BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045J15

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN71162.1|  hypothetical protein VITISV_015705                     218   5e-67   Vitis vinifera
gb|AAC69181.1|  peroxisomal targeting sequence 1 receptor               220   1e-66   Nicotiana tabacum [American tobacco]
ref|XP_008811134.1|  PREDICTED: peroxisome biogenesis protein 5-like    215   4e-66   Phoenix dactylifera
gb|AAC69180.1|  peroxisomal targeting sequence 1 receptor               222   6e-65   Nicotiana tabacum [American tobacco]
ref|XP_008384983.1|  PREDICTED: peroxisome biogenesis protein 5-like    219   1e-64   
ref|XP_003598273.1|  Peroxisomal targeting signal 1 receptor            211   2e-64   
ref|XP_009787957.1|  PREDICTED: peroxisome biogenesis protein 5         223   5e-64   Nicotiana sylvestris
ref|XP_002529211.1|  peroxisomal targeting signal type 1 (pts1) r...    214   8e-64   
ref|XP_011095665.1|  PREDICTED: peroxisome biogenesis protein 5         222   9e-64   Sesamum indicum [beniseed]
gb|AAC69177.1|  peroxisomal targeting signal 1 receptor                 221   1e-63   Nicotiana tabacum [American tobacco]
ref|XP_004248297.1|  PREDICTED: peroxisome biogenesis protein 5         221   2e-63   Solanum lycopersicum
ref|XP_006352575.1|  PREDICTED: peroxisome biogenesis protein 5-like    220   3e-63   Solanum tuberosum [potatoes]
gb|EYU27520.1|  hypothetical protein MIMGU_mgv1a001936mg                220   4e-63   Erythranthe guttata [common monkey flower]
ref|XP_010089722.1|  Peroxisome biogenesis protein 5                    213   5e-63   
ref|XP_010644705.1|  PREDICTED: peroxisome biogenesis protein 5 i...    219   7e-63   Vitis vinifera
ref|XP_010644706.1|  PREDICTED: peroxisome biogenesis protein 5 i...    219   7e-63   Vitis vinifera
ref|XP_009374433.1|  PREDICTED: peroxisome biogenesis protein 5-l...    219   8e-63   Pyrus x bretschneideri [bai li]
ref|XP_009374434.1|  PREDICTED: peroxisome biogenesis protein 5-l...    219   8e-63   Pyrus x bretschneideri [bai li]
emb|CDP13627.1|  unnamed protein product                                219   1e-62   Coffea canephora [robusta coffee]
ref|XP_008246513.1|  PREDICTED: peroxisome biogenesis protein 5         219   1e-62   Prunus mume [ume]
ref|XP_007207214.1|  hypothetical protein PRUPE_ppa001874mg             219   1e-62   Prunus persica
ref|XP_006378020.1|  peroxisomal targeting signal-1 receptor fami...    218   3e-62   
ref|XP_011000400.1|  PREDICTED: peroxisome biogenesis protein 5         218   3e-62   Populus euphratica
emb|CDY67858.1|  BnaCnng56710D                                          206   3e-62   Brassica napus [oilseed rape]
ref|XP_008355814.1|  PREDICTED: peroxisome biogenesis protein 5-like    218   3e-62   
ref|XP_003598272.1|  Peroxisomal targeting signal 1 receptor            211   3e-62   
ref|XP_009379080.1|  PREDICTED: peroxisome biogenesis protein 5-l...    218   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_009379078.1|  PREDICTED: peroxisome biogenesis protein 5-l...    218   3e-62   Pyrus x bretschneideri [bai li]
ref|XP_004159522.1|  PREDICTED: peroxisome biogenesis protein 5-like    213   4e-62   
ref|XP_009410316.1|  PREDICTED: peroxisome biogenesis protein 5         217   9e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007020294.1|  Peroxin 5 isoform 4                                216   1e-61   
ref|XP_007020291.1|  Peroxin 5 isoform 1                                216   1e-61   
ref|XP_011461534.1|  PREDICTED: peroxisome biogenesis protein 5         216   1e-61   Fragaria vesca subsp. vesca
ref|XP_010263067.1|  PREDICTED: peroxisome biogenesis protein 5         216   2e-61   Nelumbo nucifera [Indian lotus]
gb|KJB63150.1|  hypothetical protein B456_009G455400                    216   2e-61   Gossypium raimondii
gb|KJB63159.1|  hypothetical protein B456_009G455400                    216   2e-61   Gossypium raimondii
gb|KDP29519.1|  hypothetical protein JCGZ_19232                         215   3e-61   Jatropha curcas
ref|XP_010913243.1|  PREDICTED: peroxisome biogenesis protein 5-like    215   3e-61   Elaeis guineensis
ref|XP_008806178.1|  PREDICTED: peroxisome biogenesis protein 5-like    215   4e-61   Phoenix dactylifera
ref|XP_002299082.1|  peroxisomal targeting signal-1 receptor fami...    214   5e-61   
gb|AAC97489.1|  peroxisomal targeting signal-1 receptor                 213   8e-61   Citrullus lanatus subsp. vulgaris
ref|XP_010676141.1|  PREDICTED: peroxisome biogenesis protein 5         213   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006474746.1|  PREDICTED: peroxisome biogenesis protein 5-like    213   1e-60   Citrus sinensis [apfelsine]
ref|XP_006452789.1|  hypothetical protein CICLE_v10007566mg             213   1e-60   Citrus clementina [clementine]
gb|KGN55958.1|  hypothetical protein Csa_3G039290                       213   1e-60   Cucumis sativus [cucumbers]
ref|XP_008448966.1|  PREDICTED: peroxisome biogenesis protein 5         213   2e-60   Cucumis melo [Oriental melon]
ref|XP_004147973.1|  PREDICTED: peroxisome biogenesis protein 5-like    213   2e-60   
