    + W + +I   +  S+  D SY   D +     RKR++ G  S A+ SKA REK
Sbjct  18   PPQSISFSWSNPSINFLSKDSLEVDCSYEDLDSTKEV-GRKRLR-GETSAASTSKACREK  75

Query  512  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  333
             RR +LN+RF EL+ V++PGKPPK DK AILSDA+RM+  L+ E QKL+ES EDL+ ++ 
Sbjct  76   QRRDKLNERFLELAAVLEPGKPPKSDKVAILSDAIRMMTDLQCETQKLRESKEDLKAKIK  135

Query  332  ELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPAT-AVPFPTPHHLVGGKLV  156
            ELK EKNEL+DEKQ+L+ EK+KLELQ++A+N+R   + HPP T +  F       G KL+
Sbjct  136  ELKVEKNELRDEKQRLRAEKEKLELQIRAVNTRAADVQHPPXTLSAAFTAQGQSAGNKLM  195

Query  155  PFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PF+GYPGI MWQF  PA +D  +DH L PPVA
Sbjct  196  PFIGYPGIAMWQFLPPAAVDISQDHVLRPPVA  227



>ref|XP_006401546.1| hypothetical protein EUTSA_v10014564mg [Eutrema salsugineum]
 dbj|BAJ33812.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42999.1| hypothetical protein EUTSA_v10014564mg [Eutrema salsugineum]
Length=234

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 147/246 (60%), Gaps = 21/246 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S    DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSAGVDV  48

Query  593  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
            S G S   +     K G C  S A  SKA REK+RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEASKEPGSKKRGRCESSSATGSKACREKLRRDRLNDKFTELGAILEPGNPPKTDK  108

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVAQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  251  kaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            K +N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH 
Sbjct  169  KTMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHV  228

Query  77   L-PPVA  63
            L PPVA
Sbjct  229  LRPPVA  234



>ref|XP_009127072.1| PREDICTED: transcription factor ILR3 [Brassica rapa]
Length=235

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 151/242 (62%), Gaps = 12/242 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsIRQDESYVKFD  597
            M +PE   +NW+ DL   D     G F    PG+ W     +   +  S   D S    +
Sbjct  1    MVSPE--NANWISDLIDADY----GGFTIQGPGFSWPVHQPLAVSSNSSAGVDGSAGNSE  54

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
             S    ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK DK+AIL 
Sbjct  55   ASKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILV  113

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  236  -RPGFLPHPPA--TAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
             +P F P PP   TA    T     G K+VPF+ YPG+ MWQF  PA +DT +DH L PP
Sbjct  174  PQPSFFPAPPMMPTAFASATQGQAPGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRPP  233

Query  68   VA  63
            VA
Sbjct  234  VA  235



>ref|XP_010694263.1| PREDICTED: transcription factor ILR3 [Beta vulgaris subsp. vulgaris]
Length=240

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = -2

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
            +++KR +S +C+ ++ SKA REK RR RLND+F EL  +++PG+ PK DK+AIL DAVRM
Sbjct  68   NSKKRGRSESCAPSS-SKACREKARRDRLNDKFMELGSILEPGRTPKTDKAAILIDAVRM  126

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V QLR EAQKLK+S   LQE++ ELK EKNEL+DEKQ+LK EKDKLE QLK +N++PG+L
Sbjct  127  VTQLRSEAQKLKDSNSSLQEKIKELKTEKNELRDEKQRLKAEKDKLEQQLKTMNTQPGYL  186

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P P A    F  P    GGKLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  187  PGPTAIPAAFAPPAQAPGGKLVPFMGYPGVAMWQFMPPASVDTSQDHVLRPPVA  240



>ref|XP_004487616.1| PREDICTED: transcription factor ILR3-like [Cicer arietinum]
Length=228

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 153/243 (63%), Gaps = 21/243 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKF----PPLEPGYQWHssailspappsIRQDESY  609
            M +PE   +NWL D    +DIP+P G F    PP +P                +  D S 
Sbjct  1    MVSPE--NTNWLFDYALMDDIPVPDGSFNFTWPPPDPS------------NVGVEIDGSL  46

Query  608  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  429
               D      ++KR +S +C+ ++ SKA REK+RR RLND+F EL  +++PG+PPK DK+
Sbjct  47   GDSDGIKDPGSKKRGRSDSCAPSS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKA  105

Query  428  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  249
            AIL DAVRMV QLR EAQKLK S   LQE++ ELK EKNEL+DEKQ+LK +K+KLE Q+K
Sbjct  106  AILIDAVRMVTQLRGEAQKLKASNSSLQEKIKELKVEKNELRDEKQRLKADKEKLEQQVK  165

Query  248  aLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
            ++N++PGFL  PPA    F         KL+PF+ YPG+ MWQF  PA +D  +DH L P
Sbjct  166  SMNTQPGFLTPPPAIPAAFAPQGQAPSNKLMPFISYPGVAMWQFVPPATMDISQDHELRP  225

Query  71   PVA  63
            PVA
Sbjct  226  PVA  228



>ref|XP_007148298.1| hypothetical protein PHAVU_006G196600g [Phaseolus vulgaris]
 gb|ESW20292.1| hypothetical protein PHAVU_006G196600g [Phaseolus vulgaris]
Length=215

 Score =   151 bits (381),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 129/173 (75%), Gaps = 14/173 (8%)
 Frame = -2

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ++KR++S  CS     KA +EKMRR RLNDRF EL  ++DPG+P KMDK+ ILSDAVR+V
Sbjct  56   SKKRLRS-PCS-----KACKEKMRRDRLNDRFLELGSILDPGRPLKMDKAVILSDAVRLV  109

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR+EA KL+ES E+LQ ++NELKAEKNEL++EKQ+LK EKD LE +++A +S+  FL 
Sbjct  110  SQLREEAHKLRESIENLQGKINELKAEKNELREEKQRLKAEKDSLEQKIEAFSSQSSFLR  169

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                    FP P  +VG KLVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  170  -------AFPGPGQVVGSKLVPFMGYPGVGMWQFLPPAAVDTSQDHVLRPPVA  215



>ref|XP_010448513.1| PREDICTED: transcription factor ILR3-like [Camelina sativa]
Length=235

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 145/246 (59%), Gaps = 20/246 (8%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ DL   D     G F    PG+ W                 S    DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQQPIGVS-----SNSSAGVDV  49

Query  593  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  50   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDK  109

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  110  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  169

Query  251  kaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH 
Sbjct  170  KAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHV  229

Query  77   L-PPVA  63
            L PPVA
Sbjct  230  LRPPVA  235



>ref|XP_007149945.1| hypothetical protein PHAVU_005G112500g [Phaseolus vulgaris]
 gb|ESW21939.1| hypothetical protein PHAVU_005G112500g [Phaseolus vulgaris]
Length=233

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 149/236 (63%), Gaps = 17/236 (7%)
 Frame = -2

Query  752  GSNWLLDLGFEDIPLPGGKFPPL--EPGYQWHssailspappsIRQDESYV--KFDVSNG  585
             S WL D GF DIP+ G  F       G+ W        AP +   D  Y      + NG
Sbjct  9    ASGWLYDYGF-DIPVAGADFMAAADSGGFSWGPQNHTLKAPSNTSLDMEYSLDSTVLENG  67

Query  584  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  405
             S  KR+++ +C+  A  KA REK+RR +LN+RF ELS +++PG+PPK DK AILSDAVR
Sbjct  68   PS--KRLRTESCASGA--KACREKLRRDKLNERFLELSSILEPGRPPKTDKVAILSDAVR  123

Query  404  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-RPG  228
             V+QLR+EA++LKE  ++LQ +V ELKAEKNEL+DEK  LKEEK+KLE Q+K  N  +  
Sbjct  124  AVVQLRNEAERLKEMNDELQGKVKELKAEKNELRDEKNMLKEEKEKLEQQVKLTNVMQHS  183

Query  227  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            FLP  PA          +   KL+PF+GYPGI MWQF  PA +DT +DH L PPVA
Sbjct  184  FLPQAPA------AKEQVGSHKLIPFIGYPGIAMWQFMPPAAVDTSKDHLLRPPVA  233



>ref|NP_175518.1| transcription factor bHLH115 [Arabidopsis thaliana]
 sp|Q9C682.1|BH115_ARATH RecName: Full=Transcription factor bHLH115; AltName: Full=Basic 
helix-loop-helix protein 115; Short=AtbHLH115; Short=bHLH 
115; AltName: Full=Transcription factor EN 134; AltName: Full=bHLH 
transcription factor bHLH115 [Arabidopsis thaliana]
 gb|AAG50538.1|AC079828_9 bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAM10965.1|AF488632_1 putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AAM62840.1| bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAO00793.1| bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAP13381.1| At1g51070 [Arabidopsis thaliana]
 gb|AEE32618.1| transcription factor bHLH115 [Arabidopsis thaliana]
Length=226

 Score =   151 bits (381),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 149/242 (62%), Gaps = 21/242 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL      D PL  G F    P + W      + +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIEGAFSDQNPTFPWQIDGSATVSVEV---DGFLCDADV  50

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                S+RKR+K+ +C+G+ +SKA REK RR RLND+F ELS V++PG+ PK DK AI++D
Sbjct  51   IKEPSSRKRIKTESCTGS-NSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAIIND  109

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV Q RDEAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK++++ QLKA+ ++
Sbjct  110  AIRMVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAIKTQ  169

Query  233  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            P     FLP+P   +          G KLVPF  YPG  MWQF  PA +DT +DH L PP
Sbjct  170  PQPQPCFLPNPQTLS-----QAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPP  224

Query  68   VA  63
            VA
Sbjct  225  VA  226



>ref|XP_006452147.1| hypothetical protein CICLE_v10009354mg [Citrus clementina]
 gb|ESR65387.1| hypothetical protein CICLE_v10009354mg [Citrus clementina]
Length=235

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 161/241 (67%), Gaps = 10/241 (4%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDL-GFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE   +NWLLD    +DI +P G F     G+ W     ++       + +S   F 
Sbjct  1    MVSPE--NTNWLLDYPLIDDITVPDGNFSVSASGFTWTVQPPINGPSNGCVEIDSA--FG  56

Query  596  VSNGC--SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             SNG   S++KR++S +C  ++ SKA REK+RR RLND+F EL+ +++PG+PPK DK+AI
Sbjct  57   DSNGLKESSKKRVRSESCGSSS-SKACREKLRRDRLNDKFVELASILEPGRPPKTDKAAI  115

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            L DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+K+E QLKA+
Sbjct  116  LIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAM  175

Query  242  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPV  66
            +++P FL   PA    F       G KL+PF+ YPG+ MWQF  PA +DT +DH L PPV
Sbjct  176  STQPSFLTP-PAIPAAFAAQGQAPGNKLMPFISYPGVAMWQFMPPAAVDTSQDHVLRPPV  234

Query  65   A  63
            A
Sbjct  235  A  235



>ref|XP_003543375.1| PREDICTED: transcription factor ILR3-like isoform X1 [Glycine 
max]
 ref|XP_006594876.1| PREDICTED: transcription factor ILR3-like isoform X2 [Glycine 
max]
Length=231

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 154/234 (66%), Gaps = 15/234 (6%)
 Frame = -2

Query  752  GSNWLLDLGFEDIPLPGGKFPPLEPG-YQW--HssailspappsIRQDESYVKFDVSNGC  582
             S+WL D GF DIP+ G  F   + G ++W   S     P+  S+  + S     + NG 
Sbjct  9    ASDWLYDYGF-DIPVAGSDFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSLDSTVMENGP  67

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
            S  KR+++ +C  A+ SKA REK+RR +LN+RF ELS +++P + PK DK AILSDA R+
Sbjct  68   S--KRLRTESC--ASGSKACREKLRRDKLNERFLELSSILEPSRQPKSDKVAILSDAARV  123

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V+QLR+EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K  N +P FL
Sbjct  124  VIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEQQVKVANIQPSFL  183

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P  P           +   KL+PF+GYPGI MWQF +PA +DT +DH L PPVA
Sbjct  184  PQAP------DAKGQVGSHKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  231



>ref|XP_002891614.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67873.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 150/242 (62%), Gaps = 21/242 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL      D PL  G F    P + W   A  + +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDQNPTFPWQIDASATVSVEV---DGFLCDSDV  50

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 +RKR+K+ +C+G+ +SKA REK RR RLND+F ELS +++PG+ PK DK AI++D
Sbjct  51   IKEPGSRKRIKTESCAGS-NSKACREKQRRDRLNDKFTELSSILEPGRAPKTDKVAIIND  109

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV Q R+EAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK++++ QLKA+ ++
Sbjct  110  AIRMVNQAREEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIDQQLKAIKTQ  169

Query  233  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            P     FLP+PP       +     G KLVPF  YPG  MWQF  PA +DT +DH L PP
Sbjct  170  PQPQSCFLPNPPTL-----SQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPP  224

Query  68   VA  63
            VA
Sbjct  225  VA  226



>gb|KJB45598.1| hypothetical protein B456_007G314800 [Gossypium raimondii]
Length=237

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 150/224 (67%), Gaps = 8/224 (4%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKFDVSNGCSARKRMKSGAC  549
              DIP P G +     G+ W +  I + +     + D S+   D      ++KR++S +C
Sbjct  19   INDIPAPDGPYS----GFSWPTRPINASSNVFSVEIDGSFEDSDGLKESGSKKRVRSESC  74

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            +  + SKA REK+RR +LN++F ELS +++P KPPK DK+AIL DAVRMV QLR EAQKL
Sbjct  75   N-VSSSKACREKLRRDKLNEKFMELSSILEPEKPPKTDKAAILVDAVRMVTQLRGEAQKL  133

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP  189
            K+S   L +++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+NS+P F+P  PA    F 
Sbjct  134  KDSISSLHDRIKELKAEKNELRDEKQRLKAEKEKLEQQLKAMNSQPSFMPPAPAFPAAFA  193

Query  188  TPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            T    V G KLVPF GYPG+ MWQF  PA +DT EDH L PPVA
Sbjct  194  TAQGQVPGNKLVPFFGYPGVAMWQFMLPASLDTSEDHVLRPPVA  237



>ref|XP_006393084.1| hypothetical protein EUTSA_v10011752mg [Eutrema salsugineum]
 dbj|BAJ34492.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30370.1| hypothetical protein EUTSA_v10011752mg [Eutrema salsugineum]
Length=229

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 150/242 (62%), Gaps = 18/242 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL      D PL  G F    P + W    I   A  S+  D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDQNPTFPWPIDQIDGSASVSVEVDGFLCDSDV  53

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 +RKR+KS  C G++ SKA REK RR +LN++F ELS +++PG+ PK DK AI++D
Sbjct  54   IKEPGSRKRIKSETCGGSS-SKACREKQRRDKLNEKFTELSSILEPGRLPKTDKVAIIND  112

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV Q+RDEAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK+++E QLKA+ ++
Sbjct  113  AIRMVNQVRDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIEQQLKAIKTQ  172

Query  233  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            P     FLP+PP       +     G KLVPF  YPG  MWQF  PA +DT +DH L PP
Sbjct  173  PQPQPLFLPNPPTM-----SQGQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPP  227

Query  68   VA  63
            VA
Sbjct  228  VA  229



>emb|CDY41004.1| BnaA02g27940D [Brassica napus]
Length=235

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 150/242 (62%), Gaps = 12/242 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsIRQDESYVKFD  597
            M +PE   +NW+ DL   D     G F    PG+ W     I   +  S   D S    +
Sbjct  1    MVSPE--NANWISDLIDADY----GSFTIQGPGFSWPVHQPIAVSSNSSAGVDGSAGNSE  54

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
             S    ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK DK+AIL 
Sbjct  55   TSKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILV  113

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK++   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDTNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  236  -RPGFLPHPPATAVPFPTPH--HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
             +P F P PP     F +       G K+VPF+ YPG+ MWQF  PA +DT +DH L PP
Sbjct  174  PQPSFFPAPPMMPTAFTSAAQGQAPGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRPP  233

Query  68   VA  63
            VA
Sbjct  234  VA  235



>gb|KJB81836.1| hypothetical protein B456_013G164100 [Gossypium raimondii]
Length=237

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 150/226 (66%), Gaps = 12/226 (5%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKFDVSNGCSARKRMKSGAC  549
             +DIP+P G +     G+ W +    +P+     + D S+   D      ++KR  S +C
Sbjct  19   IDDIPVPDGPYT----GFSWSTQPTNAPSTAVNVEVDNSFGDLDGLTESGSKKR--SESC  72

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            + ++ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLRDEAQK+
Sbjct  73   NPSS-SKACREKLRRDRLNDKFMELGAILEPGRPPKTDKSAILVDAVRMVTQLRDEAQKM  131

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP  189
            K+S   LQE++ ELKAEKNEL++EKQ+LK EK+KLE QLK +N++P F+P  PA    F 
Sbjct  132  KDSNSSLQERIKELKAEKNELREEKQRLKAEKEKLEQQLKTMNAQPSFMPPAPAIPSAFA  191

Query  188  TPH---HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                     G KLVPF GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  192  AAAAQGQAHGNKLVPFFGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  237



>emb|CDY28758.1| BnaA02g09500D [Brassica napus]
Length=235

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 150/242 (62%), Gaps = 12/242 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsIRQDESYVKFD  597
            M +PE   +NW+ DL   D     G F    PG+ W     +   +  S   D S    +
Sbjct  1    MVSPE--NANWISDLIDADY----GGFTIQGPGFSWPVHQPLAVSSNSSAGVDGSAGNSE  54

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
             S    ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK DK+AIL 
Sbjct  55   ASKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILV  113

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  236  -RPGFLPHPPATAVPFPTPH--HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
             +P F P PP     F +       G K+VPF+ YPG+ MWQF  PA +DT +DH L PP
Sbjct  174  PQPSFFPAPPMMPTAFASAAQGQAPGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRPP  233

Query  68   VA  63
            VA
Sbjct  234  VA  235



>ref|XP_008776472.1| PREDICTED: transcription factor ILR3-like [Phoenix dactylifera]
Length=237

 Score =   149 bits (377),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 153/240 (64%), Gaps = 6/240 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFD  597
            M +PE    NW LD    +D+P+P   F     G  W+          S+  + S    D
Sbjct  1    MGSPE--HPNWFLDCPLIDDMPVPETDFAAPTGGLNWNPQGFNPYPDVSVEINGSIANSD  58

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
                  ++KRM+S +CSG + SKA REKMRR RLN+RF +LS ++DPGKPPKMDK+ IL+
Sbjct  59   GHKEPGSQKRMRSESCSGPS-SKACREKMRRDRLNERFLDLSSILDPGKPPKMDKATILN  117

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAV MV QLR EAQKLKES E LQ+++NELKAEK+EL+DEKQ+LK EK+ LE QLK LN 
Sbjct  118  DAVHMVTQLRTEAQKLKESNESLQDKINELKAEKSELRDEKQRLKAEKESLEQQLKLLNP  177