ref|XP_004499675.1|  PREDICTED: peroxisome biogenesis protein 5-like    213   2e-60   Cicer arietinum [garbanzo]
gb|KHN20585.1|  Peroxisome biogenesis protein 5                         213   2e-60   Glycine soja [wild soybean]
ref|XP_006578359.1|  PREDICTED: peroxisome biogenesis protein 5-l...    211   2e-60   
gb|KHN44770.1|  Peroxisome biogenesis protein 5                         212   3e-60   Glycine soja [wild soybean]
ref|XP_003523862.1|  PREDICTED: peroxisome biogenesis protein 5-l...    212   3e-60   Glycine max [soybeans]
gb|AES68523.2|  peroxisomal targeting signal 1 receptor                 212   4e-60   Medicago truncatula
ref|XP_007020292.1|  Peroxin 5 isoform 2                                212   5e-60   
ref|XP_010928166.1|  PREDICTED: peroxisome biogenesis protein 5-like    211   7e-60   Elaeis guineensis
ref|XP_007148691.1|  hypothetical protein PHAVU_005G006500g             211   8e-60   Phaseolus vulgaris [French bean]
gb|EPS66664.1|  peroxisomal targeting signal 1 receptor                 210   2e-59   Genlisea aurea
gb|AAX11256.1|  peroxisomal targeting signal 1 receptor short form      209   2e-59   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD08811.1|  putative peroxisomal targeting signal 1 receptor       209   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659548.1|  PREDICTED: peroxisome biogenesis protein 5-l...    209   3e-59   Oryza brachyantha
ref|XP_006659547.1|  PREDICTED: peroxisome biogenesis protein 5-l...    209   4e-59   Oryza brachyantha
gb|AAX11255.1|  peroxisomal targeting signal 1 receptor long form       209   4e-59   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062153.1|  Os08g0500100                                       209   4e-59   
gb|EEC83824.1|  hypothetical protein OsI_29764                          209   4e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010061377.1|  PREDICTED: peroxisome biogenesis protein 5         208   7e-59   Eucalyptus grandis [rose gum]
ref|XP_009120148.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisome b...    206   4e-58   Brassica rapa
ref|XP_008666997.1|  PREDICTED: uncharacterized protein LOC100191...    206   4e-58   Zea mays [maize]
gb|AAC62012.1|  peroxisomal targeting signal type 1 receptor            206   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574713.1|  PREDICTED: peroxisome biogenesis protein 5         206   5e-58   Brachypodium distachyon [annual false brome]
ref|XP_002445936.1|  hypothetical protein SORBIDRAFT_07g028340          206   5e-58   Sorghum bicolor [broomcorn]
tpg|DAA47839.1|  TPA: hypothetical protein ZEAMMB73_779817              206   5e-58   
ref|NP_200440.1|  peroxisome biogenesis protein 5                       206   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008666974.1|  PREDICTED: uncharacterized protein LOC100191...    206   5e-58   Zea mays [maize]
ref|NP_001130381.1|  uncharacterized protein LOC100191477               206   6e-58   Zea mays [maize]
ref|XP_004973819.1|  PREDICTED: peroxisome biogenesis protein 5-l...    204   1e-57   Setaria italica
ref|XP_010450900.1|  PREDICTED: peroxisome biogenesis protein 5-l...    204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004973818.1|  PREDICTED: peroxisome biogenesis protein 5-l...    205   2e-57   Setaria italica
ref|XP_010483103.1|  PREDICTED: peroxisome biogenesis protein 5         204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008679528.1|  PREDICTED: peroxisome biogenesis protein 5-l...    204   2e-57   Zea mays [maize]
gb|AFW65172.1|  hypothetical protein ZEAMMB73_964933                    204   2e-57   
ref|XP_002864444.1|  hypothetical protein ARALYDRAFT_495719             204   2e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_010443280.1|  PREDICTED: peroxisome biogenesis protein 5-like    204   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008679527.1|  PREDICTED: peroxisome biogenesis protein 5-l...    204   2e-57   Zea mays [maize]
ref|XP_006401353.1|  hypothetical protein EUTSA_v10012791mg             204   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006401352.1|  hypothetical protein EUTSA_v10012791mg             204   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_008679526.1|  PREDICTED: peroxisome biogenesis protein 5-l...    204   2e-57   Zea mays [maize]
emb|CDY36789.1|  BnaA03g10970D                                          204   3e-57   Brassica napus [oilseed rape]
ref|XP_009132316.1|  PREDICTED: peroxisome biogenesis protein 5-like    204   3e-57   Brassica rapa
emb|CDY11941.1|  BnaC03g13670D                                          204   3e-57   Brassica napus [oilseed rape]
ref|XP_010539370.1|  PREDICTED: peroxisome biogenesis protein 5 i...    204   3e-57   Tarenaya hassleriana [spider flower]
gb|ABB92565.1|  peroxisomal import receptor PTS1                        204   3e-57   Brassica napus [oilseed rape]
ref|XP_010539369.1|  PREDICTED: peroxisome biogenesis protein 5 i...    204   3e-57   Tarenaya hassleriana [spider flower]
emb|CDY49390.1|  BnaC09g53570D                                          203   4e-57   Brassica napus [oilseed rape]