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            +P ++P PP     F       G KL +P + +PG PMWQF  PA +DT +D  + PPVA
Sbjct  178  QPSYVPPPPVMPAAFSAQGQPTGQKLMMPVISFPGFPMWQFMPPADVDTSKDAETCPPVA  237



>ref|XP_010500676.1| PREDICTED: transcription factor bHLH115-like [Camelina sativa]
Length=227

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 145/242 (60%), Gaps = 20/242 (8%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL      D PL  G F    P + W      S +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLVDGAFSDHNPSFPWQIDVSSSVSVE---VDGFLCDSDV  50

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 +RKR+K+ +C+  + SKA REK RR RLND+F ELS +++PG+ PK DK AI++D
Sbjct  51   IKEPGSRKRIKTESCTAGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVAIIND  110

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV   RDEAQKLK+    LQE++ E+K EK+EL+DEK KLK EK+++E QLK + ++
Sbjct  111  AIRMVNHARDEAQKLKDLNSSLQEKIKEVKDEKSELRDEKHKLKIEKERMEQQLKEIKTQ  170

Query  233  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            P     FLP+PP+      +     G KLVPF  YPG  MWQF  PA +DT +DH L PP
Sbjct  171  PQPQPCFLPNPPSL-----SQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPP  225

Query  68   VA  63
            VA
Sbjct  226  VA  227



>gb|AAM64276.1| bHLH transcription factor, putative [Arabidopsis thaliana]
Length=234

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 146/246 (59%), Gaps = 21/246 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S    D 
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSAGVDG  48

Query  593  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDK  108

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  251  kaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH 
Sbjct  169  KAINAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHV  228

Query  77   L-PPVA  63
            L PPVA
Sbjct  229  LRPPVA  234



>ref|NP_200279.1| transcription factor ILR3 [Arabidopsis thaliana]
 ref|XP_002864351.1| hypothetical protein ARALYDRAFT_495549 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9FH37.1|ILR3_ARATH RecName: Full=Transcription factor ILR3; AltName: Full=Basic 
helix-loop-helix protein 105; Short=AtbHLH105; Short=bHLH 105; 
AltName: Full=Protein IAA-LEUCINE RESISTANT 3; AltName: Full=Transcription 
factor EN 133; AltName: Full=bHLH transcription 
factor bHLH105 [Arabidopsis thaliana]
 gb|AAM10964.1|AF488629_1 putative bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAB09934.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96776.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72200.1| Unknown protein [Arabidopsis thaliana]
 gb|EFH40610.1| hypothetical protein ARALYDRAFT_495549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96526.1| transcription factor ILR3 [Arabidopsis thaliana]
Length=234

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 146/246 (59%), Gaps = 21/246 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S    D 
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSAGVDG  48

Query  593  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  432
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDK  108

Query  431  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  252
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  251  kaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH 
Sbjct  169  KAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHV  228

Query  77   L-PPVA  63
            L PPVA
Sbjct  229  LRPPVA  234



>gb|AFK34442.1| unknown [Lotus japonicus]
Length=226

 Score =   149 bits (375),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 145/237 (61%), Gaps = 16/237 (7%)
 Frame = -2

Query  761  EVDGSN---WLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVS  591
            E+D S    WL D GF+DI +       +     +               D +  +    
Sbjct  2    EIDSSGDSCWLYDYGFDDISVAAAADFMVADSADFTWVPSNMNLEMEYSLDSTVFE----  57

Query  590  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  411
            +G S R R +S + SG   SKA REK+RR +LN+RF EL  +++PG+ PK DK+AI+SDA
Sbjct  58   SGPSKRLRTES-SVSG---SKACREKLRRDKLNERFLELGSILEPGRQPKTDKAAIISDA  113

Query  410  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP  231
            VR+V QLR+EA+KLKE   DLQE++ ELKAEKNE++DEK KLK +K+KLE ++K  N +P
Sbjct  114  VRVVTQLRNEAEKLKEMNNDLQEKIKELKAEKNEIRDEKNKLKLDKEKLEKKVKLRNVQP  173

Query  230  GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            GFLPH  A         H    KL+P++GYPGI MWQF   AV+DT  DH L PPVA
Sbjct  174  GFLPHADAAVKGKGAASH----KLIPYIGYPGIAMWQFMPSAVLDTSRDHLLRPPVA  226



>emb|CAN70830.1| hypothetical protein VITISV_005283 [Vitis vinifera]
Length=384

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 145/235 (62%), Gaps = 30/235 (13%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP--GYQWHssailspappsIRQDESYVK  603
            MA    + SNWL D G  EDI +PGG+FP   P  G+ W S A+ S +  S+  D S+  
Sbjct  1    MALDSSENSNWLFDYGLMEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSF--  58

Query  602  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
                                  DS   +E   R     RF EL  +++PG+PPK DK+AI
Sbjct  59   ---------------------GDSDGLKELGPRK----RFLELGSILEPGRPPKTDKAAI  93

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            LSDAVRMV QLR EAQKLKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA+
Sbjct  94   LSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVKAI  153

Query  242  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS  78
            +++PGFLPHP A    F       G KL+PF+GYP + MWQF  PA +DT +DH+
Sbjct  154  SAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQFMPPAAVDTSQDHN  208



>ref|XP_009132430.1| PREDICTED: transcription factor ILR3-like [Brassica rapa]
Length=238

 Score =   149 bits (375),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 150/249 (60%), Gaps = 23/249 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE    NW+ DL   D    GG F    P + W         P  +    S V  D 
Sbjct  1    MVSPE--NGNWICDLIEADY---GGSFTIQAPAFSW-----PLHQPIGVSSHNSSVGVDG  50

Query  593  SNGCS--------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  438
            S G S        +RKR++    S A +SKA REK RR RLND+F EL  +++PG PPK 
Sbjct  51   SAGISEASKDPPLSRKRVRC-ELSSATNSKACREKQRRDRLNDKFMELGVILEPGHPPKT  109

Query  437  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  258
            DK+AIL DA+RMV QLR EAQKLK+S   L +++ ELK EKNEL+DEKQ+LK EK+KLEL
Sbjct  110  DKAAILVDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKEKLEL  169

Query  257  qlkaLNS--RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
            QLKA+N+  +P F P PP     F +      G K+VPF+ YPG+ MWQF  PA +DT +
Sbjct  170  QLKAMNAPPQPSFFPAPPMMPTAFASAQGQAPGNKMVPFISYPGVAMWQFMPPASVDTSQ  229

Query  86   DHSL-PPVA  63
            DH L PPVA
Sbjct  230  DHVLRPPVA  238



>emb|CDY43028.1| BnaA03g11750D [Brassica napus]
Length=238

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 150/249 (60%), Gaps = 23/249 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE    NW+ DL   D    GG F    P + W         P  +    S V  D 
Sbjct  1    MVSPE--NGNWICDLIEADY---GGSFTIQAPAFSW-----PLHQPIGVSSHNSSVGVDG  50

Query  593  SNGCS--------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  438
            S G S        +RKR++  + S A  SKA REK RR RLND+F EL  +++PG PPK 
Sbjct  51   SAGISEASKDPPLSRKRVRCES-SSATSSKACREKQRRDRLNDKFMELGVILEPGHPPKT  109

Query  437  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  258
            DK+AIL DA+RMV QLR EAQKLK+S   L +++ ELK EKNEL+DEKQ+LK EK+KLEL
Sbjct  110  DKAAILVDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKEKLEL  169

Query  257  qlkaLNS--RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
            QLKA+N+  +P F P PP     F +      G K+VPF+ YPG+ MWQF  PA +DT +
Sbjct  170  QLKAMNAPPQPSFFPAPPMMPTAFASAQGQAPGNKMVPFISYPGVAMWQFMPPASVDTSQ  229

Query  86   DHSL-PPVA  63
            DH L PPVA
Sbjct  230  DHVLRPPVA  238



>gb|KJB13568.1| hypothetical protein B456_002G081900 [Gossypium raimondii]
Length=238

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 151/225 (67%), Gaps = 9/225 (4%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKFDVSNGCSARKRMKSGAC  549
             +DIP+P   +     G+ W +  I +P+     + D S+   D      ++KR++S +C
Sbjct  19   IDDIPVPDDPYA----GFAWSTQPIDAPSNVVSVEIDGSFGDSDGLKESGSKKRVRSESC  74

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            + A+ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLR EAQKL
Sbjct  75   N-ASSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSAILIDAVRMVTQLRGEAQKL  133

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL--PHPPATAVP  195
            K+S   LQE++ ELK+EKNEL+DEKQ+LK EK++LE QLKA+N++P F+    P   A  
Sbjct  134  KDSNTSLQERIKELKSEKNELRDEKQRLKAEKERLEQQLKAMNAQPSFMPPAPPAIPAAF  193

Query  194  FPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
               P    G KLVP +GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  194  AAAPGQAPGNKLVPLIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  238



>gb|KFK35883.1| hypothetical protein AALP_AA4G049100 [Arabis alpina]
Length=230

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 149/242 (62%), Gaps = 17/242 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYV-KFD  597
            M +PE   +NWL      D PL  G F      + W     +  +     + + ++   D
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDQNHTFPWQIDHHIDGSASVSVEVDGFLCDSD  53

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
            V     +RKR+KS AC G ++SKA +EK RR RLND+F ELS VM+PG+PPK DK AIL+
Sbjct  54   VIKEPGSRKRLKSEAC-GGSNSKACKEKQRRDRLNDKFTELSNVMEPGRPPKTDKVAILN  112

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL--  243
            DA+RMV Q R+EAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK+++E QLKA+  
Sbjct  113  DAIRMVNQAREEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIEQQLKAIKP  172

Query  242  NSRPGFLPHPPA-TAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
              +P FLP P   T      P    G KLVPF  YPG  MWQF  PA IDT +DH L PP
Sbjct  173  QPQPCFLPTPQTLTQAQAQAP----GSKLVPFTTYPGFAMWQFMPPATIDTSQDHVLRPP  228

Query  68   VA  63
            VA
Sbjct  229  VA  230



>emb|CDY43809.1| BnaC03g14420D [Brassica napus]
Length=238

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 148/243 (61%), Gaps = 21/243 (9%)
 Frame = -2

Query  755  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS-  579
            +  NW+ DL   D    GG F    PG+ W         P  +  + S V  D S G S 
Sbjct  5    ENGNWICDLIDADY---GGSFTIQGPGFSW-----PLHQPIGVSSNNSSVGVDGSAGSSE  56

Query  578  -------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
                   +RKR +  + S A +SKA REK RR RLND+F EL+ +++PG PPK DK+AIL
Sbjct  57   ASKEPPVSRKRSRCES-SSATNSKACREKQRRDRLNDKFMELAVILEPGHPPKTDKAAIL  115

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DA+RMV QLR EAQKLK+S   L +++ ELK EKNEL+DEKQ+LK EKDKLE QLKA+N
Sbjct  116  VDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKDKLEQQLKAMN  175

Query  239  S--RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
            +  +P F P  P     F +      G K+VPF+ YPG+ MWQF  PA +DT +DH L P
Sbjct  176  APPQPSFFPASPMMPTAFASAQGQAPGNKMVPFISYPGVAMWQFMPPASVDTSQDHVLRP  235

Query  71   PVA  63
            PVA
Sbjct  236  PVA  238



>gb|AHZ94970.1| helix-loop-helix-like protein, partial [Lilium regale]
Length=169

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 125/172 (73%), Gaps = 6/172 (3%)
 Frame = -2

Query  569  RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQL  390
            R +SG   G   SKA REKMRR +LNDRF EL  ++DPGKPPKMDK+AILSDA  MV QL
Sbjct  1    RSESGNVPG---SKACREKMRRDKLNDRFMELGSILDPGKPPKMDKAAILSDAALMVTQL  57

Query  389  RDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPP  210
            R EAQKLK+S E LQE++ ELK+EK+EL+DEKQ+LK+EK+ LE Q+K L++RP ++PHPP
Sbjct  58   RSEAQKLKDSNESLQEKIKELKSEKSELRDEKQRLKQEKENLEQQVKMLSARPSYMPHPP  117

Query  209  AT-AVPFPTPHHLVGGK-LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
               A  F       G K ++P + YPG PMWQF  P+ +DT +D  S PPVA
Sbjct  118  VLPAAAFAAQGQPAGHKMMMPVISYPGFPMWQFMPPSDVDTSQDAESCPPVA  169



>ref|XP_006659812.1| PREDICTED: transcription factor ILR3-like [Oryza brachyantha]
Length=246

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 152/245 (62%), Gaps = 26/245 (11%)
 Frame = -2

Query  752  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKF-DVSNGC  582
            G  W LD G  ED+P    G FP       W +S   S       +  S+V   D     
Sbjct  13   GDEWFLDCGILEDLPAAACGAFP-------WDASPSCSNPSV---EVSSFVNTSDALKEP  62

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
             + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RM
Sbjct  63   GSNKRVRSGSC-GRPTSKACREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRM  121

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            V+QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++
Sbjct  122  VIQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQMKIMTSTPAYM  181

Query  221  PHPPATAVPFP----TPHHLVGGK-------LVPFVGYPGIPMWQFAAPAVIDTPEDH-S  78
            PHP     PFP     P H   G+       ++PFVGYPG PMWQF  P+ +DT +D+ S
Sbjct  182  PHPTLMPAPFPQAPLAPFHPAQGQQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDNES  241

Query  77   LPPVA  63
             PPVA
Sbjct  242  CPPVA  246



>emb|CDY47456.1| BnaC09g31010D [Brassica napus]
Length=233

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 148/248 (60%), Gaps = 26/248 (10%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NW+ +L   D     G F    PG+ W                 S V  D 
Sbjct  1    MVSPE--NANWISELIDADY----GSFTIQGPGFSWPVHQQPIGV--------SSVGVDG  46

Query  593  SNGCS-------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  435
            S G S       ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK D
Sbjct  47   SAGNSEATKEPVSKKRARCDSSS-ATSSKACREKQRRDRLNDKFTELSVILEPGNPPKTD  105

Query  434  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  255
            K+AIL DAVRMV QLR EAQKLK+S   LQ ++NELK EKNEL+DEKQ+LK EK+KLE Q
Sbjct  106  KAAILVDAVRMVTQLRGEAQKLKDSNSSLQGKINELKTEKNELRDEKQRLKTEKEKLEQQ  165

Query  254  lkaLNS--RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPED  84
            LKA+N+  +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +D
Sbjct  166  LKAMNAPPQPSFFPGPPMMPTAFASAQGQAPGNKMVPVISYPGVAMWQFMPPASVDTSQD  225

Query  83   HSL-PPVA  63
            H L PPVA
Sbjct  226  HVLRPPVA  233



>ref|XP_006280790.1| hypothetical protein CARUB_v10026758mg [Capsella rubella]
 gb|EOA13688.1| hypothetical protein CARUB_v10026758mg [Capsella rubella]
Length=332

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 147/248 (59%), Gaps = 21/248 (8%)
 Frame = -2

Query  779  ERMAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKF  600
            + M +PE   +NW+ DL   D     G F    PG+ W     +  +        S +  
Sbjct  97   QEMVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSIGV  144

Query  599  DVSNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  438
            D S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK 
Sbjct  145  DGSAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKT  204

Query  437  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  258
            DK+AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE 
Sbjct  205  DKAAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQ  264

Query  257  qlkaLNS-RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPED  84
            QLK +N+ +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +D
Sbjct  265  QLKTMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQD  324

Query  83   HSL-PPVA  63
            H L PPVA
Sbjct  325  HVLRPPVA  332



>ref|XP_007021087.1| DNA binding protein, putative [Theobroma cacao]
 gb|EOY12612.1| DNA binding protein, putative [Theobroma cacao]
Length=235

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 136/189 (72%), Gaps = 3/189 (2%)
 Frame = -2

Query  623  QDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPP  444
             D S+   D      ++KR++S +C+ ++ SKA REK+RR RLND+F EL  +++PG+PP
Sbjct  48   NDGSFGDLDGLKESGSKKRVRSESCNPSS-SKACREKLRRDRLNDKFMELGSILEPGRPP  106

Query  443  KMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkl  264
            K DK+AIL DAVRMV QLR EAQKLK+S   LQE++ ELK+EKNEL+DEKQ+LK EK++L
Sbjct  107  KTDKAAILIDAVRMVTQLRGEAQKLKDSNSSLQEKIKELKSEKNELRDEKQRLKAEKERL  166

Query  263  elqlkaLNSRPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
            E QLK +N++P F+P  PA    F        G KLVPF+GYPG+ MWQF  PA +DT +
Sbjct  167  EQQLKTMNAQPSFMPPGPAIPAAFAAAQGQAPGNKLVPFIGYPGVAMWQFMPPAAVDTSQ  226

Query  86   DHSL-PPVA  63
            DH L PPVA
Sbjct  227  DHVLRPPVA  235



>ref|XP_006847910.1| hypothetical protein AMTR_s00029p00112130 [Amborella trichopoda]
 gb|ERN09491.1| hypothetical protein AMTR_s00029p00112130 [Amborella trichopoda]
Length=225

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 125/175 (71%), Gaps = 4/175 (2%)
 Frame = -2

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
            S+RKR +  +C  A  SKA REKMRR RLNDRF EL  ++DPG+PPK DK+ ILSDA R 
Sbjct  53   SSRKRARDESCC-APGSKACREKMRRDRLNDRFLELGSILDPGRPPKADKATILSDAARA  111

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GF  225
            + QLR EAQKLKE+ E LQE + +LK EKNEL+DEK +LK +K++LE Q+KA++  P GF
Sbjct  112  LSQLRIEAQKLKEANEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVKAMSMAPTGF  171

Query  224  LPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +PHP A    F  P  + G K VP+ GYP + MWQ+  P V+DT +DH L PPVA
Sbjct  172  IPHPAAIHA-FAAPSQVGGAKAVPYSGYPAMTMWQWMPPTVVDTSQDHKLRPPVA  225



>ref|XP_010062961.1| PREDICTED: transcription factor ILR3-like isoform X1 [Eucalyptus 
grandis]
Length=239

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 158/242 (65%), Gaps = 8/242 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLP----GGKFPPLEPGYQWHssailspappsIRQDESYV  606
            M +PE   +NW+ D G  D        GG F     G+ W    +   +  S   D S  
Sbjct  1    MVSPE--QANWIYDCGLIDDIAAAAADGGPFQVSGSGFSWPDQPLNGSSIFSAEIDGSLG  58

Query  605  KFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  426
              D      ++KR++S +CS A+ SKA REK+RR RLND+F EL+ +++PG+PPK DK+A
Sbjct  59   DSDGVKENGSKKRVRSESCS-ASSSKACREKLRRDRLNDKFLELASILEPGRPPKTDKAA  117

Query  425  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  246
            IL D VRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA
Sbjct  118  ILIDVVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKA  177

Query  245  LNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            +N++P FLP PPA    F T     G KLVPF+GYPG+ MWQF  PA +DT +DH L PP
Sbjct  178  MNAQPSFLPPPPAIPAAFATQGQAPGNKLVPFIGYPGVAMWQFMPPATVDTSQDHVLRPP  237

Query  68   VA  63
            VA
Sbjct  238  VA  239



>ref|NP_001242620.1| uncharacterized protein LOC100806838 [Glycine max]
 gb|ACU21305.1| unknown [Glycine max]
Length=231

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 107/229 (47%), Positives = 147/229 (64%), Gaps = 11/229 (5%)
 Frame = -2

Query  743  WLLDLGFEDIPLPGGKFPPLEPG-YQWHssailspappsIRQDESYVKFDVSNGCSARKR  567
            WL   GF DIP+ G  F   + G + W   +     P ++  +  Y    +       KR
Sbjct  12   WLYVYGF-DIPVAGSDFMASDSGGFSWGPQSYNFKGPSNMSLEMEYSLDSIVMENGPSKR  70

Query  566  MKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLR  387
            +++ +C  A+ SKA REK+RR +LN+RF ELS +++PG+ PK DK A+LSDA R+V+QLR
Sbjct  71   LRTESC--ASGSKACREKLRRDKLNERFLELSSILEPGRQPKTDKVALLSDAARVVIQLR  128

Query  386  DEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPA  207
            +EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K  N +P FLP  P 
Sbjct  129  NEAERLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEKQVKLTNIQPSFLPQAP-  187

Query  206  TAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                      +   KL+PF+GYPGI MWQF +PA +DT +DH L PPVA
Sbjct  188  -----DAKGQVGSHKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  231



>dbj|BAK03093.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 152/251 (61%), Gaps = 25/251 (10%)
 Frame = -2

Query  773  MAAPEVDG-SNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVK  603
            M+ P  DG  +W LD G  ED+P    G FP       W +S   S       +  SYV 
Sbjct  1    MSLPPTDGGDDWFLDCGILEDLPAAACGAFP-------WDASVSSSNPSA---EVGSYVN  50

Query  602  -FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  426
              DV    S+ KR++SG C G   SKA REK+RR +LNDRF EL   +DPGKP K DK+A
Sbjct  51   NSDVPKDSSSNKRLRSGPC-GRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKADKAA  109

Query  425  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  246
            ILSDA RMV QLR EA++LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  110  ILSDATRMVTQLRAEAKQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMKL  169

Query  245  LNSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQFAAPAVIDT  93
            L + P ++PHP     PF      P H  G       ++PFVGYPG PMWQ   P+ +DT
Sbjct  170  LTATPAYMPHPTMMHSPFAQAPMAPFHAQGHASAQKLMMPFVGYPGYPMWQLMPPSEVDT  229

Query  92   PED-HSLPPVA  63
             +D  + PPVA
Sbjct  230  SKDSEACPPVA  240



>gb|EAZ41459.1| hypothetical protein OsJ_25981 [Oryza sativa Japonica Group]
Length=253

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 152/243 (63%), Gaps = 26/243 (11%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKFD--VSNGCS  579
            +W LD G  ED+P    G FP       W++S   S       +  SYV     V     
Sbjct  22   DWFLDCGILEDLPAAACGAFP-------WNASPSCSNPSV---EVSSYVNTTSYVLKEPG  71

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  72   SNKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  130

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
            +QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++P
Sbjct  131  IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMP  190

Query  218  HPPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQFAAPAVIDTPED-HSLP  72
            HP     P+P     P H   G+      ++PFVGYPG PMWQF  P+ +DT +D  + P
Sbjct  191  HPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACP  250

Query  71   PVA  63
            PVA
Sbjct  251  PVA  253



>emb|CDY71937.1| BnaA05g35780D, partial [Brassica napus]
Length=219

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 143/230 (62%), Gaps = 12/230 (5%)
 Frame = -2

Query  749  SNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSARK  570
            +NWL D       L  G F    P + W      +        D      DV     ++K
Sbjct  1    TNWLSDYPL----LIDGVFSHHSPTFPWQIDGSATTVSVE-EVDGFLCDSDVIKEPGSKK  55

Query  569  RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQL  390
            R+KS + +G + SKA REK RR +LND+F ELS +++PG+ PK DK AI++DA+RMV Q 
Sbjct  56   RVKSESNAGPS-SKACREKQRRDKLNDKFTELSSILEPGRAPKTDKVAIINDAIRMVNQA  114

Query  389  RDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPP  210
            RDEAQ+LK+   +LQE++ ELK EKNEL+DEKQKLK EKD++E QLKA+N++P FLP+PP
Sbjct  115  RDEAQRLKDLNSNLQEKIKELKDEKNELRDEKQKLKTEKDRIEQQLKAINTQPCFLPNPP  174

Query  209  ATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                   +     G KLVPF  YPG  MWQF  PA +DT +DH L PPVA
Sbjct  175  TL-----SQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  219



>ref|XP_006304584.1| hypothetical protein CARUB_v10011628mg [Capsella rubella]
 gb|EOA37482.1| hypothetical protein CARUB_v10011628mg [Capsella rubella]
Length=226

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 146/242 (60%), Gaps = 21/242 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL      D PL  G F    P + W      S +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGVFSDQNPSFPWQIDGSSSVSVEV---DGFLCDSDV  50

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR+K+ +C+G++ SKA REK RR RLND+F ELS +++PG+ PK DK +I++D
Sbjct  51   IKEPGSKKRIKTESCTGSS-SKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVSIIND  109

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV   RDEAQKLK+    LQE++ ELK EKNEL+DEK KLK EK+++E QLKA+N++
Sbjct  110  AIRMVNHARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKHKLKTEKERIEQQLKAINTQ  169

Query  233  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
            P     FLP+ P  +          G KLVPF  YP   MWQF  PA +DT +DH L PP
Sbjct  170  PQPQPCFLPNQPTLS-----QAQAPGSKLVPFTTYPSFAMWQFMPPAAVDTSQDHVLRPP  224

Query  68   VA  63
            VA
Sbjct  225  VA  226



>ref|NP_001060960.1| Os08g0138500 [Oryza sativa Japonica Group]
 dbj|BAD03011.1| helix-loop-helix-like protein [Oryza sativa Japonica Group]
 dbj|BAF22874.1| Os08g0138500 [Oryza sativa Japonica Group]
 dbj|BAG95797.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60264.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=253

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 151/243 (62%), Gaps = 26/243 (11%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKFD--VSNGCS  579
            +W LD G  ED+P    G FP       W +S   S       +  SYV     V     
Sbjct  22   DWFLDCGILEDLPAAACGAFP-------WDASPSCSNPSV---EVSSYVNTTSYVLKEPG  71

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  72   SNKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  130

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
            +QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++P
Sbjct  131  IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMP  190

Query  218  HPPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQFAAPAVIDTPED-HSLP  72
            HP     P+P     P H   G+      ++PFVGYPG PMWQF  P+ +DT +D  + P
Sbjct  191  HPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACP  250

Query  71   PVA  63
            PVA
Sbjct  251  PVA  253



>ref|XP_006594652.1| PREDICTED: transcription factor ILR3-like [Glycine max]
Length=144

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 116/151 (77%), Gaps = 8/151 (5%)
 Frame = -2

Query  512  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  333
            MRR RLNDRF EL  ++ PG P KMDK+ ILSDAVR+V QL++EAQKL+ES E+LQE++N
Sbjct  1    MRRDRLNDRFMELWSIVGPGMPLKMDKAVILSDAVRVVSQLQEEAQKLRESSENLQEKIN  60

Query  332  ELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVP  153
            ELKAEKNEL+DEKQ+LK EKD +E +L AL+S+P FLP        FP+   +VG KLVP
Sbjct  61   ELKAEKNELRDEKQRLKAEKDSIEQKLIALSSQPSFLPA-------FPSAGQVVGSKLVP  113

Query  152  FVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            F+GYPG+ MWQF  PA +D  +DH L PPVA
Sbjct  114  FMGYPGVAMWQFLPPAAVDISQDHVLRPPVA  144



>gb|AFN84533.1| BHLH domain class transcription factor [Fragaria x ananassa]
Length=231

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 152/238 (64%), Gaps = 8/238 (3%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            MA+PE   +NWL D G  D       F      + W    +   +  S+  D S    + 
Sbjct  1    MASPE--NTNWLYDYGLID----DANFHVSSSAFNWPVQPLPGSSSVSVELDGSLGDVEG  54

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR++S + S  + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  55   LKESGSKKRVRSESSSATS-SKACREKLRRDRLNDKFMELGSILEPGRPPKTDKAAILID  113

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            AVRMV QLR EAQKLK+S   LQE++ ELK EK EL+DEKQ+LK EK+KLE QLKA+ ++
Sbjct  114  AVRMVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLKAMTAQ  173

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P F+P PPA    FP      G K+VPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  174  PSFMPAPPAIPAAFPAQGQAHGNKMVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_009144925.1| PREDICTED: transcription factor bHLH115 [Brassica rapa]
Length=225

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 146/238 (61%), Gaps = 14/238 (6%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M  PE   +NWL D       L  G F    P + W      +        D      DV
Sbjct  1    MVFPE--NTNWLSDYPL----LIDGVFSHHSPTFPWQIDGSATTVSVE-EVDGFLCDSDV  53

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR+KS + +G + SKA REK RR +LN++F ELS V++PG+ PK DK AI++D
Sbjct  54   IKEPGSKKRVKSESNAGPS-SKACREKQRRDKLNEKFTELSSVLEPGRAPKTDKVAIIND  112

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV Q RDEAQ+LK+   +LQE++ ELK EKNEL+DEKQKLK EKD++E QLKA+N++
Sbjct  113  AIRMVNQARDEAQRLKDLNSNLQEKIKELKDEKNELRDEKQKLKTEKDRIEQQLKAINTQ  172

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P FLP+PP       +     G KLVPF  YPG  MWQF  PA +DT +DH L PPVA
Sbjct  173  PCFLPNPPTL-----SQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  225



>ref|XP_010479562.1| PREDICTED: transcription factor bHLH115-like [Camelina sativa]
Length=227

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 141/242 (58%), Gaps = 20/242 (8%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE    NWL      D PL    F    P + W      S +      D      DV
Sbjct  1    MVSPE--NMNWL-----SDYPLIDSAFSDQNPTFPWQIDGSSSVSVEV---DGFLCDSDV  50

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 +RKR+K+ +C+  + SKA REK RR RLND+F ELS +++PG+ PK DK AI++D
Sbjct  51   DKEPGSRKRIKTESCTAGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVAIIND  110

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV   RDEAQKLK+    LQ+++ ELK EK+EL+DEK KLK EK+++E QLK + ++
Sbjct  111  AIRMVNHARDEAQKLKDLNSSLQDKIKELKNEKSELRDEKHKLKIEKERIEQQLKEIKTQ  170

Query  233  ----PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
                  FLP+PP  +          G KLVPF  YPG  MWQF  PA +DT +DH L PP
Sbjct  171  HQPQSCFLPNPPTLS-----QAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPP  225

Query  68   VA  63
            VA
Sbjct  226  VA  227



>gb|EAZ05534.1| hypothetical protein OsI_27750 [Oryza sativa Indica Group]
Length=247

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 150/242 (62%), Gaps = 26/242 (11%)
 Frame = -2

Query  743  WLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKFD--VSNGCSA  576
            W LD G  ED+P    G FP       W +S   S       +  SYV     V     +
Sbjct  17   WFLDCGILEDLPAAACGAFP-------WDASPSCSNPSV---EVSSYVNTTSYVLKEPGS  66

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
             KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV+
Sbjct  67   NKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMVI  125

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH  216
            QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++PH
Sbjct  126  QLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMPH  185

Query  215  PPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPP  69
            P     P+P     P H   G+      ++PFVGYPG PMWQF  P+ +DT +D  + PP
Sbjct  186  PTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACPP  245

Query  68   VA  63
            VA
Sbjct  246  VA  247



>gb|EEC82221.1| hypothetical protein OsI_26369 [Oryza sativa Indica Group]
Length=256

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = -2

Query  533  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  354
            SKA REK+RR +LN+RF EL  V++PGK PKMDKS+IL+DA+R++ +LR EAQKLKES E
Sbjct  96   SKACREKVRRDKLNERFLELGAVLEPGKTPKMDKSSILNDAIRVMAELRSEAQKLKESNE  155

Query  353  DLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPAT-AVPFPTPHH  177
             LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP F+PHPP   A  F  P  
Sbjct  156  SLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIKFLNARPSFVPHPPVIPASAFTAPQG  215

Query  176  LVGGK--LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
               G+  ++P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  216  QAAGQKLMMPVIGYPGFPMWQFMPPSDVDTTDDTKSCPPVA  256



>ref|NP_001059905.1| Os07g0543000 [Oryza sativa Japonica Group]
 dbj|BAC78588.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC83769.1| putative bHLH protein [Oryza sativa Japonica Group]
 dbj|BAE96297.1| bHLH-HALZ myc like protein [Oryza sativa Japonica Group]
 dbj|BAF21819.1| Os07g0543000 [Oryza sativa Japonica Group]
 gb|ACF60478.1| bHLH transcription factor [Oryza sativa Japonica Group]
 dbj|BAG86829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67352.1| hypothetical protein OsJ_24621 [Oryza sativa Japonica Group]
Length=256

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 4/161 (2%)
 Frame = -2

Query  533  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  354
            SKA REK+RR +LN+RF EL  V++PGK PKMDKS+IL+DA+R++ +LR EAQKLKES E
Sbjct  96   SKACREKVRRDKLNERFLELGAVLEPGKTPKMDKSSILNDAIRVMAELRSEAQKLKESNE  155

Query  353  DLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPAT-AVPFPTPHH  177
             LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP F+PHPP   A  F  P  
Sbjct  156  SLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIKFLNARPSFVPHPPVIPASAFTAPQG  215

Query  176  LVGGK--LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
               G+  ++P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  216  QAAGQKLMMPVIGYPGFPMWQFMPPSDVDTTDDTKSCPPVA  256



>ref|XP_006658659.1| PREDICTED: transcription factor ILR3-like [Oryza brachyantha]
Length=238

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 128/175 (73%), Gaps = 7/175 (4%)
 Frame = -2

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
            SA KR +S + S  + SKA REK+RR +LN+RF EL  V++PGK PKMDKSAIL+DA+R+
Sbjct  69   SANKRPRSESVSQPS-SKACREKLRRDKLNERFLELGAVLEPGKTPKMDKSAILNDAIRV  127

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL  222
            + +LR EAQKLKES + LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP  +
Sbjct  128  MTELRSEAQKLKESNQSLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIKFLNARPSLV  187

Query  221  PHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            PHPP      P      G KL +P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  188  PHPPV----IPAAAFAAGQKLMMPVIGYPGFPMWQFMPPSDVDTTDDPKSCPPVA  238



>gb|AAO72577.1| helix-loop-helix-like protein [Oryza sativa Japonica Group]
Length=216

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 12/183 (7%)
 Frame = -2

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  35   SNKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  93

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
            +QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++P
Sbjct  94   IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMP  153

Query  218  HPPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQFAAPAVIDTPED-HSLP  72
            HP     P+P     P H   G+      ++PFVGYPG PMWQF  P+ +DT +D  + P
Sbjct  154  HPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACP  213

Query  71   PVA  63
            PVA
Sbjct  214  PVA  216



>emb|CDY42475.1| BnaA10g08510D [Brassica napus]
Length=233

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 148/243 (61%), Gaps = 16/243 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQW--HssailspappsIRQDESYVKF  600
            M +PE   +NW+ +L   D     G F    PG+ W  H   I   +      D S    
Sbjct  1    MVSPE--NANWISELIDADY----GSFTIQGPGFSWPLHQQPIGVSSLGV---DGSAGNS  51

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            + +    ++KR +  + S A  SKA REK RR RLND+F EL  +++PG PPK DK+AIL
Sbjct  52   EATKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAIL  110

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  111  VDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMN  170

Query  239  S--RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
            +  +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH L P
Sbjct  171  APPQPSFFPAPPMMPTAFASAQGQAPGNKMVPVISYPGVAMWQFMPPASVDTSQDHVLRP  230

Query  71   PVA  63
            PVA
Sbjct  231  PVA  233



>ref|XP_009120001.1| PREDICTED: transcription factor ILR3-like [Brassica rapa]
Length=233

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 148/243 (61%), Gaps = 16/243 (7%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQW--HssailspappsIRQDESYVKF  600
            M +PE   +NW+ +L    I    G F    PG+ W  H   I   +      D S    
Sbjct  1    MVSPE--NANWISEL----IDAEYGSFTIQGPGFSWPLHQQPIGVSSLGV---DGSAGNS  51

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            + +    ++KR +  + S A  SKA REK RR RLND+F EL  +++PG PPK DK+AIL
Sbjct  52   EATKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAIL  110

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  111  VDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMN  170

Query  239  S--RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
            +  +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH L P
Sbjct  171  APPQPSFFPAPPMMPTAFASAQGQAPGNKMVPVISYPGVAMWQFMPPASVDTSQDHVLRP  230

Query  71   PVA  63
            PVA
Sbjct  231  PVA  233



>ref|XP_003573355.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=246

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 147/238 (62%), Gaps = 22/238 (9%)
 Frame = -2

Query  743  WLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKF-DVSNGCSAR  573
            W LD G  ED+P    G FP       W +SA  S       +  SYV   DVS    + 
Sbjct  20   WFLDCGILEDLPASACGAFP-------WDASASSSNPSV---EVGSYVNTSDVSKVPGSN  69

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +S +C G   SKA REK+RR +LNDRF EL   +DPGKP K DK+AILSDA RMV Q
Sbjct  70   KRSRSESC-GRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKSDKAAILSDATRMVTQ  128

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR EAQ+LK++ E L++++ ELK EK+EL+DEKQKLK EK+ LE Q+K L + P ++PHP
Sbjct  129  LRAEAQQLKDTNESLEDKIKELKTEKDELRDEKQKLKVEKETLEHQMKLLTATPAYMPHP  188

Query  212  PATAVPFP----TPHHLVG---GKLVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
                 PF      P H  G     ++PFVGYPG PMWQF  P+ +DT +D  + PPVA
Sbjct  189  AMMPSPFAQAPMAPFHAHGQGQKMMMPFVGYPGYPMWQFMPPSEVDTSKDSEACPPVA  246



>gb|KHN36564.1| Transcription factor bHLH115 [Glycine soja]
Length=239

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 154/242 (64%), Gaps = 23/242 (10%)
 Frame = -2

Query  752  GSNWLLDLGFEDIPLPGGKFPPLEPG-YQW--HssailspappsIRQDESYVKFDVSNGC  582
             S+WL D GF DIP+ G  F   + G ++W   S     P+  S+  + S     + NG 
Sbjct  9    ASDWLYDYGF-DIPVAGSDFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSLDSAVMENGP  67

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDR--------FQELSCVMDPGKPPKMDKSA  426
            S  KR+++ +C  A+ SKA REK+RR +LN+R        F ELS +++P + PK DK A
Sbjct  68   S--KRLRTESC--ASGSKACREKLRRDKLNERHAIILHIVFLELSSILEPSRQPKSDKVA  123