gb|KFK27205.1|  hypothetical protein AALP_AA8G349500                    202   1e-56   Arabis alpina [alpine rockcress]
ref|XP_006857544.1|  hypothetical protein AMTR_s00061p00043210          197   1e-54   
gb|EMT18446.1|  Peroxisomal targeting signal 1 receptor                 189   1e-51   
ref|XP_010450908.1|  PREDICTED: peroxisome biogenesis protein 5-l...    186   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002980203.1|  hypothetical protein SELMODRAFT_444455             179   2e-48   
ref|XP_001772418.1|  predicted protein                                  177   5e-48   
ref|XP_002963119.1|  hypothetical protein SELMODRAFT_78782              177   7e-48   
emb|CDY66435.1|  BnaC02g12360D                                          162   1e-46   Brassica napus [oilseed rape]
gb|KDO73933.1|  hypothetical protein CISIN_1g024618mg                   164   1e-45   Citrus sinensis [apfelsine]
ref|XP_003056940.1|  peroxisomal protein importer family                171   2e-45   Micromonas pusilla CCMP1545
ref|XP_007020293.1|  Peroxin 5 isoform 3                                167   3e-44   
ref|XP_007020296.1|  Peroxin 5 isoform 6                                165   2e-43   
ref|XP_002502498.1|  peroxisomal protein importer family                164   1e-42   Micromonas commoda
gb|KCW68311.1|  hypothetical protein EUGRSUZ_F01979                     162   1e-42   Eucalyptus grandis [rose gum]
gb|KJB63152.1|  hypothetical protein B456_009G455400                    161   3e-42   Gossypium raimondii
ref|XP_005645163.1|  TPR-like protein                                   156   2e-40   Coccomyxa subellipsoidea C-169
gb|KDD74974.1|  hypothetical protein H632_c953p0                        144   2e-39   Helicosporidium sp. ATCC 50920
ref|XP_003079364.1|  putative peroxisomal targeting signal 1 rece...    145   9e-37   
ref|XP_005849526.1|  hypothetical protein CHLNCDRAFT_21245              144   1e-36   Chlorella variabilis
emb|CEF97993.1|  Tetratricopeptide repeat                               146   1e-36   Ostreococcus tauri
ref|XP_001418009.1|  peroxisomal targeting signal 1 receptor            145   3e-36   Ostreococcus lucimarinus CCE9901
ref|XP_002945667.1|  hypothetical protein VOLCADRAFT_120154             145   8e-36   Volvox carteri f. nagariensis
ref|XP_007514089.1|  TPR repeat-containing protein                      140   1e-34   Bathycoccus prasinos
ref|XP_001690276.1|  peroxisomal targeting signal 1 receptor            140   4e-34   Chlamydomonas reinhardtii
ref|XP_011395784.1|  Peroxisome biogenesis protein 5                    134   8e-33   Auxenochlorella protothecoides
gb|KIZ06207.1|  peroxin-5                                               127   2e-29   Monoraphidium neglectum
gb|EWM20982.1|  peroxisomal targeting signal 1 receptor                 119   6e-29   Nannochloropsis gaditana
ref|XP_005708204.1|  peroxisomal targeting signal type 1 (PTS1) r...    124   7e-29   Galdieria sulphuraria
ref|XP_009841352.1|  hypothetical protein H257_15069                    123   1e-28   Aphanomyces astaci
ref|XP_009521756.1|  hypothetical protein PHYSODRAFT_556029             123   1e-28   Phytophthora sojae
gb|ETK76697.1|  hypothetical protein L915_16963                         122   5e-28   Phytophthora parasitica
ref|XP_008895910.1|  hypothetical protein PPTG_03877                    122   5e-28   Phytophthora parasitica INRA-310
gb|ETI36422.1|  hypothetical protein F443_17442                         122   5e-28   Phytophthora parasitica P1569
gb|KDO20672.1|  hypothetical protein SPRG_13424                         121   5e-28   Saprolegnia parasitica CBS 223.65
emb|CCA20458.1|  peroxisomal targeting signal 1 receptor putative       121   5e-28   Albugo laibachii Nc14
gb|ETL83352.1|  hypothetical protein L917_16701                         122   5e-28   Phytophthora parasitica
ref|XP_002900734.1|  peroxisomal targeting signal 1 receptor, put...    122   6e-28   Phytophthora infestans T30-4
emb|CCI42503.1|  unnamed protein product                                119   1e-27   Albugo candida
ref|XP_008609900.1|  hypothetical protein SDRG_05933                    119   4e-27   Saprolegnia diclina VS20
ref|XP_002177392.1|  predicted protein                                  115   4e-26   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008874240.1|  hypothetical protein, variant                      115   6e-26   Aphanomyces invadans
ref|XP_008874239.1|  hypothetical protein H310_09842                    115   7e-26   Aphanomyces invadans
ref|WP_028830491.1|  hypothetical protein                               110   1e-25   
ref|XP_005826999.1|  hypothetical protein GUITHDRAFT_114013             108   5e-24   Guillardia theta CCMP2712
ref|XP_005536540.1|  similar to peroxisomal targeting signal type...    108   2e-23   Cyanidioschyzon merolae strain 10D
gb|ETO35826.1|  hypothetical protein RFI_01236                          103   4e-23   Reticulomyxa filosa
gb|EMS62055.1|  Peroxisome biogenesis protein 5                         108   5e-23   Triticum urartu
ref|XP_002294361.1|  peroxisomal targeting signal receptor              103   8e-23   Thalassiosira pseudonana CCMP1335
emb|CDJ61272.1|  TPR domain-containing protein, putative                106   2e-22   Eimeria maxima
emb|CBJ48315.1|  conserved unknown protein                              105   3e-22   Ectocarpus siliculosus
ref|XP_006819303.1|  PREDICTED: peroxisomal targeting signal 1 re...    105   3e-22   Saccoglossus kowalevskii
gb|ETO25949.1|  hypothetical protein RFI_11184                          103   4e-22   Reticulomyxa filosa
gb|EJK69679.1|  hypothetical protein THAOC_09039                      99.4    5e-22   Thalassiosira oceanica
ref|XP_004027388.1|  hypothetical protein IMG5_184450                   103   1e-21   Ichthyophthirius multifiliis
ref|XP_007020297.1|  Peroxin 5 isoform 7                                102   3e-21   
ref|XP_007020295.1|  Peroxin 5 isoform 5                                102   3e-21   
gb|KFG55362.1|  tetratricopeptide repeat-containing protein           97.4    3e-21   Toxoplasma gondii FOU
ref|XP_005769450.1|  hypothetical protein EMIHUDRAFT_459060             100   6e-21   Emiliania huxleyi CCMP1516
emb|CDI79114.1|  TPR domain-containing protein, putative                102   8e-21   Eimeria acervulina
ref|XP_005784618.1|  hypothetical protein EMIHUDRAFT_449555             100   8e-21   Emiliania huxleyi CCMP1516
ref|XP_002113707.1|  hypothetical protein TRIADDRAFT_57411              100   9e-21   Trichoplax adhaerens
gb|KFW07374.1|  Peroxisomal targeting signal 1 receptor               95.5    2e-20   Eurypyga helias
emb|CDW84760.1|  peroxisome biogenesis protein 5-like                 99.8    2e-20   Stylonychia lemnae
gb|KFH17395.1|  tetratricopeptide repeat-containing protein           96.7    2e-20   Toxoplasma gondii MAS
emb|CDJ63704.1|  TPR domain-containing protein, putative                100   3e-20   Eimeria necatrix
ref|XP_010668551.1|  PREDICTED: peroxisome biogenesis protein 5-like  95.5    4e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|AAI11710.1|  Pex5 protein                                          94.4    6e-20   Rattus norvegicus [brown rat]
ref|XP_010152181.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.5    9e-20   Eurypyga helias
ref|XP_001013887.2|  TPR Domain containing protein                    98.2    9e-20   
gb|KFQ90424.1|  Peroxisomal targeting signal 1 receptor               93.6    9e-20   Phoenicopterus ruber ruber
gb|EAR93642.3|  tetratricopeptide repeat protein                      98.2    9e-20   Tetrahymena thermophila SB210
dbj|GAM24309.1|  hypothetical protein SAMD00019534_074840             98.2    1e-19   Acytostelium subglobosum LB1
dbj|GAM24169.1|  hypothetical protein SAMD00019534_073440             97.1    1e-19   Acytostelium subglobosum LB1
ref|XP_009010553.1|  hypothetical protein HELRODRAFT_183274           93.2    1e-19   Helobdella robusta
gb|KFG63721.1|  tetratricopeptide repeat-containing protein           95.9    1e-19   Toxoplasma gondii RUB
ref|XP_011431303.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.1    2e-19   Crassostrea gigas
pdb|2C0L|A  Chain A, Tpr Domain Of Human Pex5p In Complex With Hu...  94.7    2e-19   Homo sapiens [man]
pdb|3R9A|B  Chain B, Human Alanine-Glyoxylate Aminotransferase In...  94.7    2e-19   Homo sapiens [man]
pdb|2J9Q|A  Chain A, A Novel Conformation For The Tpr Domain Of P...  94.4    2e-19   Homo sapiens [man]
pdb|2C0M|A  Chain A, Apo Form Of The Tpr Domain Of The Pex5p Rece...  94.4    2e-19   Homo sapiens [man]
gb|KGG51182.1|  hypothetical protein DI09_42p250                      96.3    2e-19   Mitosporidium daphniae
ref|XP_003287008.1|  hypothetical protein DICPUDRAFT_47119            97.1    2e-19   Dictyostelium purpureum
ref|XP_006014027.1|  PREDICTED: peroxisomal targeting signal 1 re...  96.3    3e-19   Latimeria chalumnae
ref|XP_003883433.1|  putative TPR domain-containing protein           97.4    3e-19   Neospora caninum Liverpool
ref|XP_002586247.1|  hypothetical protein BRAFLDRAFT_62718            96.3    3e-19   Branchiostoma floridae
ref|XP_006738309.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    4e-19   Leptonychotes weddellii
gb|EJY65472.1|  hypothetical protein OXYTRI_14373                     96.3    4e-19   Oxytricha trifallax
pdb|1FCH|A  Chain A, Crystal Structure Of The Pts1 Complexed To T...  94.0    4e-19   Homo sapiens [man]
dbj|BAG61481.1|  unnamed protein product                              94.0    4e-19   Homo sapiens [man]
gb|EPY42762.1|  peroxin-5                                             94.0    4e-19   Angomonas deanei
ref|XP_002610911.1|  hypothetical protein BRAFLDRAFT_60314            95.9    5e-19   Branchiostoma floridae
ref|XP_003771284.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.9    5e-19   
ref|XP_002368058.1|  TPR domain-containing protein                    95.9    5e-19   
ref|XP_006127421.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.9    5e-19   
gb|KFG51068.1|  tetratricopeptide repeat-containing protein           96.3    6e-19   Toxoplasma gondii p89
gb|KFH11152.1|  tetratricopeptide repeat-containing protein           96.3    6e-19   Toxoplasma gondii VAND