Query  425  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  246
            ILSDA R+V+QLR+EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K 
Sbjct  124  ILSDAARVVIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEQQVKV  183

Query  245  LNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
             N +P FLP  P           +   KL+PF+GYPGI MWQF +PA +DT +DH L PP
Sbjct  184  ANIQPSFLPQAP------DAKGQVGSHKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPP  237

Query  68   VA  63
            VA
Sbjct  238  VA  239



>gb|ADC33137.1| helix-loop-helix-like protein [Triticum aestivum]
Length=240

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 151/251 (60%), Gaps = 25/251 (10%)
 Frame = -2

Query  773  MAAPEVDG-SNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYV-  606
            M+ P  DG  +W LD G  ED+P    G FP       W +S   S     +    S+V 
Sbjct  1    MSLPPTDGGDDWFLDCGILEDLPAAACGAFP-------WDASVSSSNPSAEVG---SHVN  50

Query  605  KFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  426
            K D+     + KR++S  C G   SKA REK+RR +LNDRF EL   +DPGKP K DK+A
Sbjct  51   KLDLPKDSGSNKRLRSEPC-GRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKADKAA  109

Query  425  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  246
            ILSDA RMV QLR EAQ+LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  110  ILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMKL  169

Query  245  LNSRPGFLPHPPATAVPFP----TPHHLVGGKL-----VPFVGYPGIPMWQFAAPAVIDT  93
            L + P ++PHP     PF      P H  G  L     +PFVGYPG PMWQ   P+ +DT
Sbjct  170  LTATPAYMPHPTMMPSPFAQAPMAPFHAQGQALGQKLMMPFVGYPGYPMWQLMPPSEVDT  229

Query  92   PED-HSLPPVA  63
             +D  + PPVA
Sbjct  230  SKDSEACPPVA  240



>ref|XP_009414543.1| PREDICTED: transcription factor ILR3 [Musa acuminata subsp. malaccensis]
Length=226

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 137/233 (59%), Gaps = 21/233 (9%)
 Frame = -2

Query  743  WLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCS---AR  573
            W LD    D+    G    +  G+ W               + S+  F  SNG +     
Sbjct  9    WFLDDLIGDMHASEGDLAGVNGGFCWAPPGF----------NISFSSFSDSNGLTEPVTG  58

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +S  CS  A  KA REKMRR RLNDRF EL  +++PGK  K+DK+AILSDAVR++ Q
Sbjct  59   KRKRSETCSTPA--KACREKMRRDRLNDRFLELGSLLEPGKLSKLDKAAILSDAVRVLTQ  116

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH-  216
            LR E +KLKES E LQE++NELKAEKNEL+DEKQKLK E + LE Q+K    R  ++ H 
Sbjct  117  LRSETEKLKESNEILQEKINELKAEKNELRDEKQKLKAENESLEQQIKL---RSSYVSHP  173

Query  215  PPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            PP  A PF         KL +P +GYPG PMWQF AP+ IDT +D    PP A
Sbjct  174  PPVIATPFTAKGQAAAQKLMIPIIGYPGFPMWQFMAPSDIDTSQDADKYPPAA  226



>gb|KCW70124.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=226

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 1/154 (1%)
 Frame = -2

Query  521  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  342
            REK+RR RLND+F EL+ +++PG+PPK DK+AIL D VRMV QLR EAQKLK+S   LQE
Sbjct  73   REKLRRDRLNDKFLELASILEPGRPPKTDKAAILIDVVRMVTQLRGEAQKLKDSNSSLQE  132

Query  341  QVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGK  162
            ++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N++P FLP PPA    F T     G K
Sbjct  133  KIKELKAEKNELRDEKQRLKAEKEKLEHQLKAMNAQPSFLPPPPAIPAAFATQGQAPGNK  192

Query  161  LVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            LVPF+GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  193  LVPFIGYPGVAMWQFMPPATVDTSQDHVLRPPVA  226



>ref|XP_004972892.1| PREDICTED: transcription factor ILR3-like [Setaria italica]
Length=249

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 149/241 (62%), Gaps = 24/241 (10%)
 Frame = -2

Query  746  NWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKF-DVSNGCSA  576
            +W LD G  +D+P    G FP       W +S   S     +    SYV   DV     +
Sbjct  20   DWFLDCGILDDLPAAACGAFP-------WDASPSSSNPSVEVG---SYVNTNDVFKEPGS  69

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
             KR++SG+ SG   SKA REK RR +LNDRF EL   ++PGKP K DK+AILSDA RMV+
Sbjct  70   NKRLRSGS-SGRPTSKASREKQRRDKLNDRFLELGSTLEPGKPIKADKAAILSDATRMVI  128

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH  216
            QLR EAQ+LK++   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++PH
Sbjct  129  QLRSEAQQLKDTNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLMTSAPAYMPH  188

Query  215  PPATAVPFP----TPHH----LVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPV  66
            P     PFP     P H      G KL +PFV YPG PMWQF  P+ +DT +D  + PPV
Sbjct  189  PTLMPAPFPQAPLAPFHPQGQAAGQKLMMPFVSYPGYPMWQFMPPSEVDTSKDSEACPPV  248

Query  65   A  63
            A
Sbjct  249  A  249



>gb|EPS70109.1| hypothetical protein M569_04652 [Genlisea aurea]
Length=232

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 105/232 (45%), Positives = 145/232 (63%), Gaps = 5/232 (2%)
 Frame = -2

Query  755  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSA  576
            + +NWL D G  DI    G      PG+ W +      +      + S    D+      
Sbjct  5    ENTNWLCDYGIGDIHENPGIAN--NPGFSWPAQGCNFSSNSGGELEGSLGDSDMQRETGN  62

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            +KR +   C+ ++ SKA REK RR RLND+F EL+ +++PG+PPK DK+AIL DAVRM+ 
Sbjct  63   KKRARPNTCASSS-SKACREKQRRDRLNDKFMELAALLEPGRPPKADKAAILVDAVRMLN  121

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPH  216
            QL+ EAQKLK+S  +L E++ ELKAEK+EL++EKQ+LK EK+ LE +LK +  +P F+P 
Sbjct  122  QLKGEAQKLKDSNLNLHEKIKELKAEKSELREEKQRLKVEKENLEYKLKTM-PQPNFMPA  180

Query  215  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P A    F   +   G KLVP + YPG+ MWQF  PA +DT +DH+L PPVA
Sbjct  181  PAAIPAAFAAQNQAGGEKLVPVISYPGVAMWQFMPPATVDTSQDHALRPPVA  232



>gb|KHN25765.1| Transcription factor ILR3 [Glycine soja]
Length=239

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 152/239 (64%), Gaps = 23/239 (10%)
 Frame = -2

Query  743  WLLDLGFEDIPLPGGKFPPLEPG-YQW--HssailspappsIRQDESYVKFDVSNGCSAR  573
            WL D GF DIP+ G  F   + G + W   S     P+  S+  + S     + NG S  
Sbjct  12   WLYDYGF-DIPVAGSDFMASDSGGFSWGPQSYNFKGPSNMSLEMEYSLDSTVMENGPS--  68

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDR--------FQELSCVMDPGKPPKMDKSAILS  417
            KR+++ +C  A+ SKA REK+RR +LN+R        F ELS +++PG+ PK DK A+LS
Sbjct  69   KRLRTESC--ASGSKACREKLRRDKLNERHAIILHIVFLELSSILEPGRQPKTDKVALLS  126

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA R+V+QLR+EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K  N 
Sbjct  127  DAARVVIQLRNEAERLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEKQVKLTNI  186

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +P FLP  P           +   KL+PF+GYPGI MWQF +PA +DT +DH L PPVA
Sbjct  187  QPSFLPQAP------DAKGQVGSHKLIPFIGYPGIAMWQFMSPAAVDTSKDHLLRPPVA  239



>gb|KFK27081.1| hypothetical protein AALP_AA8G331500 [Arabis alpina]
Length=234

 Score =   141 bits (355),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 149/241 (62%), Gaps = 11/241 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsIRQDESYVKFD  597
            M +PE   +NW+ DL   D     G F    PG+ W     I   +  S   D S    +
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVSSNSSAGVDGSVGNSE  54

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
             S    ++KR +S + S A  SKA REK RR RLND+F EL  +++PG PPK DK+AIL 
Sbjct  55   ASKEPGSKKRGRSESSS-ATSSKACREKQRRDRLNDKFMELGTILEPGNPPKTDKAAILV  113

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  236  -RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPV  66
             +P F P PP     F +      G K+VP + YPG+ MWQF  PA +DT +DH L PPV
Sbjct  174  PQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFMPPASVDTSQDHVLRPPV  233

Query  65   A  63
            A
Sbjct  234  A  234



>gb|ACG38605.1| bHLH transcription factor [Zea mays]
Length=253

 Score =   141 bits (356),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 150/250 (60%), Gaps = 31/250 (12%)
 Frame = -2

Query  752  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKF-------  600
            G +W LD G  +D+P    G FP       W +S   S     +    SYV         
Sbjct  15   GDDWFLDCGILDDLPAAACGAFP-------WDASPSSSNPSVEVG---SYVNANDAFKEP  64

Query  599  -DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             DV     + KR++SG+ S    SKA RE+MRR +LNDRF EL   ++PGKP K DK+AI
Sbjct  65   NDVFKEPGSSKRLRSGS-SDMPTSKACRERMRRNKLNDRFLELGSALEPGKPVKADKAAI  123

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            LSDA RMV+QLR E+Q+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K +
Sbjct  124  LSDATRMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLM  183

Query  242  NSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQFAAPAVIDTP  90
             S P ++PHP     PF     TP H  G       ++PFVGYPG PMWQF  P+ +DT 
Sbjct  184  ASAPAYMPHPTLMPAPFAQAPLTPFHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTS  243

Query  89   ED-HSLPPVA  63
            +D  + PPVA
Sbjct  244  KDSEACPPVA  253



>gb|AJO70790.1| bHLH transcription factor bHLH57 [Eleusine coracana]
Length=256

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            S    +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R+V +LR EAQKL
Sbjct  91   SAQPSTKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRVVSELRTEAQKL  150

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPAT-AVPF  192
            K+S E LQE++ ELKAEKNEL++EKQ+LK EK+ LE Q+K +N+RP  +PHPP   A  F
Sbjct  151  KDSNESLQEKIKELKAEKNELREEKQRLKAEKENLEQQIKFMNARPSLVPHPPVIPASAF  210

Query  191  PTPHHLVGGK--LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
              P     G+  ++P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  211  TAPQGPAAGQKLMMPVIGYPGFPMWQFMPPSDVDTSDDPKSCPPVA  256



>emb|CDY35576.1| BnaC05g27050D [Brassica napus]
Length=228

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 146/243 (60%), Gaps = 21/243 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M  PE   +NWL      D PL  G F    P + W      +     +  D      DV
Sbjct  1    MVFPE--NTNWL-----SDYPLIDGVFSHQSPTFPWQIDGSATVTVEEV--DGFLCDSDV  51

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 ++KR+KS + +G + SKA REK RR +LND+F ELS +++PG+ PK DK AI++D
Sbjct  52   IKEPGSKKRVKSESYAGPS-SKASREKQRRDKLNDKFTELSSILEPGRAPKTDKVAIIND  110

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-  237
             +RMV Q RDEAQ+LK+    LQE++ ELK EKNEL+DEKQKLK EKD++E QLKA+N+ 
Sbjct  111  VIRMVNQARDEAQRLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKDRIEQQLKAINTQ  170

Query  236  ----RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
                +P FLP+PP       +     G KLVP+  YPG  MWQF  PA +DT +DH L P
Sbjct  171  PLPAQPCFLPNPPTL-----SQAQAPGSKLVPYTTYPGFAMWQFMPPAAVDTSQDHVLRP  225

Query  71   PVA  63
            PVA
Sbjct  226  PVA  228



>ref|XP_010461939.1| PREDICTED: transcription factor bHLH115 [Camelina sativa]
Length=226

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/238 (45%), Positives = 141/238 (59%), Gaps = 13/238 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDV  594
            M +PE   +NWL      D PL  G F    P + W      S +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDHNPTFPWQIDGSSSVSVEV---DGFLCDSDV  50

Query  593  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  414
                 +RKR+K+ +C+G++ SKA REK RR RLND+F ELS +++PG+ PK +K AI++D
Sbjct  51   IKEPGSRKRIKTESCTGSS-SKACREKQRRDRLNDKFTELSSILEPGRTPKTEKVAIIND  109

Query  413  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSR  234
            A+RMV   RDEAQKLK+    LQE++ ELK EK+EL+DEK KLK EK+++E QLK + ++
Sbjct  110  AIRMVNHARDEAQKLKDLNSSLQEKIKELKDEKSELRDEKHKLKIEKERIEQQLKEIKTQ  169

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P   P          +     G KLVPF  YPG  MWQF  PA +DT +DH L PPVA
Sbjct  170  PQPPPCFLPNPPTL-SQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLRPPVA  226



>ref|XP_002316971.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE97583.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=249

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 1/154 (1%)
 Frame = -2

Query  521  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  342
            REK+RR RLND+F EL  ++DPG+ PK DK+AIL DAVR+V QLR EAQKLK+S   LQE
Sbjct  96   REKLRRDRLNDKFMELGSILDPGRTPKTDKAAILVDAVRIVTQLRGEAQKLKDSNSSLQE  155

Query  341  QVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGK  162
            ++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +NS+P F+P PPA    F T     G K
Sbjct  156  KIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNSQPSFMPAPPAIPAAFTTQGQAPGNK  215

Query  161  LVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            L+PF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  216  LMPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  249



>ref|NP_001146503.1| uncharacterized protein LOC100280093 [Zea mays]
 gb|ACG47187.1| bHLH transcription factor [Zea mays]
Length=257

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 13/191 (7%)
 Frame = -2

Query  599  DVSNGCSARKRMKSGACSGAA--DSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  426
            DV     + KR++SG C+      SKA REKMRR +LNDRF EL   ++PGKP K DK+A
Sbjct  68   DVFKEPGSNKRLRSG-CNDVHVPTSKASREKMRRNKLNDRFLELGSTLEPGKPVKADKAA  126

Query  425  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  246
            ILSDA RMV+QLR EAQ+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  127  ILSDATRMVIQLRSEAQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKL  186

Query  245  LNSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQFAAPAVIDT  93
            + S P ++PHP     PFP     P H  G       ++PFV YPG PMWQF  P+ +DT
Sbjct  187  MTSTPTYMPHPTLMPAPFPQAPLAPFHAQGQAAGQKLMMPFVSYPGYPMWQFMPPSEVDT  246

Query  92   PED-HSLPPVA  63
             +D  + PPVA
Sbjct  247  SKDSEACPPVA  257



>ref|XP_003597042.1| Transcription factor ILR3 [Medicago truncatula]
 gb|AES67293.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK41880.1| unknown [Medicago truncatula]
Length=260

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 150/262 (57%), Gaps = 42/262 (16%)
 Frame = -2

Query  752  GSNWLLDLGFEDIPLPGGKF--------------------------PP-----LEPGYQW  666
             S WL D G++DI +    F                          PP     LE  Y  
Sbjct  9    SSIWLYDYGYDDISISAADFMASDSSAAASTFTWMPQPQSQTQIINPPSSHMSLEMDYSL  68

Query  665  HssailspappsIRQDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDR  486
             S+ + S     +  + S     + NG S R R +S A S    SKA REK+RR +LNDR
Sbjct  69   DSTVMESNPSKRMEMEYSLDSTVLENGPSKRLRTESYASS----SKAGREKVRRDKLNDR  124

Query  485  FQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknel  306
            F ELS V++P   PK DK ++L+DAVR+V QLR+EA++LKE  ++L+E+V ELKAEK EL
Sbjct  125  FMELSSVLEPDTLPKTDKVSLLNDAVRVVTQLRNEAERLKERNDELREKVKELKAEKKEL  184

Query  305  kdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPM  126
            +DEK KLK +K+KLE Q+K  + +  FL +  A A    T +H    KL+PF+GYPGI M
Sbjct  185  RDEKNKLKLDKEKLEQQVKLASVQSNFLSN--AMAAKGQTANH----KLMPFIGYPGISM  238

Query  125  WQFAAPAVIDTPEDHSL-PPVA  63
            WQF +PA +DT +DH L PPVA
Sbjct  239  WQFMSPATVDTSQDHLLRPPVA  260



>ref|NP_001185192.1| transcription factor bHLH115 [Arabidopsis thaliana]
 gb|AEE32619.1| transcription factor bHLH115 [Arabidopsis thaliana]
Length=292

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 11/184 (6%)
 Frame = -2

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            DV    S+RKR+K+ +C+G+ +SKA REK RR RLND+F ELS V++PG+ PK DK AI+
Sbjct  115  DVIKEPSSRKRIKTESCTGS-NSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAII  173

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
            +DA+RMV Q RDEAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK++++ QLKA+ 
Sbjct  174  NDAIRMVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAIK  233

Query  239  S----RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-  75
            +    +P FLP+P        +     G KLVPF  YPG  MWQF  PA +DT +DH L 
Sbjct  234  TQPQPQPCFLPNPQTL-----SQAQAPGSKLVPFTTYPGFAMWQFMPPAAVDTSQDHVLR  288

Query  74   PPVA  63
            PPVA
Sbjct  289  PPVA  292



>gb|AFW57417.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=257

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 126/190 (66%), Gaps = 11/190 (6%)
 Frame = -2

Query  599  DVSNGCSARKRMKSGACS-GAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
            DV     + KR++SG        SKA REKMRR +LNDRF EL   ++PGKP K DK+AI
Sbjct  68   DVFKEPGSNKRLRSGFNDVHVPTSKASREKMRRNKLNDRFLELGSTLEPGKPVKADKAAI  127

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            LSDA RMV+QLR EAQ+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K +
Sbjct  128  LSDATRMVIQLRSEAQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLM  187

Query  242  NSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQFAAPAVIDTP  90
             S P ++PHP     PFP     P H  G       ++PFV YPG PMWQF  P+ +DT 
Sbjct  188  TSTPTYMPHPTLMPAPFPQAPLAPFHAQGQAAGQKLMMPFVSYPGYPMWQFMPPSEVDTS  247

Query  89   ED-HSLPPVA  63
            +D  + PPVA
Sbjct  248  KDSEACPPVA  257



>gb|EMS54079.1| Transcription factor ILR3 [Triticum urartu]
Length=240

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 152/251 (61%), Gaps = 25/251 (10%)
 Frame = -2

Query  773  MAAPEVDGSN-WLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYV-  606
            M+ P  DG + W LD G  ED+P    G FP       W +S   S       +  S+V 
Sbjct  1    MSLPPTDGGDDWFLDCGILEDLPAAACGAFP-------WDASVSSSNPSA---EVGSHVN  50

Query  605  KFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  426
            K D+     + KR++S  C G   SKA R K+RR +LNDRF EL   +DPGKP K DK+A
Sbjct  51   KLDLPKDSGSNKRLRSEPC-GRPTSKACRGKVRRDKLNDRFLELGTTLDPGKPVKADKAA  109