ref|XP_005420741.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.5    6e-19   
ref|XP_003771282.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.9    6e-19   Sarcophilus harrisii
ref|XP_003771283.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.5    6e-19   Sarcophilus harrisii
gb|EPR64293.1|  tetratricopeptide repeat-containing protein           96.3    6e-19   Toxoplasma gondii GT1
gb|EPT28915.1|  tetratricopeptide repeat-containing protein           96.3    6e-19   Toxoplasma gondii ME49
ref|XP_005486224.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.5    7e-19   
ref|XP_007503751.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.5    7e-19   Monodelphis domestica
ref|XP_009975102.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  95.5    7e-19   Tyto alba [Schleiereule]
ref|XP_009018401.1|  hypothetical protein HELRODRAFT_80635            92.8    7e-19   Helobdella robusta
ref|XP_001370656.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.5    7e-19   
ref|XP_009975101.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  95.5    7e-19   Tyto alba [Schleiereule]
ref|XP_009975100.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  95.5    8e-19   Tyto alba [Schleiereule]
ref|XP_009100897.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  95.1    9e-19   
ref|XP_004692979.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.1    9e-19   Condylura cristata
ref|XP_004692977.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.1    9e-19   
ref|XP_004692980.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.1    1e-18   Condylura cristata
ref|XP_011431302.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.7    1e-18   Crassostrea gigas
ref|XP_011431301.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.1    1e-18   Crassostrea gigas
ref|XP_004692978.1|  PREDICTED: peroxisomal targeting signal 1 re...  95.1    1e-18   
ref|XP_007420463.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  95.1    1e-18   
ref|XP_008885674.1|  tetratricopeptide repeat-containing protein      95.5    1e-18   
gb|ELV09735.1|  Calsyntenin-3                                         95.9    1e-18   Tupaia chinensis
ref|XP_001498231.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.7    1e-18   
ref|XP_002769981.1|  Peroxisomal targeting signal receptor, putative  94.4    1e-18   Perkinsus marinus ATCC 50983
gb|KFP04959.1|  Peroxisomal targeting signal 1 receptor               94.4    1e-18   Calypte anna
ref|XP_004344039.1|  tetratricopeptide repeat-containing protein      94.7    2e-18   Acanthamoeba castellanii str. Neff
ref|XP_005610958.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.4    2e-18   
ref|XP_004052676.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    2e-18   
ref|XP_009897926.1|  PREDICTED: peroxisomal biogenesis factor 5       94.4    2e-18   Picoides pubescens
ref|XP_005610960.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.4    2e-18   
ref|XP_003223806.2|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  94.4    2e-18   
gb|KFQ17552.1|  Peroxisomal targeting signal 1 receptor               94.4    2e-18   Merops nubicus
ref|XP_005610957.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.4    2e-18   Equus caballus [domestic horse]
gb|KFW74119.1|  Peroxisomal targeting signal 1 receptor               94.4    2e-18   Manacus vitellinus
gb|EPY41380.1|  peroxin-5                                             94.0    2e-18   Angomonas deanei
ref|XP_005610959.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.4    2e-18   
emb|CDJ44843.1|  TPR domain-containing protein, putative              92.4    2e-18   Eimeria tenella
ref|XP_005235427.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  94.4    2e-18   Falco peregrinus [peregrine]
ref|XP_009460105.1|  PREDICTED: peroxisomal biogenesis factor 5       94.4    2e-18   Nipponia nippon
ref|XP_010394441.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Corvus cornix cornix
ref|XP_008933539.1|  PREDICTED: peroxisomal biogenesis factor 5       94.4    2e-18   Merops nubicus
ref|XP_009891125.1|  PREDICTED: peroxisomal biogenesis factor 5       94.0    2e-18   Charadrius vociferus
gb|EPQ04457.1|  Peroxisomal targeting signal 1 receptor               93.2    2e-18   Myotis brandtii
ref|XP_010394440.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Corvus cornix cornix
ref|XP_005434403.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   
ref|XP_004092183.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   Nomascus leucogenys [White-cheeked Gibbon]
gb|KGL87086.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Charadrius vociferus
ref|XP_009705583.1|  PREDICTED: peroxisomal biogenesis factor 5       94.0    2e-18   Cariama cristata
gb|KFQ90935.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Nipponia nippon
ref|XP_004909555.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.4    2e-18   
ref|XP_009982723.1|  PREDICTED: peroxisomal biogenesis factor 5       94.0    2e-18   Tauraco erythrolophus
ref|XP_009423019.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pan troglodytes
ref|XP_004909557.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   
ref|XP_009476807.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.4    2e-18   Pelecanus crispus
gb|KFR07406.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Opisthocomus hoazin [hoatzin]
ref|XP_009476809.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pelecanus crispus
ref|XP_008928851.1|  PREDICTED: peroxisomal biogenesis factor 5       94.4    2e-18   
gb|KFV01478.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Tauraco erythrolophus
gb|EHB18640.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Heterocephalus glaber [naked mole rat]
ref|XP_009930335.1|  PREDICTED: peroxisomal biogenesis factor 5       94.0    2e-18   Opisthocomus hoazin [hoatzin]
gb|KFZ65987.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Podiceps cristatus
gb|KFO57790.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Corvus brachyrhynchos
ref|XP_008630159.1|  PREDICTED: peroxisomal biogenesis factor 5       94.0    2e-18   Corvus brachyrhynchos
ref|XP_010011125.1|  PREDICTED: peroxisomal biogenesis factor 5       94.0    2e-18   Nestor notabilis
ref|XP_009423014.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pan troglodytes
ref|XP_010310881.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Balearica regulorum gibbericeps
ref|XP_006268393.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   Alligator mississippiensis
ref|XP_008497379.1|  PREDICTED: peroxisomal biogenesis factor 5       94.4    2e-18   Calypte anna
ref|XP_008971897.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pan paniscus [bonobo]
gb|AIC55002.1|  PEX5                                                  94.0    2e-18   synthetic construct
ref|XP_005570066.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   Macaca fascicularis [crab eating macaque]
ref|XP_008971892.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pan paniscus [bonobo]
gb|EAW88673.1|  peroxisomal biogenesis factor 5, isoform CRA_c        94.0    2e-18   Homo sapiens [man]
ref|XP_010310884.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Balearica regulorum gibbericeps
ref|XP_009423018.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pan troglodytes
ref|XP_009178392.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Papio anubis [baboon]
ref|NP_000310.2|  peroxisomal biogenesis factor 5 isoform b           94.0    2e-18   Homo sapiens [man]
ref|XP_002798518.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    2e-18   
gb|EHH20452.1|  Peroxisomal targeting signal 1 receptor               94.0    2e-18   Macaca mulatta [rhesus macaque]
ref|XP_002798517.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   
ref|XP_010310882.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Balearica regulorum gibbericeps
ref|XP_001164247.2|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Pan troglodytes
ref|XP_007965656.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   Chlorocebus sabaeus
ref|XP_004092182.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    2e-18   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005253512.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    2e-18   
ref|XP_005570067.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   Macaca fascicularis [crab eating macaque]
ref|XP_005570064.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   
ref|XP_005570063.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    2e-18   
ref|XP_006268392.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    3e-18   Alligator mississippiensis
ref|XP_001164320.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   Pan troglodytes
ref|NP_001287718.1|  peroxisomal biogenesis factor 5 isoform e        94.0    3e-18   
ref|NP_001124495.1|  peroxisomal biogenesis factor 5 isoform a        94.0    3e-18   
ref|XP_001112429.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    3e-18   
ref|XP_001112463.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_009996709.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_002822892.3|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  94.0    3e-18   
gb|EAW88675.1|  peroxisomal biogenesis factor 5, isoform CRA_e        94.0    3e-18   
ref|XP_001437511.1|  hypothetical protein                             94.0    3e-18   
ref|XP_006170833.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    3e-18   
ref|XP_010386340.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    3e-18   
ref|NP_001124496.1|  peroxisomal biogenesis factor 5 isoform c        93.6    3e-18   
ref|XP_004176027.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  94.0    3e-18   
ref|XP_010386339.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    3e-18   
ref|NP_001124497.1|  peroxisomal biogenesis factor 5 isoform d        94.0    3e-18   
ref|XP_006757602.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    3e-18   
gb|AAC50103.1|  peroxisomal targeting signal receptor 1               93.6    3e-18   
ref|XP_005655750.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    3e-18   