Query  425  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  246
            ILSDA RMV QLR EAQ+LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  110  ILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMKL  169

Query  245  LNSRPGFLPHPPATAVPFP----TPHH----LVGGKL-VPFVGYPGIPMWQFAAPAVIDT  93
            L + P ++PHP     PF      P H     +G KL +PFVGYPG PMWQ   P+ +DT
Sbjct  170  LTATPAYMPHPTMMPSPFAQAPMAPFHAQAQALGQKLMMPFVGYPGYPMWQLMPPSEVDT  229

Query  92   PED-HSLPPVA  63
             +D  + PPVA
Sbjct  230  SKDSEACPPVA  240



>ref|XP_010092690.1| hypothetical protein L484_019764 [Morus notabilis]
 gb|EXB51987.1| hypothetical protein L484_019764 [Morus notabilis]
Length=210

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 145/240 (60%), Gaps = 33/240 (14%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLE-PGYQWHssailspappsIRQDESYVKF  600
            M +PE    NW+ D    ED+P+PGG  P L+ P + W S +   P   S   DES    
Sbjct  1    MGSPE--NPNWVFDYSLIEDLPIPGGGLPALDPPSFPWPSHSFTPPTTVSADFDESLANS  58

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            D       RK                           RF EL  + +PG+PPKMDK+ IL
Sbjct  59   DGFKEAGCRK---------------------------RFLELGSISEPGRPPKMDKAVIL  91

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
             DAVRMV  LR EA+KLKES E LQE++NELKAEKNEL+DEKQ+LK EKD L+ Q+KAL 
Sbjct  92   GDAVRMVTHLRMEAEKLKESNEKLQEKINELKAEKNELRDEKQRLKAEKDVLDKQVKALT  151

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            ++P FL HPPA   PFP P  +VGGKL+PFVGYPGI MWQF  PA +DT +DH L PPVA
Sbjct  152  TQPSFL-HPPAIPPPFPGPGQVVGGKLMPFVGYPGISMWQFMPPAAVDTSQDHVLRPPVA  210



>ref|XP_008677332.1| PREDICTED: LOC100284429 isoform X1 [Zea mays]
 gb|ACF84747.1| unknown [Zea mays]
 gb|AFW61271.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04286.1| bHLH transcription factor, partial [Zea mays]
Length=253

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 149/250 (60%), Gaps = 31/250 (12%)
 Frame = -2

Query  752  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsIRQDESYVKF-------  600
            G +W LD G  +D+P    G FP       W +S   S     +    SYV         
Sbjct  15   GDDWFLDCGILDDLPAAACGAFP-------WDASPSSSNPSVEVG---SYVNANDAFKEP  64

Query  599  -DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             DV     + KR++SG+ S    SKA RE+MRR +LNDRF EL   ++PGKP K DK+AI
Sbjct  65   NDVFKEPGSSKRLRSGS-SDMPTSKACRERMRRNKLNDRFLELGSALEPGKPVKADKAAI  123

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            LSDA RMV+QLR E+Q+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K +
Sbjct  124  LSDATRMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLM  183

Query  242  NSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQFAAPAVIDTP  90
             S P ++PHP     PF      P H  G       ++PFVGYPG PMWQF  P+ +DT 
Sbjct  184  ASAPAYMPHPTLMPAPFAQAPLAPFHAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTS  243

Query  89   ED-HSLPPVA  63
            +D  + PPVA
Sbjct  244  KDSEACPPVA  253



>ref|XP_011030891.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=251

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = -2

Query  521  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  342
            REK+RR RLND+F EL  ++DPG+ PK DK+AIL DAVR+V QLR EAQ LK+S   LQE
Sbjct  98   REKLRRDRLNDKFMELGSILDPGRTPKTDKAAILVDAVRVVTQLRGEAQTLKDSNSSLQE  157

Query  341  QVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGK  162
            ++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +NS+P F+P PPA    F T     G K
Sbjct  158  KIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNSQPSFMPAPPAIPAAFTTQAQAPGNK  217

Query  161  LVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            L+PF+ YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  218  LMPFISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  251



>ref|XP_004957936.1| PREDICTED: transcription factor ILR3-like isoform X2 [Setaria 
italica]
Length=254

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = -2

Query  533  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  354
            +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R V +LR EAQKLK+S E
Sbjct  93   TKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRAVGELRSEAQKLKDSNE  152

Query  353  DLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPAT-AVPFPTPHH  177
             LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LNSRP  +PHPP   A  F TP  
Sbjct  153  SLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNSRPSLVPHPPVIPASAFTTPKG  212

Query  176  --LVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
                G KL +P +GYPG PMWQF  P+ +DT  D  S PPVA
Sbjct  213  PPAAGHKLMMPVIGYPGFPMWQFMPPSDVDTSNDPKSCPPVA  254



>ref|XP_004957935.1| PREDICTED: transcription factor ILR3-like isoform X1 [Setaria 
italica]
Length=255

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 120/162 (74%), Gaps = 5/162 (3%)
 Frame = -2

Query  533  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  354
            +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R V +LR EAQKLK+S E
Sbjct  94   TKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRAVGELRSEAQKLKDSNE  153

Query  353  DLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPAT-AVPFPTPHH  177
             LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LNSRP  +PHPP   A  F TP  
Sbjct  154  SLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNSRPSLVPHPPVIPASAFTTPKG  213

Query  176  --LVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
                G KL +P +GYPG PMWQF  P+ +DT  D  S PPVA
Sbjct  214  PPAAGHKLMMPVIGYPGFPMWQFMPPSDVDTSNDPKSCPPVA  255



>ref|XP_010935491.1| PREDICTED: transcription factor bHLH115-like [Elaeis guineensis]
Length=230

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 7/190 (4%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            +E+Y         S+RKR++  +C+G   SKA REKMRR +LNDRF ELS ++DPG+PPK
Sbjct  39   EEAYRDVCGLEQTSSRKRIRDESCAGP-KSKACREKMRRDKLNDRFLELSSILDPGRPPK  97

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             +KS+ILSDA R+++QLR EAQ+LKES E LQE + +LK EKNEL++EK KLK +K++L+
Sbjct  98   FEKSSILSDAARLLVQLRSEAQQLKESNEKLQEAIKDLKVEKNELREEKMKLKADKERLD  157

Query  260  lqlkaLNSRP-GFLPHPPA-----TAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVI  99
             Q+KA++  P GF+PHP A         F    H    K+ PF  +PG+ MWQ+  PAV+
Sbjct  158  QQVKAMSVPPAGFMPHPIAFHPATATAAFAPHGHTPANKVAPFTAFPGVAMWQWLPPAVV  217

Query  98   DTPEDHSLPP  69
            DT +D  L P
Sbjct  218  DTTQDTKLWP  227



>gb|ABK96448.1| unknown [Populus trichocarpa x Populus deltoides]
Length=263

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S+ + DV     ++KR +S +   A+ SKA REK+RR RLND+F EL  +++PG+ PK
Sbjct  78   DGSFGECDVQKEPCSKKRGRSES-CSASSSKACREKLRRDRLNDKFIELGSILEPGRTPK  136

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK+AIL DAVRMV QLRDEAQKL++S   LQE++ ELKAEK EL+DEKQ+LK EK+KLE
Sbjct  137  TDKAAILVDAVRMVTQLRDEAQKLRDSNSSLQEKIKELKAEKIELRDEKQRLKAEKEKLE  196

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
             QLKA++S+P F+P PPA    F T     G KL+PF+GYPG+ MWQF  PA +DT +DH
Sbjct  197  HQLKAMSSQPSFMPAPPAIPAAFATQGQAPGNKLMPFIGYPGVAMWQFLPPAAVDTSQDH  256

Query  80   SL-PPVA  63
             L PPVA
Sbjct  257  VLHPPVA  263



>ref|XP_006370611.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|ERP67180.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=264

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S+ + DV     ++KR +S +   A+ SKA REK+RR RLND+F EL  +++PG+ PK
Sbjct  79   DGSFGECDVQKEPCSKKRGRSES-CSASSSKACREKLRRDRLNDKFIELGSILEPGRTPK  137

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK+AIL DAVRMV QLRDEAQKL++S   LQE++ ELKAEK EL+DEKQ+LK EK+KLE
Sbjct  138  TDKAAILVDAVRMVTQLRDEAQKLRDSNSSLQEKIKELKAEKIELRDEKQRLKAEKEKLE  197

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
             QLKA++S+P F+P PPA    F T     G KL+PF+GYPG+ MWQF  PA +DT +DH
Sbjct  198  HQLKAMSSQPSFMPAPPAIPAAFATQGQAPGNKLMPFIGYPGVAMWQFLPPAAVDTSQDH  257

Query  80   SL-PPVA  63
             L PPVA
Sbjct  258  VLHPPVA  264



>ref|XP_006493504.1| PREDICTED: transcription factor ILR3-like, partial [Citrus sinensis]
Length=157

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = -2

Query  503  YRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELK  324
            + L   F EL  +++PG+PPK DK+ ILSD VRM+ QLR EAQKLK+S EDLQE++ ELK
Sbjct  10   HILQRSFLELGSMLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELK  69

Query  323  AeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVG  144
            AEKNEL+DEKQ+LK +K+KLE Q+KA+++  GFLPHP + +  F     +   KLVPF+G
Sbjct  70   AEKNELRDEKQRLKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIG  129

Query  143  YPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  130  YPGVAMWQFMPPAAVDTSQDHVLRPPVA  157



>gb|KHN27978.1| Transcription factor ILR3 [Glycine soja]
Length=234

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 149/241 (62%), Gaps = 11/241 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED---IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVK  603
            M +PE   SNWL D    D   IP+    F      + W               D S   
Sbjct  1    MVSPE--NSNWLFDYPLIDDDVIPVGDSSFAVSASTFSWPPPPANVSVEI----DASLGD  54

Query  602  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
             D     + +KR +  + S A+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AI
Sbjct  55   SDGPKDTALKKRARCDS-STASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAI  113

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            L DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE+Q+K++
Sbjct  114  LIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLEMQVKSM  173

Query  242  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPV  66
            N++P FLP PPA    F       G KL+PF+ YPG+ MWQF  PA +DT +DH L PPV
Sbjct  174  NAQPAFLPPPPAIPAAFAPQGQAPGNKLMPFIRYPGVAMWQFMPPATMDTSQDHVLRPPV  233

Query  65   A  63
            A
Sbjct  234  A  234



>ref|XP_004172808.1| PREDICTED: transcription factor ILR3-like, partial [Cucumis sativus]
Length=168

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 116/156 (74%), Gaps = 7/156 (4%)
 Frame = -2

Query  521  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  342
            REK+RR RLND+F EL  ++DPG+PPK DK+AIL DAVRMV QLR E QKLKES   LQE
Sbjct  17   REKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVRMVNQLRSETQKLKESNSSLQE  76

Query  341  QVNELKAeknelkdekqklkeekdklelqlkaL-NSRPGFLPHPPATAVPFPTPHHLVGG  165
            ++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++   +PGFLP P  T   FP      G 
Sbjct  77   KIKELKAEKNELRDEKQRLKADKERLEQQVKSIPAQQPGFLPPPIPT---FPAQGQ-AGN  132

Query  164  KLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            KLVPF+GY P + MWQF  PA +DT +DH L PPVA
Sbjct  133  KLVPFIGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  168



>gb|EMT27826.1| Transcription factor ILR3 [Aegilops tauschii]
Length=218

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 127/195 (65%), Gaps = 12/195 (6%)
 Frame = -2

Query  614  SYVK-FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  438
            SYV   DV     + KR++S  C G   SKA R K+RR +LNDRF EL   +DPGKP K 
Sbjct  25   SYVNNSDVPKDSGSNKRLRSEPC-GRPTSKACRGKVRRDKLNDRFLELGTTLDPGKPVKA  83

Query  437  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  258
            DK+AILSDA RMV QLR EAQ+LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE 
Sbjct  84   DKAAILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEH  143

Query  257  qlkaLNSRPGFLPHPPATAVPFP----TPHHLVGGKL-----VPFVGYPGIPMWQFAAPA  105
            Q+K L + P ++PHP     PF      P H  G  L     +PFVGYPG PMWQ   P+
Sbjct  144  QMKLLTATPAYMPHPTMMPSPFAQAPMAPFHAQGQALGQKLMMPFVGYPGYPMWQLMPPS  203

Query  104  VIDTPED-HSLPPVA  63
             +DT +D  + PPVA
Sbjct  204  EVDTSKDSEACPPVA  218



>gb|KHG21334.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=238

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 150/225 (67%), Gaps = 9/225 (4%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQWHssailspappsIRQ-DESYVKFDVSNGCSARKRMKSGAC  549
             +DIP+P   +     G+ W +  I +P+     + D S+   D      ++KR++S +C
Sbjct  19   IDDIPVPDDPYA----GFAWSTQPIDAPSNVVSVEIDGSFGDSDGLKESGSKKRVRSESC  74

Query  548  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  369
            S ++ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLR EAQKL
Sbjct  75   SASS-SKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSAILIDAVRMVTQLRGEAQKL  133

Query  368  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFL--PHPPATAVP  195
            K+S   LQE++ ELKAEKNEL+DEKQ+LK EK++LE QLKA+N++P F+        A  
Sbjct  134  KDSNTSLQERIKELKAEKNELRDEKQRLKAEKERLEQQLKAMNAQPSFMPPAPSAIPAAF  193

Query  194  FPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
               P    G KLVP +GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  194  AAAPGQAPGNKLVPLIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  238



>ref|XP_011048283.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=269

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S+ + DV     ++KR +S +   A+ SKA REK+RR RLND+F EL  +++PG+ PK
Sbjct  84   DGSFGECDVQKEPCSKKRGRSES-CSASSSKACREKLRRDRLNDKFIELGSILEPGRTPK  142

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK+AIL DAVRMV QLR EAQKL++S  +LQE++ ELKAEK EL+DEKQ+LK EK+KLE
Sbjct  143  TDKAAILVDAVRMVTQLRGEAQKLRDSNSNLQEKIKELKAEKIELRDEKQRLKAEKEKLE  202

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
             QLKA++S+P F+P PPA    F T     G KL+PF+GYPG+ MWQF  PA +DT +DH
Sbjct  203  YQLKAMSSQPSFMPAPPAIPAAFATQGQAPGNKLMPFIGYPGVAMWQFLPPAAVDTSQDH  262

Query  80   SL-PPVA  63
             L PPVA
Sbjct  263  VLHPPVA  269



>ref|XP_003562971.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=251

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 157/256 (61%), Gaps = 24/256 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF-EDIPL------PGGKF---PPLEPGYQWHssailspappsIR  624
            MA+PE  GSNW+ D    +D+ +      P G F   PP++P  Q H+ A    A     
Sbjct  1    MASPE--GSNWVFDCPLMDDLAVADFAAGPAGAFYWTPPMQP--QMHTQAQAVSAASLPN  56

Query  623  ---QDESYVKFDV--SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMD  459
               +  S V  D   + G    KR +S + S    SKA REK+RR +LN+RF EL  V+D
Sbjct  57   PCAEINSPVSLDCEHAKGHPTNKRPRSES-SAQPSSKACREKVRRDKLNERFLELGAVLD  115

Query  458  PGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklke  279
            PGK PK+DK AIL+DA+R+V +LR EA+KLK+S E LQ+++ ELK+EKNEL+DEKQKLK 
Sbjct  116  PGKTPKIDKCAILNDAIRVVTELRSEAEKLKDSNESLQDKIKELKSEKNELRDEKQKLKA  175

Query  278  ekdklelqlkaLNSRPGFLPHP---PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAP  108
            EK+ LE Q+K +N+R   +PHP   PATA             ++P +GYPG PMWQF  P
Sbjct  176  EKESLEQQIKFMNARQSLVPHPSVIPATAFAAAQGQAAGQKLMMPVIGYPGFPMWQFMPP  235

Query  107  AVIDTPED-HSLPPVA  63
            + +DT +D  S PPVA
Sbjct  236  SDVDTSDDPKSCPPVA  251



>ref|XP_010940315.1| PREDICTED: transcription factor ILR3-like isoform X2 [Elaeis 
guineensis]
Length=188

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 127/186 (68%), Gaps = 9/186 (5%)
 Frame = -2

Query  602  FDVSN--GCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  429
             DV N    S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK DK+
Sbjct  1    MDVCNLDQASSRKRVRDESCSGP-KTKACREKMRRDRLNDRFLELSSILDPGRPPKSDKA  59

Query  428  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  249
            +IL DA R+++QLR EA++LKES E LQE + +LK EKNEL+DEK +LK +K++LE Q+K
Sbjct  60   SILGDAARVLVQLRSEARQLKESNEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVK  119

Query  248  aLNSRP-GFLPHP----PATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
            A++  P GF+PHP    PA A     PH      K      +PG+ MWQ+  PAV+DT +
Sbjct  120  AMSVPPAGFMPHPIAFHPAAATVAFAPHGQAPANKAGSVTAFPGVAMWQWMPPAVVDTTQ  179

Query  86   DHSLPP  69
            D  L P
Sbjct  180  DTKLWP  185



>ref|XP_004487368.1| PREDICTED: transcription factor bHLH115-like [Cicer arietinum]
Length=236

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 146/237 (62%), Gaps = 16/237 (7%)
 Frame = -2

Query  752  GSNWLLDLGFEDIPLPGGKF---PPLEPGYQW--HssailspappsIRQDESYVKFDVSN  588
             S WL D GF DI +    F         + W  H++    P+     + E  +   V  
Sbjct  9    SSCWLYDYGF-DISVAASDFMASDSTTAAFTWIPHTNITNPPSSNISLEMEYSLDSTVLE  67

Query  587  GCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAV  408
               + KR+K+   S A+ SKA REK+RR +LNDRF ELS V++P K PK DK  +L+DA 
Sbjct  68   NAPS-KRLKTE--SYASGSKACREKLRRDKLNDRFLELSSVLEPDKLPKTDKVTLLNDAA  124

Query  407  RMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN-SRP  231
            R++ QLR+EA++LKE  ++L+E+V ELKAEKNEL+DEK KLK +K+KLE Q+++    + 
Sbjct  125  RVITQLRNEAERLKERNDELREKVKELKAEKNELRDEKNKLKLDKEKLEQQVRSTTVQQS  184

Query  230  GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             FLP+  A A      H     KL+PF+GYPGI MWQF +PA +DT +DH L PPVA
Sbjct  185  SFLPNALAAAKGQTGSH-----KLMPFIGYPGISMWQFMSPATVDTSQDHLLRPPVA  236



>ref|XP_010940314.1| PREDICTED: transcription factor ILR3-like isoform X1 [Elaeis 
guineensis]
Length=230

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 129/189 (68%), Gaps = 7/189 (4%)
 Frame = -2