ref|XP_009178393.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_005038585.1|  PREDICTED: peroxisomal targeting signal 1 re...  94.0    3e-18   
ref|XP_009996701.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    3e-18   
gb|EAW88670.1|  peroxisomal biogenesis factor 5, isoform CRA_a        93.6    3e-18   
dbj|BAG63172.1|  unnamed protein product                              93.2    3e-18   
ref|XP_003273836.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    3e-18   
ref|XP_008823570.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_011364095.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_006719195.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_005338357.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_003988406.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_005253508.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  94.0    3e-18   
ref|XP_005523871.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  93.6    3e-18   
ref|XP_011364094.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_009637496.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  93.6    3e-18   
ref|XP_006914727.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_006757604.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_006757601.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_010610006.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_007089636.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_010386341.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_006757603.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_009001759.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_003355636.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_009001764.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_010134235.1|  PREDICTED: peroxisomal biogenesis factor 5       93.6    3e-18   
ref|XP_011364093.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_006170832.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|NP_001166469.1|  peroxisome biogenesis factor 5                   93.6    3e-18   
ref|XP_003796515.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_005253510.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_005655749.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_001447670.1|  hypothetical protein                             93.6    3e-18   
ref|XP_007089638.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    3e-18   
ref|XP_006933533.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    3e-18   
ref|XP_004438732.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_005338356.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_007089637.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_010331193.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_006170834.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_005655751.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
gb|ELK10421.1|  Peroxisomal targeting signal 1 receptor               93.6    3e-18   
ref|XP_008143112.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_007089635.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_003988404.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_008068939.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    3e-18   
ref|XP_008823568.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_005338358.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    3e-18   
ref|XP_006933532.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    3e-18   
ref|XP_004438730.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    3e-18   
ref|XP_008068938.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    3e-18   
ref|XP_005066082.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
ref|XP_003944935.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_010610005.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    4e-18   
ref|XP_637903.1|  tetratricopeptide-like helical domain-containin...  93.6    4e-18   
ref|XP_010610007.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_003988403.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_009001761.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.6    4e-18   
ref|XP_007644333.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
ref|XP_005862091.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
ref|XP_006084257.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
ref|XP_009001760.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_005862090.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
ref|XP_005365241.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
gb|ELT95480.1|  hypothetical protein CAPTEDRAFT_220978                93.2    4e-18   
dbj|BAE26240.1|  unnamed protein product                              93.2    4e-18   