Query  617  ESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  438
            E+Y+     +  S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK 
Sbjct  40   EAYMDVCNLDQASSRKRVRDESCSGP-KTKACREKMRRDRLNDRFLELSSILDPGRPPKS  98

Query  437  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  258
            DK++IL DA R+++QLR EA++LKES E LQE + +LK EKNEL+DEK +LK +K++LE 
Sbjct  99   DKASILGDAARVLVQLRSEARQLKESNEKLQETIKDLKVEKNELRDEKTRLKADKERLEQ  158

Query  257  qlkaLNSRP-GFLPHP----PATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVID  96
            Q+KA++  P GF+PHP    PA A     PH      K      +PG+ MWQ+  PAV+D
Sbjct  159  QVKAMSVPPAGFMPHPIAFHPAAATVAFAPHGQAPANKAGSVTAFPGVAMWQWMPPAVVD  218

Query  95   TPEDHSLPP  69
            T +D  L P
Sbjct  219  TTQDTKLWP  227



>ref|XP_008803703.1| PREDICTED: transcription factor bHLH115-like [Phoenix dactylifera]
Length=230

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 127/192 (66%), Gaps = 7/192 (4%)
 Frame = -2

Query  626  RQDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKP  447
            R +E+Y         S RKRM+  +C+G   SKA REK+RR RLNDRF ELS ++DPG+ 
Sbjct  37   RIEEAYRDASGLEQASLRKRMRDESCAGP-KSKACREKIRRDRLNDRFLELSAILDPGRH  95

Query  446  PKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdk  267
            PK DK++ILSDA R+++QLR EAQ+LKES E LQE + +LK EKNEL++EK +LK +K++
Sbjct  96   PKFDKASILSDAARLLVQLRSEAQQLKESNEKLQETIKDLKVEKNELREEKMRLKADKER  155

Query  266  lelqlkaLNSRP-GFLPHP----PATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPA  105
            LE Q+K ++  P GF+PHP    P  A     PH      K  PF  +PG+ MW++  P 
Sbjct  156  LEQQIKVMSVPPAGFMPHPIAYHPTAATVAFAPHGQAPPSKCAPFTAFPGVAMWKWLPPP  215

Query  104  VIDTPEDHSLPP  69
            V+DT +D  L P
Sbjct  216  VVDTTQDTKLWP  227



>ref|XP_009420541.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like 
[Musa acuminata subsp. malaccensis]
Length=149

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = -2

Query  512  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  333
            MRR +LNDRF ELS ++DPGKPP  DK+AILS A R+V +L DEAQKLK+S E LQE++ 
Sbjct  1    MRREKLNDRFMELSSLLDPGKPPMTDKAAILSGAARLVSRLHDEAQKLKDSNESLQEKIK  60

Query  332  ELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKL-V  156
            ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP +LPHPP     FPT     G KL V
Sbjct  61   ELKAEKNELRDEKQKLKAEKESLEQQVKLLNARPNYLPHPPLAPSLFPTQSQAAGHKLMV  120

Query  155  PFVGYPGIPMWQFAAPAVIDTPED  84
            P +G+   PMWQF AP  +DT +D
Sbjct  121  PIMGF---PMWQFMAPTDVDTSQD  141



>ref|XP_002462974.1| hypothetical protein SORBIDRAFT_02g035580 [Sorghum bicolor]
 gb|EER99495.1| hypothetical protein SORBIDRAFT_02g035580 [Sorghum bicolor]
Length=254

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 122/162 (75%), Gaps = 5/162 (3%)
 Frame = -2

Query  533  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  354
            +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R+V +LR EA++LK+S E
Sbjct  93   TKASREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRVVGELRSEAKELKDSNE  152

Query  353  DLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPP---ATAVPFPTP  183
             LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+RP  +PH P   A+A   P  
Sbjct  153  SLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNARPSLVPHHPVISASAFTAPQG  212

Query  182  HHLVGGKL-VPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
              + G KL +P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  213  PAVAGHKLMMPVLGYPGFPMWQFMPPSDVDTSDDPKSCPPVA  254



>gb|ACN40301.1| unknown [Picea sitchensis]
Length=232

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 112/173 (65%), Gaps = 4/173 (2%)
 Frame = -2

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR +  +CS     KA REKMRR RLNDRF ELS +++PG+PPK DKSAILSDA+ +V 
Sbjct  62   RKRPRDESCSKHG-IKACREKMRRERLNDRFTELSILLEPGRPPKTDKSAILSDALSLVN  120

Query  395  QLRDEAQKLKESFEDLQEQVNELKAekne-lkdekqklkeekdklelqlkaLNSRPGFLP  219
            QLR+EA KLK+S E L++ + ELK EKNE   ++ +   E++   +     + S PGF+P
Sbjct  121  QLREEAGKLKDSNEQLRQSIKELKTEKNELRDEKTRLKAEKERLDQQMKAMMTSPPGFMP  180

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            H  A +  F         K +P  G+PG+ MWQ+  PA +DT +DH+L PPVA
Sbjct  181  H-LAVSHAFSAQSQAANSKTLPIPGFPGMAMWQWMPPAAVDTSQDHALRPPVA  232



>gb|KDO50387.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
 gb|KDO50388.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
 gb|KDO50389.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
Length=136

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -2

Query  467  VMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqk  288
            +++PG+PPK DK+ ILSD VRM+ QLR EAQKLK+S EDLQE++ ELKAEKNEL+DEKQ+
Sbjct  1    MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQR  60

Query  287  lkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAP  108
            LK +K+KLE Q+KA+++  GFLPHP + +  F     +   KLVPF+GYPG+ MWQF  P
Sbjct  61   LKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIGYPGVAMWQFMPP  120

Query  107  AVIDTPEDHSL-PPVA  63
            A +DT +DH L PPVA
Sbjct  121  AAVDTSQDHVLRPPVA  136



>ref|NP_001150796.1| LOC100284429 [Zea mays]
 gb|ACG40431.1| bHLH transcription factor [Zea mays]
Length=238

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = -2

Query  527  AQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDL  348
            ++RE+MRR +LNDRF EL   ++PGKP K DK+AILSDA RMV+QLR E+Q+LKE+   L
Sbjct  74   SKRERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDATRMVIQLRSESQQLKETNGSL  133

Query  347  QEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP----TPH  180
            +E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++PHP     PF     TP 
Sbjct  134  EEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLMASAPAYMPHPTLMPAPFAQAPLTPF  193

Query  179  HLVGGK-----LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            H  G       ++PFVGYPG PMWQF  P+ +DT +D  + PPVA
Sbjct  194  HAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACPPVA  238



>ref|XP_008454559.1| PREDICTED: transcription factor ILR3-like isoform X2 [Cucumis 
melo]
Length=207

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 113/156 (72%), Gaps = 7/156 (4%)
 Frame = -2

Query  521  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  342
            REK+RR RLND+F EL  ++DPG+PPK DK+AIL DAVRMV QLR E  KLKES   LQE
Sbjct  56   REKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVRMVNQLRSETHKLKESNSSLQE  115

Query  341  QVNELKAeknelkdekqklkeekdklelqlkaL-NSRPGFLPHPPATAVPFPTPHHLVGG  165
            ++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++   +PGFLP  P     FP      G 
Sbjct  116  KIKELKAEKNELRDEKQRLKADKERLEQQVKSMPAQQPGFLPPIPT----FPAQGQAPGN  171

Query  164  KLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            KL PFVGY P + MWQF  PA +DT +DH L PPVA
Sbjct  172  KLFPFVGYHPSVAMWQFMPPAAVDTSQDHVLRPPVA  207



>ref|NP_001239799.1| uncharacterized protein LOC100813088 [Glycine max]
 gb|ACU21616.1| unknown [Glycine max]
Length=233

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 133/189 (70%), Gaps = 7/189 (4%)
 Frame = -2

Query  608  VKFDVSNGCS------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKP  447
            V+ D S G S      A K+      S A+ SKA REK+RR RLND+F EL  +++PG+P
Sbjct  45   VEIDASLGDSDGPKDTALKKRARCDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRP  104

Query  446  PKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdk  267
            PK DK+AIL DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+K
Sbjct  105  PKTDKAAILIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEK  164

Query  266  lelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
            LE+Q+K++N++P FLP PPA    F       G KL+PF+ YPG+ MWQF  PA +DT +
Sbjct  165  LEMQVKSMNAQPAFLPPPPAIPAAFAPQGQAPGNKLMPFIRYPGVAMWQFMPPATMDTSQ  224

Query  86   DHSL-PPVA  63
            DH L PPVA
Sbjct  225  DHVLRPPVA  233



>ref|XP_010539274.1| PREDICTED: transcription factor ILR3 [Tarenaya hassleriana]
Length=231

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 145/240 (60%), Gaps = 12/240 (5%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsIRQDESYVKFD  597
            M +PE    NWL DL      +    F    PG+ W     I S +  S   D S    +
Sbjct  1    MVSPE--NPNWLYDL------IDDESFTIQGPGFSWPVQQPIGSSSIASAGADGSVSNLE  52

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
             S    ++KR +    S A+ SKA REK RR RLND+F EL  +++PG P K DK+AIL 
Sbjct  53   TSKEPGSKKRGRP-ELSCASSSKACREKQRRDRLNDKFMELGSILEPGSPLKTDKAAILI  111

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA+N+
Sbjct  112  DAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQMKAMNA  171

Query  236  RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            +  F P PP     F        G KLVP + YPG+ MWQF  PA +DT +DH L PPVA
Sbjct  172  QASFFPAPPPMPAAFAAAQGQAPGNKLVPIISYPGVAMWQFMPPAAVDTSQDHVLRPPVA  231



>ref|XP_006837018.1| hypothetical protein AMTR_s00098p00170370 [Amborella trichopoda]
 gb|ERM99871.1| hypothetical protein AMTR_s00098p00170370 [Amborella trichopoda]
Length=224

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 130/179 (73%), Gaps = 5/179 (3%)
 Frame = -2

Query  590  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  411
            N CS RKR +S  CSG+  SKA REKMRR RLNDRF EL  +++PG+PPK DK+ ILSDA
Sbjct  48   NLCS-RKRPRSEPCSGSG-SKACREKMRRDRLNDRFLELGAILEPGRPPKTDKATILSDA  105

Query  410  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP  231
            +R++ QL+ EA+KLKE+ ++LQE++ +LKAEKNEL+DEK +LK +K++LE Q+KA+N+ P
Sbjct  106  IRVLNQLQSEARKLKEANDELQEKIKDLKAEKNELRDEKLRLKADKERLEQQVKAINTPP  165

Query  230  GFLPHPPATAVPFPT-PHHLVGGKLVPFVGY-PGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                 P   A   P  P    G K++PF+GY P + MWQ+  PA +DT +DH L PPVA
Sbjct  166  PSPFIPHPMAFSSPQGPAVGAGAKMMPFMGYQPTVAMWQWMPPAAVDTSQDHVLRPPVA  224



>ref|XP_010109550.1| hypothetical protein L484_018285 [Morus notabilis]
 gb|EXC23154.1| hypothetical protein L484_018285 [Morus notabilis]
Length=308

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 125/174 (72%), Gaps = 3/174 (2%)
 Frame = -2

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            +RKR +S   SGA+ SKA REK+RR RLN+RF EL  VM+PG+ PK DK+AILSDA R++
Sbjct  136  SRKRPRSDQSSGASCSKACREKLRRDRLNERFLELVAVMEPGRLPKTDKAAILSDAARIL  195

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLP  219
             QLR E++ LKE+ +DL E++ ELKAEKNEL++E+Q+L+E+K++LE Q+KA+ ++  FLP
Sbjct  196  TQLRSESRHLKETIDDLHEKIKELKAEKNELREERQRLREDKERLEQQVKAMAAQTSFLP  255

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYP-GIPMWQFAAPAVIDTPEDH-SLPPVA  63
            H PA +    T       KL+PF+ YP G+ MWQ      +DT +DH   PPVA
Sbjct  256  HSPAISSAL-TVQGQSTNKLMPFISYPGGVTMWQMMPQTPLDTSQDHIRHPPVA  308



>gb|AFW61272.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=238

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = -2

Query  527  AQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDL  348
            ++RE+MRR +LNDRF EL   ++PGKP K DK+AILSDA RMV+QLR E+Q+LKE+   L
Sbjct  74   SKRERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDATRMVIQLRSESQQLKETNGSL  133

Query  347  QEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP----TPH  180
            +E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++PHP     PF      P 
Sbjct  134  EEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLMASAPAYMPHPTLMPAPFAQAPLAPF  193

Query  179  HLVGGK-----LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            H  G       ++PFVGYPG PMWQF  P+ +DT +D  + PPVA
Sbjct  194  HAQGQAAGQKLMMPFVGYPGYPMWQFMPPSEVDTSKDSEACPPVA  238



>gb|ACL54160.1| unknown [Zea mays]
 gb|ACN26446.1| unknown [Zea mays]
 gb|AFW57419.1| putative HLH DNA-binding domain superfamily protein isoform 1 
[Zea mays]
 gb|AFW57420.1| putative HLH DNA-binding domain superfamily protein isoform 2 
[Zea mays]
Length=160

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 111/160 (69%), Gaps = 10/160 (6%)
 Frame = -2

Query  512  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  333
            MRR +LNDRF EL   ++PGKP K DK+AILSDA RMV+QLR EAQ+LKE+   L+E++ 
Sbjct  1    MRRNKLNDRFLELGSTLEPGKPVKADKAAILSDATRMVIQLRSEAQQLKETNGSLEEKIK  60

Query  332  ELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFP----TPHHLVGG  165
            ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++PHP     PFP     P H  G 
Sbjct  61   ELKAEKDELRDEKQKLKLEKESLEHQMKLMTSTPTYMPHPTLMPAPFPQAPLAPFHAQGQ  120

Query  164  K-----LVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
                  ++PFV YPG PMWQF  P+ +DT +D  + PPVA
Sbjct  121  AAGQKLMMPFVSYPGYPMWQFMPPSEVDTSKDSEACPPVA  160



>ref|XP_010274798.1| PREDICTED: transcription factor bHLH104-like [Nelumbo nucifera]
Length=215

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 124/174 (71%), Gaps = 10/174 (6%)
 Frame = -2

Query  578  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  399
            ARKR ++ +CS    SKA REKMRR R+NDRF +LS V++PG+P K DKSAI+SDA+R++
Sbjct  50   ARKRGRNQSCSDPG-SKACREKMRRDRMNDRFLDLSSVLEPGRPAKTDKSAIVSDAIRVL  108

Query  398  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GFL  222
             QLR EAQ+LK++ E L+E +  LKAEKNEL++EK +LK +K+K+E Q+KA++  P GF+
Sbjct  109  NQLRTEAQELKDASEKLREVIKNLKAEKNELREEKLQLKADKEKMEQQVKAMSLLPAGFV  168

Query  221  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            P       P P  +H    KL+ +  Y G PMWQ+  P V+DT +DH L PPVA
Sbjct  169  P-------PLPATYHTGANKLMAYPSYGGFPMWQWIPPVVLDTSQDHVLRPPVA  215



>ref|XP_008813306.1| PREDICTED: transcription factor ILR3-like isoform X1 [Phoenix 
dactylifera]
Length=235

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 130/198 (66%), Gaps = 16/198 (8%)
 Frame = -2

Query  617  ESYVKFDVSNGC---------SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCV  465
            E++ +  +   C         S+RKR++  +CSG   +KA REKMRR RLNDRF ELS +
Sbjct  36   ENFNRIGIQGACIDVCSLDQASSRKRVRDESCSGPK-TKACREKMRRDRLNDRFLELSSI  94

Query  464  MDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqkl  285
            +DPG+PPK D+++ILSDA R+++QLR EAQ+LKES E+LQE + +LK EKNEL+DEK +L
Sbjct  95   LDPGRPPKSDRASILSDAARVLVQLRSEAQQLKESNENLQETIKDLKVEKNELRDEKTRL  154

Query  284  keekdklelqlkaLNSRP-GFLPHPPATAVPFPTPHHLVGG-----KLVPFVGYPGIPMW  123
            K +K++LE Q+KA++  P GF+PHP +         +   G     K      +PG+ MW
Sbjct  155  KADKERLEQQVKAMSVPPAGFMPHPISFHAAAAPVAYAPHGQAPANKAASVTAFPGVAMW  214

Query  122  QFAAPAVIDTPEDHSLPP  69
            Q+  PAV+DT +D  L P
Sbjct  215  QWLPPAVVDTTQDTKLWP  232



>ref|XP_008813314.1| PREDICTED: transcription factor ILR3-like isoform X2 [Phoenix 
dactylifera]
Length=230

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 124/177 (70%), Gaps = 7/177 (4%)
 Frame = -2

Query  581  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  402
            S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK D+++ILSDA R+
Sbjct  52   SSRKRVRDESCSGPK-TKACREKMRRDRLNDRFLELSSILDPGRPPKSDRASILSDAARV  110

Query  401  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GF  225
            ++QLR EAQ+LKES E+LQE + +LK EKNEL+DEK +LK +K++LE Q+KA++  P GF
Sbjct  111  LVQLRSEAQQLKESNENLQETIKDLKVEKNELRDEKTRLKADKERLEQQVKAMSVPPAGF  170

Query  224  LPHPPATAVPFPTPHHLVGG-----KLVPFVGYPGIPMWQFAAPAVIDTPEDHSLPP  69
            +PHP +         +   G     K      +PG+ MWQ+  PAV+DT +D  L P
Sbjct  171  MPHPISFHAAAAPVAYAPHGQAPANKAASVTAFPGVAMWQWLPPAVVDTTQDTKLWP  227



>ref|XP_008651109.1| PREDICTED: uncharacterized protein LOC100273838 isoform X2 [Zea 
mays]
 gb|ADX60077.1| bHLH transcription factor [Zea mays]
 tpg|DAA63013.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=252

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 126/180 (70%), Gaps = 15/180 (8%)
 Frame = -2

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +S + + ++ +KA REK+RR +LN+RF EL  +++PGK PKMDK+AILSDA+R+V +
Sbjct  78   KRPRSESTTESS-TKASREKIRRDKLNERFLELGAILEPGKTPKMDKTAILSDAIRVVGE  136

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR EA+KLK+S E+LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+RP  +PH 
Sbjct  137  LRSEAKKLKDSNENLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNARPSLVPHH  196

Query  212  PATAVPFPTP---------HHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            P                  H L    ++P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  197  PVIPASAFPAPQGPAAAARHKL----MMPVIGYPGFPMWQFMPPSDVDTSDDPRSCPPVA  252



>ref|XP_008651108.1| PREDICTED: uncharacterized protein LOC100273838 isoform X1 [Zea 
mays]
Length=253

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 126/180 (70%), Gaps = 15/180 (8%)
 Frame = -2

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +S + + ++ +KA REK+RR +LN+RF EL  +++PGK PKMDK+AILSDA+R+V +
Sbjct  79   KRPRSESTTESS-TKASREKIRRDKLNERFLELGAILEPGKTPKMDKTAILSDAIRVVGE  137

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP  213
            LR EA+KLK+S E+LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+RP  +PH 
Sbjct  138  LRSEAKKLKDSNENLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNARPSLVPHH  197

Query  212  PATAVPFPTP---------HHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
            P                  H L    ++P +GYPG PMWQF  P+ +DT +D  S PPVA
Sbjct  198  PVIPASAFPAPQGPAAAARHKL----MMPVIGYPGFPMWQFMPPSDVDTSDDPRSCPPVA  253



>gb|KHN19061.1| Transcription factor ILR3 [Glycine soja]
Length=134

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 8/140 (6%)
 Frame = -2

Query  479  ELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkd  300
            EL  ++ PG P KMDK+ ILSDAVR+V QLR+EAQKL+ES E+LQE++NELKAEKNEL+D
Sbjct  2    ELWSIVGPGMPLKMDKAVILSDAVRVVSQLREEAQKLRESSENLQEKINELKAEKNELRD  61

Query  299  ekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQ  120
            EKQ+LK EKD +E +L AL+S+P FLP        FP+   +VG KLVPF+GYPG+ MWQ
Sbjct  62   EKQRLKAEKDSIEQKLIALSSQPSFLPA-------FPSAGQVVGSKLVPFMGYPGVAMWQ  114

Query  119  FAAPAVIDTPEDHSL-PPVA  63
            F  PA +D  +DH L PPVA
Sbjct  115  FLPPAAVDISQDHVLRPPVA  134



>ref|XP_002962528.1| hypothetical protein SELMODRAFT_165556 [Selaginella moellendorffii]
 ref|XP_002962764.1| hypothetical protein SELMODRAFT_165311 [Selaginella moellendorffii]
 gb|EFJ35991.1| hypothetical protein SELMODRAFT_165556 [Selaginella moellendorffii]
 gb|EFJ36227.1| hypothetical protein SELMODRAFT_165311 [Selaginella moellendorffii]
Length=246

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 125/202 (62%), Gaps = 17/202 (8%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S V  D       +KR +  +C GA  +KA REKMRR RLNDRF ELS  ++PG+PPK
Sbjct  46   DSSKVDSDEFEKTCPKKRSREESC-GAPGNKACREKMRRDRLNDRFVELSAALEPGRPPK  104

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK+ ILSDAVR++ QLR EAQ+LKES E L++ + ELKAEKNEL++EK +LK EKD+LE
Sbjct  105  SDKATILSDAVRVITQLRAEAQQLKESNEQLRDGIKELKAEKNELREEKMRLKSEKDRLE  164

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHL-------------VGGKLV--PFVGYPGIPM  126
             QLK +   P F+PHP A                         GG     P  G+PG+ M
Sbjct  165  QQLKTMAMPPSFMPHPAAALHAHHAAAAAAAFHAQIQAASTKTGGASAAGPLPGFPGMAM  224

Query  125  WQFAAPAVIDTPEDHSL-PPVA  63
            WQ+  PAV+DT +DH L PPVA
Sbjct  225  WQWMPPAVVDTSQDHVLRPPVA  246



>gb|KHN36734.1| Transcription factor ILR3 [Glycine soja]
Length=234

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 149/247 (60%), Gaps = 23/247 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED---IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVK  603
            M +PE   SNWL D    D   IP+    F      + W                   V+
Sbjct  1    MVSPE--NSNWLFDYPLIDDDVIPVGDSSFAVSASTFSWPPPPANVS-----------VE  47

Query  602  FDVSNGCS------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
             D S G S      A K+      S A+ SKA REK+RR RLND+F EL  +++PG+PPK
Sbjct  48   IDTSLGDSDGLKNPALKKRTKSDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPK  107

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK++IL DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE
Sbjct  108  TDKASILIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLE  167

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
            +Q+K++N++P FLP PPA    F       G KLVPF+ YPG+ MWQF  PA +DT +DH
Sbjct  168  VQVKSMNAQPAFLPPPPAIPAAFAPQGQAPGNKLVPFISYPGVAMWQFMPPAAVDTSQDH  227

Query  80   SL-PPVA  63
             L PPVA
Sbjct  228  VLRPPVA  234



>ref|XP_003543288.1| PREDICTED: transcription factor ILR3-like isoform 1 [Glycine 
max]
Length=234

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 149/247 (60%), Gaps = 23/247 (9%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGFED---IPLPGGKFPPLEPGYQWHssailspappsIRQDESYVK  603
            M +PE   SNWL D    D   IP+    F      + W                   V+
Sbjct  1    MVSPE--NSNWLFDYPLIDDDVIPVGDSSFAVSASTFSWPPPPANVS-----------VE  47

Query  602  FDVSNGCS------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
             D S G S      A K+      S A+ SKA REK+RR RLND+F EL  +++PG+PPK
Sbjct  48   IDASLGDSDGLKNPALKKRTKSDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPK  107

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK++IL DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE
Sbjct  108  TDKASILIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLE  167

Query  260  lqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDH  81
            +Q+K++N++P FLP PPA    F       G KLVPF+ YPG+ MWQF  PA +DT +DH
Sbjct  168  VQVKSMNAQPAFLPPPPAIPAAFAPQGQAPGNKLVPFISYPGVAMWQFMPPAAVDTSQDH  227

Query  80   SL-PPVA  63
             L PPVA
Sbjct  228  VLRPPVA  234



>ref|XP_010262298.1| PREDICTED: transcription factor bHLH104-like [Nelumbo nucifera]
Length=216

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 127/192 (66%), Gaps = 19/192 (10%)
 Frame = -2

Query  608  VKFDVS--------NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPG  453
            + FDVS          C+ RKR ++ +CSG   SKA REKMRR R+ND F +L+ +++PG
Sbjct  34   LDFDVSPIESILQEKACT-RKRGRNESCSGPG-SKACREKMRRDRMNDMFSDLTSILEPG  91

Query  452  KPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeek  273
            +P K DKSAIL DA+R++ QLR EAQ+LK++ E LQE +  LKAEKNEL++EK  LK +K
Sbjct  92   RPAKTDKSAILGDAIRVLNQLRTEAQELKDANEKLQEDIKNLKAEKNELREEKLLLKADK  151

Query  272  dklelqlkaLNSRP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVID  96
            +++E QLK ++  P GF+P       P P  +     KL+ +  + G PMWQ+  PAV+D
Sbjct  152  ERMEQQLKTMSIMPTGFVP-------PVPATYQAGANKLMTYPSFGGFPMWQWIPPAVLD  204

Query  95   TPEDHSL-PPVA  63
            T +DH L PPVA
Sbjct  205  TSQDHVLRPPVA  216



>dbj|BAJ40866.1| bHLH transcriptional factor [Coptis japonica]
Length=219

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 120/179 (67%), Gaps = 9/179 (5%)
 Frame = -2

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
            V  GC A+KR ++ +C G   SKA REKMRR +LNDRF +LS  ++PG+P K DKSAILS
Sbjct  49   VEKGC-AKKRGRNESCGGLG-SKACREKMRRDKLNDRFADLSSALEPGRPAKTDKSAILS  106

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA+R++ QLR E+Q+LKE+ E LQE +  LKAEKNEL++EK  LK +K+++E Q+KA+  
Sbjct  107  DAIRVLNQLRTESQELKEANEKLQEDIKNLKAEKNELREEKNLLKADKERIEQQMKAMAI  166

Query  236  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             PG +        P P  +     K + F  Y G PMWQ+  PA +DT +DH L PPVA
Sbjct  167  VPGGI------VPPHPATYQAGVNKFMAFPSYGGYPMWQYIPPASLDTSQDHVLRPPVA  219



>ref|XP_011030516.1| PREDICTED: transcription factor bHLH104-like [Populus euphratica]
Length=221

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 117/173 (68%), Gaps = 10/173 (6%)
 Frame = -2

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR +S +CSGA  +KA  EK+RR RLNDRFQ+LS V++PG+P K DK AIL DA+R++ 
Sbjct  57   RKRGRSDSCSGAG-TKACHEKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIRVLN  115

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN-SRPGFLP  219
            QL++EAQ+LKE+ E L E++  LKAEK EL++EK  LK +K+K+E QLK L  +  GF+P
Sbjct  116  QLKNEAQELKETNEKLLEEIKSLKAEKTELREEKLMLKADKEKMEQQLKTLALTTSGFMP  175

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
              PAT       +H    K+  F GY  +PMW +  PA  DT  DH L PP A
Sbjct  176  AYPAT-------YHAAANKIPVFPGYGLMPMWHYLPPATCDTSRDHELRPPAA  221



>ref|XP_010062962.1| PREDICTED: transcription factor ILR3-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW70123.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=213

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = -2

Query  488  RFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAekne  309
            RF EL+ +++PG+PPK DK+AIL D VRMV QLR EAQKLK+S   LQE++ ELKAEKNE
Sbjct  71   RFLELASILEPGRPPKTDKAAILIDVVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNE  130

Query  308  lkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIP  129
            L+DEKQ+LK EK+KLE QLKA+N++P FLP PPA    F T     G KLVPF+GYPG+ 
Sbjct  131  LRDEKQRLKAEKEKLEHQLKAMNAQPSFLPPPPAIPAAFATQGQAPGNKLVPFIGYPGVA  190

Query  128  MWQFAAPAVIDTPEDHSL-PPVA  63
            MWQF  PA +DT +DH L PPVA
Sbjct  191  MWQFMPPATVDTSQDHVLRPPVA  213



>gb|KHN33610.1| Transcription factor ILR3 [Glycine soja]
Length=131

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 11/140 (8%)
 Frame = -2

Query  479  ELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkd  300
            EL  ++DP KP KMDK+ ILSDAVR+V QLR+EAQKL+ES E+LQE++N LK EKNEL+D
Sbjct  2    ELGSILDPRKPLKMDKAVILSDAVRVVSQLREEAQKLRESTENLQEKINALKDEKNELRD  61

Query  299  ekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQ  120
            EKQ+LK EK+ LE ++KAL+S+P FL               +VG KLVPF+GYPG+ MWQ
Sbjct  62   EKQRLKVEKENLEQKVKALSSQPSFL----------AAAGQVVGSKLVPFMGYPGVAMWQ  111

Query  119  FAAPAVIDTPEDHSL-PPVA  63
            F +PA +DT +DH L PPVA
Sbjct  112  FLSPAAVDTSQDHVLRPPVA  131



>dbj|BAK01217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 152/257 (59%), Gaps = 26/257 (10%)
 Frame = -2

Query  773  MAAPEVDGSNWLLDLGF--------EDIPLPGGKF--PPLEPGYQWHssailspappsIR  624
            MA+PE  GSNW+ D                 GG +  PP+ P  Q H+ A    A P+  
Sbjct  1    MASPE--GSNWVFDCPLMDDLAAADFAAVPAGGFYWNPPMPP--QMHTLAQAVSATPAPN  56

Query  623  -----QDESYVKFDVSNGCSARKRMKSGACSGAA-DSKAQREKMRRYRLNDRFQELSCVM  462
                      V +D + G    KR +S   +GA   SKA REK+RR +LN+RF EL  V+
Sbjct  57   PCAEINSSVSVDWDHAKGQPKNKRPRSE--TGAQPSSKACREKVRRDKLNERFLELGAVL  114

Query  461  DPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklk  282
            DPGK PK+DK AIL+DA+R V +LR EA+KLK+S E LQE++ ELKAEKNEL+DEKQKLK
Sbjct  115  DPGKTPKIDKCAILNDAIRAVTELRSEAEKLKDSNESLQEKIRELKAEKNELRDEKQKLK  174

Query  281  eekdklelqlkaLNSRPGFLPHP---PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAA  111
             EK+ LE Q+K +N+R   +PHP   PATA             ++P + YPG PMWQF  
Sbjct  175  AEKESLEQQIKFMNARQRLVPHPSVIPATAFAAAQGQAAGHKLMMPVMSYPGFPMWQFMP  234

Query  110  PAVIDTPED-HSLPPVA  63
            P+ +DT +D  S PPVA
Sbjct  235  PSDVDTSDDPKSCPPVA  251



>ref|XP_009408169.1| PREDICTED: transcription factor ILR3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 122/178 (69%), Gaps = 7/178 (4%)
 Frame = -2

Query  584  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  405
             S +KR +  + +G   SKA REKMRR +LNDRF ELS ++DPG+ PK DK++ILSDA R
Sbjct  47   TSLKKRARDDSTTGLK-SKACREKMRRDKLNDRFSELSLILDPGRTPKSDKASILSDAAR  105

Query  404  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-G  228
            +++QL+ +AQ+LKES + LQE + +LK EKNEL+DEK KLK +K+ LE Q+KA++  P G
Sbjct  106  VLVQLKADAQELKESNDKLQETIKDLKVEKNELRDEKMKLKADKETLEQQVKAISMAPSG  165

Query  227  FLPHP----PATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSLPP  69
            F+PHP    PA A    +PH      K   F  YPG+ MWQ+  PAV+DT +D  L P
Sbjct  166  FMPHPLAYHPAAAPTTFSPHVQAPSNKAAHFPAYPGMAMWQWLPPAVMDTTQDSKLWP  223



>ref|XP_001778884.1| predicted protein [Physcomitrella patens]
 gb|EDQ56334.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 118/183 (64%), Gaps = 5/183 (3%)
 Frame = -2

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            DV     +RKR +    SG+ + KA REKMRR RLNDRF +LS  ++PG+PPK DK+ IL
Sbjct  57   DVPEKSCSRKRSREEGSSGSGN-KACREKMRRDRLNDRFLDLSAALEPGRPPKTDKATIL  115

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
            SDAVR++ QLR EAQ L ES   L+E + +LK EKNEL++EK +LK +K++LE Q+KA+ 
Sbjct  116  SDAVRILTQLRAEAQGLTESNNQLRETIKDLKNEKNELREEKTRLKADKERLEQQVKAMT  175

Query  239  SRPGFLPHP---PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
               G++PHP    A    F         K     GYPG+ MWQ+  PA +DT +DH L P
Sbjct  176  IPAGYMPHPAALHAAVAAFAAQTQAASNKAAQIAGYPGMAMWQWMPPAAVDTSQDHVLRP  235

Query  71   PVA  63
            PVA
Sbjct  236  PVA  238



>gb|KHG04921.1| Transcription factor protein [Gossypium arboreum]
Length=213

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = -2

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS +++PG+P + DKSAIL 
Sbjct  43   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSILEPGRPARTDKSAILD  100

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS  237
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE++DEK  LK  K+++E QLK LN 
Sbjct  101  DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIRDEKLVLKANKERIEQQLKTLNV  160

Query  236  RPG-FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             P  +LP  PA        +H    K+  F GY  +PMWQ+  P+  DT +DH L PP A
Sbjct  161  SPARYLPAHPAG-------YHAATNKMAVFPGYGLVPMWQYLPPSARDTSQDHELRPPAA  213



>gb|ACG27921.1| DNA binding protein [Zea mays]
 gb|ACG35050.1| DNA binding protein [Zea mays]
 gb|ACG37454.1| DNA binding protein [Zea mays]
Length=231

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = -2

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +   CS    SKA REKMRR +LNDRF ELS VM+PGK  K+DK+ ILSDA RMV Q
Sbjct  52   KRSRDEPCSSGLKSKACREKMRRDKLNDRFLELSSVMNPGKQAKLDKANILSDAARMVAQ  111

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GF---  225
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  112  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  171

Query  224  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQFAAPAVIDTPEDHSLPP  69
            LPHP    PA   PF  P    G K  P    +PG+ MWQ+  P ++DT +D  L P
Sbjct  172  LPHPASYHPAAFAPFVPPQQAAGNKSAPIPAPFPGMAMWQWLPPTIVDTTQDPKLWP  228



>ref|XP_008676877.1| PREDICTED: uncharacterized protein LOC100274393 isoform X1 [Zea 
mays]
 gb|AFW66776.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05497.1| bHLH transcription factor, partial [Zea mays]
Length=231

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = -2

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +   CS    SKA REKMRR +LNDRF ELS VM+PGK  K+DK+ ILSDA RMV Q
Sbjct  52   KRGRDEPCSSGLKSKACREKMRRDKLNDRFLELSSVMNPGKQAKLDKANILSDAARMVAQ  111

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GF---  225
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  112  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  171

Query  224  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQFAAPAVIDTPEDHSLPP  69
            LPHP    PA   PF  P    G K  P    +PG+ MWQ+  P ++DT +D  L P
Sbjct  172  LPHPASYHPAAFAPFVPPQQAAGNKSAPIPAPFPGMAMWQWLPPTIVDTTQDPKLWP  228



>gb|AFW66775.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=232

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = -2

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +   CS    SKA REKMRR +LNDRF ELS VM+PGK  K+DK+ ILSDA RMV Q
Sbjct  53   KRGRDEPCSSGLKSKACREKMRRDKLNDRFLELSSVMNPGKQAKLDKANILSDAARMVAQ  112

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GF---  225
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  113  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  172

Query  224  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQFAAPAVIDTPEDHSLPP  69
            LPHP    PA   PF  P    G K  P    +PG+ MWQ+  P ++DT +D  L P
Sbjct  173  LPHPASYHPAAFAPFVPPQQAAGNKSAPIPAPFPGMAMWQWLPPTIVDTTQDPKLWP  229



>ref|XP_009378999.1| PREDICTED: transcription factor bHLH104-like [Pyrus x bretschneideri]
Length=223

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = -2

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR ++ +CSG + +KA REK+RR RLNDRF +LS V++PG+PPK DK+AIL DA+R++ 
Sbjct  55   RKRGRTDSCSGGSGAKACREKLRRERLNDRFVDLSGVLEPGRPPKTDKAAILDDAIRVLN  114

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GFLP  219
            QLR EAQ+L E+ + L E+V  LKAEKNEL++EK  LK +K++LE QLK ++  P GF+P
Sbjct  115  QLRAEAQELTETNQKLLEEVKSLKAEKNELREEKLVLKADKERLEQQLKGMSISPSGFVP  174

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSLPPVA  63
              PA     P  +H    K+  +  Y  +PMW +  P   DT  DH L P A
Sbjct  175  THPAV----PAAYHPGANKMAVYPSYSLVPMWHYIPPLARDTSRDHELRPPA  222



>ref|XP_001777933.1| predicted protein [Physcomitrella patens]
 gb|EDQ57257.1| predicted protein, partial [Physcomitrella patens]
Length=172

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = -2

Query  551  CSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQK  372
             SG A +KA REKMRR RLNDRF EL  +++PG+PPK DK+ ILSDAVR++ QLR EAQ 
Sbjct  6    ISGGAGNKACREKMRRDRLNDRFLELGAILEPGRPPKTDKATILSDAVRILTQLRAEAQG  65

Query  371  LKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP---PATA  201
            L ES   L+E + +LK EKNEL++EK +LK +K++LELQ+KA+     ++PHP    A A
Sbjct  66   LTESNNQLRETIKDLKNEKNELREEKSRLKADKERLELQVKAMTIPTRYMPHPAAIHAAA  125

Query  200  VPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
              F      V  K     GY G+ MWQ+ +PA +DT +DH L PPVA
Sbjct  126  AAFSAQAQAVSTKAAQMAGYSGMAMWQWMSPAAVDTSQDHVLRPPVA  172



>gb|EMT07811.1| Transcription factor ILR3 [Aegilops tauschii]
Length=315

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = -2

Query  536  DSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESF  357
             SKA REK+RR +LN+RF EL  V+DPGK PK+DK AIL+DA+R V +LR EA+KLK+S 
Sbjct  154  SSKACREKVRRDKLNERFLELGAVLDPGKTPKIDKCAILNDAIRAVTELRSEAEKLKDSN  213

Query  356  EDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHP---PATAVPFPT  186
            E LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K +N+R   +PHP   PA A     
Sbjct  214  ESLQEKIRELKAEKNELRDEKQKLKAEKESLEQQIKFMNARQSLVPHPSVIPAAAFAAAQ  273

Query  185  PHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPED-HSLPPVA  63
                    ++P + YPG PMWQF  P+ +DT +D  S PPVA
Sbjct  274  GQAAGHKLMMPVMSYPGFPMWQFMPPSDVDTSDDPKSCPPVA  315



>ref|XP_010241997.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like, 
partial [Nelumbo nucifera]
Length=141

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -2

Query  470  CVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekq  291
             +++PG+PPKMDK+AILSD VRMV QL+ EAQKLKES E L E++ ELKAEKNEL DEKQ
Sbjct  4    TILEPGRPPKMDKAAILSDVVRMVTQLQSEAQKLKESNESLLEKIKELKAEKNELGDEKQ  63

Query  290  klkeekdklelqlkaLNSR-PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFA  114
            +LK EK +   Q     S  P FLPHP      F       G KL+PF+GYPG+ MWQF 
Sbjct  64   RLKTEKXEKLEQQVKNLSAPPSFLPHPTTILAAFTAQGQAAGNKLMPFIGYPGVAMWQFM  123

Query  113  APAVIDTPEDHSL  75
              A +DT +DH L
Sbjct  124  PSAAVDTSQDHVL  136



>gb|ACN40263.1| unknown [Picea sitchensis]
Length=237

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 123/189 (65%), Gaps = 4/189 (2%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S    D       RKR +  + SG   SKA REKMRR RLNDRF ELS V++PG+PPK
Sbjct  50   DGSNKDIDEQEKLCPRKRPREES-SGGPGSKACREKMRRDRLNDRFMELSSVLEPGRPPK  108

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK+ ILSDA R++ QLR +AQKLKES + LQE + +LKAEKNEL+DEK +LK EK++LE
Sbjct  109  TDKATILSDAARVMSQLRADAQKLKESNDHLQETIKDLKAEKNELRDEKLRLKAEKERLE  168

Query  260  lqlkaLNSRPGFL--PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPE  87
             Q+KA+    GF+  P     A  F         K +P  GYPG+ MWQ+  PAV+DT +
Sbjct  169  QQVKAMTLPSGFVPHPAAFHAAAAFAAQSQAAANKTMPVPGYPGMAMWQWMPPAVVDTSQ  228

Query  86   DHSL-PPVA  63
            DH L PPVA
Sbjct  229  DHVLRPPVA  237



>ref|XP_009408170.1| PREDICTED: transcription factor ILR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 114/161 (71%), Gaps = 6/161 (4%)
 Frame = -2

Query  533  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  354
            SKA REKMRR +LNDRF ELS ++DPG+ PK DK++ILSDA R+++QL+ +AQ+LKES +
Sbjct  14   SKACREKMRRDKLNDRFSELSLILDPGRTPKSDKASILSDAARVLVQLKADAQELKESND  73

Query  353  DLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GFLPHP----PATAVPFP  189
             LQE + +LK EKNEL+DEK KLK +K+ LE Q+KA++  P GF+PHP    PA A    
Sbjct  74   KLQETIKDLKVEKNELRDEKMKLKADKETLEQQVKAISMAPSGFMPHPLAYHPAAAPTTF  133

Query  188  TPH-HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSLPP  69
            +PH      K   F  YPG+ MWQ+  PAV+DT +D  L P
Sbjct  134  SPHVQAPSNKAAHFPAYPGMAMWQWLPPAVMDTTQDSKLWP  174



>gb|ABK23190.1| unknown [Picea sitchensis]
 gb|ABK27132.1| unknown [Picea sitchensis]
Length=238

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -2

Query  620  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  441
            D S    D       RKR +  + SG   SKA REKMRR RLNDRF ELS V++PG+PPK
Sbjct  50   DGSNKDIDEQEKLCPRKRPREES-SGGPGSKACREKMRRDRLNDRFMELSSVLEPGRPPK  108

Query  440  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  261
             DK+ ILSDA R++ QLR +AQKLKES + LQE + +LKAEKNEL+DEK +LK EK++LE
Sbjct  109  TDKATILSDAARVMSQLRADAQKLKESNDHLQETIKDLKAEKNELRDEKLRLKAEKERLE  168

Query  260  lqlkaLNSRPGFL---PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTP  90
             Q+KA+    GF+       A A  F         K +P  GYPG+ MWQ+  PAV+DT 
Sbjct  169  QQVKAMTLPSGFVPHPAAFHAAAAAFAAQSQAAANKTMPVPGYPGMAMWQWMPPAVVDTS  228

Query  89   EDHSL-PPVA  63
            +DH L PPVA
Sbjct  229  QDHVLRPPVA  238



>gb|KJB81835.1| hypothetical protein B456_013G164100 [Gossypium raimondii]
Length=213

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 134/225 (60%), Gaps = 34/225 (15%)
 Frame = -2

Query  725  FEDIPLPGGKFPPLEPGYQWHssailspappsIRQDESYVKFDVSNGCSARKRMKSGACS  546
             +DIP+P G +     G+ W +    +P+        + V  +V N          G   
Sbjct  19   IDDIPVPDGPYT----GFSWSTQPTNAPS--------TAVNVEVDNSF--------GDLD  58

Query  545  GAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLK  366
            G  +S +++          RF EL  +++PG+PPK DKSAIL DAVRMV QLRDEAQK+K
Sbjct  59   GLTESGSKK----------RFMELGAILEPGRPPKTDKSAILVDAVRMVTQLRDEAQKMK  108

Query  365  ESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRPGFLPHPPATAVPFPT  186
            +S   LQE++ ELKAEKNEL++EKQ+LK EK+KLE QLK +N++P F+P  PA    F  
Sbjct  109  DSNSSLQERIKELKAEKNELREEKQRLKAEKEKLEQQLKTMNAQPSFMPPAPAIPSAFAA  168

Query  185  PH---HLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
                    G KLVPF GYPG+ MWQF  PA +DT +DH L PPVA
Sbjct  169  AAAQGQAHGNKLVPFFGYPGVAMWQFMPPAAVDTSQDHVLRPPVA  213



>ref|XP_008224372.1| PREDICTED: transcription factor bHLH104 [Prunus mume]
Length=223

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 117/182 (64%), Gaps = 7/182 (4%)
 Frame = -2

Query  602  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  423
            F     C  ++     +CSG+  +KA REK+RR RLNDRF ELS V++PG+PPK DK AI
Sbjct  47   FSPEKECPRKRGRTDSSCSGSG-AKACREKLRRERLNDRFVELSAVLEPGRPPKSDKPAI  105

Query  422  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaL  243
            L DA+R++ QLR EAQ+LKE+ E L E+V  LKAEKNEL++EK  LK +K++LE QLK +
Sbjct  106  LDDAIRVLTQLRAEAQELKETNEKLLEEVKSLKAEKNELREEKLVLKADKERLEKQLKGM  165

Query  242  NSRP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PP  69
               P GF+P  PA     P  +H    K+  +  Y  +PMW +  P+V DT  DH L PP
Sbjct  166  AISPSGFVPTHPAV----PAAYHPGASKMAMYPSYSLVPMWHYLPPSVRDTSRDHELRPP  221

Query  68   VA  63
             A
Sbjct  222  AA  223



>ref|XP_006378346.1| hypothetical protein POPTR_0010s08360g [Populus trichocarpa]
 gb|ERP56143.1| hypothetical protein POPTR_0010s08360g [Populus trichocarpa]
Length=218

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 115/176 (65%), Gaps = 11/176 (6%)
 Frame = -2

Query  584  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  405
            CS RKR +S  CS A  +KA REK+RR RLNDRFQ+LS V++PG+P K DK AIL DA+R
Sbjct  52   CS-RKRERSDLCSRAG-TKACREKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIR  109

Query  404  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-RPG  228
            ++ QL++EAQ+LKE+ E L E++  LKAEK EL++EK  LK +K+K+E QLK L     G
Sbjct  110  VLNQLKNEAQELKETNEKLLEEIRSLKAEKTELREEKLMLKADKEKMEQQLKTLALPTSG  169

Query  227  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            F+P        +P  +H    K+  F GY  +PMW +  P   DT  DH L PP A
Sbjct  170  FMP-------TYPAAYHAAANKIPVFPGYGLMPMWHYLPPTACDTSRDHELRPPAA  218



>ref|XP_002314636.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF00807.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=221

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 115/176 (65%), Gaps = 11/176 (6%)
 Frame = -2

Query  584  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  405
            CS RKR +S  CS A  +KA REK+RR RLNDRFQ+LS V++PG+P K DK AIL DA+R
Sbjct  55   CS-RKRERSDLCSRAG-TKACREKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIR  112

Query  404  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-RPG  228
            ++ QL++EAQ+LKE+ E L E++  LKAEK EL++EK  LK +K+K+E QLK L     G
Sbjct  113  VLNQLKNEAQELKETNEKLLEEIRSLKAEKTELREEKLMLKADKEKMEQQLKTLALPTSG  172

Query  227  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            F+P        +P  +H    K+  F GY  +PMW +  P   DT  DH L PP A
Sbjct  173  FMP-------TYPAAYHAAANKIPVFPGYGLMPMWHYLPPTACDTSRDHELRPPAA  221



>ref|XP_001754335.1| predicted protein [Physcomitrella patens]
 gb|EDQ80785.1| predicted protein [Physcomitrella patens]
Length=201

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 117/183 (64%), Gaps = 5/183 (3%)
 Frame = -2

Query  599  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  420
            DV     +RKR +  ACSGA + KA REKMRR RLNDRF ELS  ++PG+PPK DK+ IL
Sbjct  20   DVLEKSCSRKRSREDACSGAGN-KACREKMRRDRLNDRFLELSAALEPGRPPKTDKATIL  78

Query  419  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN  240
            SDAVR++ QLR EAQ L ES   L+E + +LK EKNEL++EK +LK +K++LE Q+K+++
Sbjct  79   SDAVRILTQLRAEAQGLTESNNQLRETIKDLKNEKNELREEKTRLKADKERLEQQVKSIS  138

Query  239  SRPGF---LPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-P  72
               G+        A A  F         K      YPG+ MWQ+  PA +DT +DH L P
Sbjct  139  IPTGYMPHPAAMHAAAAAFAAQTQAASTKAAQMAAYPGMAMWQWMPPAAVDTSQDHVLRP  198

Query  71   PVA  63
            PVA
Sbjct  199  PVA  201



>gb|KJB72343.1| hypothetical protein B456_011G172500 [Gossypium raimondii]
Length=213

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 11/180 (6%)
 Frame = -2

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS  ++PG+P + DKSAIL 
Sbjct  43   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSTLEPGRPARTDKSAILD  100

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN-  240
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE+++EK  LK  K+++E QLK LN 
Sbjct  101  DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIREEKLVLKANKERIEQQLKTLNV  160

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS-LPPVA  63
            S  G+LP  PA        +H    K+  F GY  +P+WQ+  P+  DT +DH   PP A
Sbjct  161  SAAGYLPAHPAG-------YHAAANKMAVFPGYGLVPVWQYLPPSARDTSQDHEHRPPAA  213



>ref|XP_008391189.1| PREDICTED: transcription factor bHLH104-like [Malus domestica]
 ref|XP_008351308.1| PREDICTED: transcription factor bHLH104-like [Malus domestica]
Length=224

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 113/172 (66%), Gaps = 5/172 (3%)
 Frame = -2

Query  575  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  396
            RKR ++ +CSG + +KA REK+RR RLNDRF ELS V++PG  PK DK+AIL DAVR++ 
Sbjct  56   RKRGRTDSCSGGSGAKACREKLRRERLNDRFVELSGVLEPGXXPKTDKAAILDDAVRVLN  115

Query  395  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GFLP  219
            QLR EAQ+L E+ + L E+V  LKAEKNEL+ EK  LK +K++LE QLK +   P GF+P
Sbjct  116  QLRAEAQELTETNQKLLEEVKSLKAEKNELRXEKLVLKADKERLEQQLKGMAISPSGFVP  175

Query  218  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSLPPVA  63
              PA     P  +H    K+  +  Y  +PMW +  P+  DT  DH L P A
Sbjct  176  THPAV----PAAYHPGANKMAVYPSYSLVPMWHYIPPSXRDTSRDHELRPPA  223



>gb|KJB72345.1| hypothetical protein B456_011G172500 [Gossypium raimondii]
Length=210

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 11/180 (6%)
 Frame = -2

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS  ++PG+P + DKSAIL 
Sbjct  40   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSTLEPGRPARTDKSAILD  97

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN-  240
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE+++EK  LK  K+++E QLK LN 
Sbjct  98   DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIREEKLVLKANKERIEQQLKTLNV  157

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS-LPPVA  63
            S  G+LP  PA        +H    K+  F GY  +P+WQ+  P+  DT +DH   PP A
Sbjct  158  SAAGYLPAHPAG-------YHAAANKMAVFPGYGLVPVWQYLPPSARDTSQDHEHRPPAA  210



>gb|KJB72344.1| hypothetical protein B456_011G172500 [Gossypium raimondii]
Length=212

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 119/180 (66%), Gaps = 11/180 (6%)
 Frame = -2

Query  596  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  417
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS  ++PG+P + DKSAIL 
Sbjct  42   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSTLEPGRPARTDKSAILD  99

Query  416  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLN-  240
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE+++EK  LK  K+++E QLK LN 
Sbjct  100  DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIREEKLVLKANKERIEQQLKTLNV  159

Query  239  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHS-LPPVA  63
            S  G+LP  PA        +H    K+  F GY  +P+WQ+  P+  DT +DH   PP A
Sbjct  160  SAAGYLPAHPAG-------YHAAANKMAVFPGYGLVPVWQYLPPSARDTSQDHEHRPPAA  212



>ref|XP_004134070.1| PREDICTED: transcription factor bHLH104-like [Cucumis sativus]
 ref|XP_004169970.1| PREDICTED: transcription factor bHLH104-like [Cucumis sativus]
 gb|KGN56869.1| hypothetical protein Csa_3G135660 [Cucumis sativus]
Length=226

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 11/178 (6%)
 Frame = -2

Query  590  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  411
            N CS RKR + G+C+GA+ SKA RE++RR +LNDRF +LS  ++P +  K +K AIL DA
Sbjct  58   NDCS-RKRARDGSCAGAS-SKACRERLRREKLNDRFLDLSIALEPSRHTKTNKPAILDDA  115

Query  410  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNS-R  234
            +R++ QL++EA++LK++ E L+E+V  LKAEKN+L+ EK  LKE+K+K+E QLK++    
Sbjct  116  IRVLNQLKNEAEELKQTNEKLREEVESLKAEKNDLRKEKIILKEDKEKMEQQLKSIAIPS  175

Query  233  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
            PG +P  PA        +H   GK+  F GY  IPMWQ+  P++ DT +DH L PP A
Sbjct  176  PGLIPGHPAA-------YHAASGKMAVFPGYGLIPMWQYLPPSIRDTSQDHELRPPAA  226



>ref|XP_009409051.1| PREDICTED: transcription factor ILR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 116/180 (64%), Gaps = 10/180 (6%)
 Frame = -2

Query  590  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  411
            N  S +KR +  +C  A  +KA REK+RR RLNDRF EL  VMDPGKPPK DKSAILSDA
Sbjct  48   NNGSRKKRNRVESC-AAPGTKACREKLRRDRLNDRFTELCSVMDPGKPPKTDKSAILSDA  106

Query  410  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP  231
             R++  LR EA+KLK+S E  ++ +  LKAEK EL+DEK +LK EK++ E  LKA+++ P
Sbjct  107  TRLMNHLRLEAKKLKDSNEAFKDAIKSLKAEKLELRDEKMRLKAEKERTEQMLKAISTTP  166

Query  230  GFLPHPPATAVPFPTPHHLVGG---KLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             F+  P A      TPH        K +P   Y  + MW++  PA +DT +DH L PPVA
Sbjct  167  QFMTQPAAA-----TPHSASVAAHIKTIPHPSYMPMGMWRWIPPAALDTSQDHVLRPPVA  221



>ref|NP_001150072.1| DNA binding protein [Zea mays]
 ref|XP_008643673.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
 gb|ACF85925.1| unknown [Zea mays]
 gb|ACG37703.1| DNA binding protein [Zea mays]
 gb|AFW69800.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04361.1| bHLH transcription factor, partial [Zea mays]
Length=235

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 116/177 (66%), Gaps = 9/177 (5%)
 Frame = -2

Query  572  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  393
            KR +   CS    SKA REKMRR +LNDRF ELS +M+PGK  K+DK+ ILSDA RMV Q
Sbjct  56   KRGRDEPCSSGPTSKACREKMRRDKLNDRFLELSSIMNPGKEAKLDKANILSDAARMVAQ  115

Query  392  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP-GF---  225
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  116  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  175

Query  224  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQFAAPAVIDTPEDHSLPP  69
            LPHP    PA   PF  P      K  P    +PG+ MWQ+  P ++DT +D  L P
Sbjct  176  LPHPASYHPAAFTPFAPPQQAPANKSAPIPAPFPGMAMWQWLPPTIVDTTQDPKLWP  232



>ref|XP_009388594.1| PREDICTED: transcription factor bHLH115-like [Musa acuminata 
subsp. malaccensis]
Length=230

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 4/177 (2%)
 Frame = -2

Query  590  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  411
            N  + RKR ++ +C+    +KA REK+RR RLN RF EL  ++DPGKPPK DK AIL DA
Sbjct  57   NNGNLRKRPRAESCA-VPGTKACREKIRRDRLNCRFTELCSILDPGKPPKTDKFAILGDA  115

Query  410  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkaLNSRP  231
             R++  LR+EA+K KES E L + +  +KAEK EL+DE+ +LK EK ++E  LK +++ P
Sbjct  116  TRLLNHLRNEAKKTKESNEALHDAIKNMKAEKVELRDERTRLKAEKARIEEMLKVISTTP  175

Query  230  GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAAPAVIDTPEDHSL-PPVA  63
             F+  P   A  F         K +P+  Y  + MWQ+ APA IDT +DH L PPVA
Sbjct  176  QFITQP--AAATFHETSAAAHSKTIPYPNYLPMGMWQWTAPAAIDTSQDHVLRPPVA  230



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150