ref|XP_003944936.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_005365242.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004407678.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004006959.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_006084258.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_008823571.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_008143110.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_005066084.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_002752335.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_867069.2|  PREDICTED: peroxisomal targeting signal 1 recep...  93.6    4e-18   
ref|XP_004438733.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_002922261.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_007644339.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_008143113.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_005862092.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004668708.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_011227001.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_008143111.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_005680972.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004438731.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_010386342.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_008143114.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_004407679.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
dbj|BAC81427.1|  middle form of PTS1-receptor                         93.2    4e-18   
ref|XP_006084260.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_005713498.1|  TPR repeat-containing protein                    92.0    4e-18   
ref|XP_008681732.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_004766677.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_005066085.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_008681731.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_004668707.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_007644336.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_006891300.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_005862089.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_006992107.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_006065926.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_006084259.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|NP_001164055.1|  peroxisomal targeting signal 1 receptor          93.2    4e-18   
ref|XP_002922260.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_006084254.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004407677.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004766675.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.6    4e-18   
ref|NP_001039648.1|  peroxisomal biogenesis factor 5                  93.2    4e-18   
ref|NP_001230930.1|  peroxisomal targeting signal 1 receptor          93.2    4e-18   
ref|XP_007535911.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_005066083.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004006958.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_004668709.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_010833869.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_011227003.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    4e-18   
gb|ELR45309.1|  Peroxisomal targeting signal 1 receptor               93.2    4e-18   
ref|XP_002922262.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    4e-18   
ref|XP_006065927.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_005680973.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    4e-18   
ref|XP_008681734.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    5e-18   
ref|XP_010833889.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    5e-18   
sp|Q2M2R8.2|PEX5_RAT  RecName: Full=Peroxisomal targeting signal ...  93.2    5e-18   
ref|XP_007535910.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    5e-18   
ref|XP_006237446.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_007935342.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    5e-18   
ref|XP_008681735.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  93.2    5e-18   
ref|XP_005680971.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_004006960.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_004668706.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_543837.3|  PREDICTED: peroxisomal targeting signal 1 recep...  93.2    5e-18   
ref|XP_006891301.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_004766673.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_009082143.1|  PREDICTED: peroxisomal biogenesis factor 5       92.8    5e-18   
ref|XP_006210956.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_007535912.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    5e-18   
ref|XP_004643567.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_005637261.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_008681733.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    5e-18   
ref|XP_006891299.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_005378919.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_010989198.1|  PREDICTED: peroxisomal biogenesis factor 5       93.2    5e-18   
ref|XP_006992108.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_005910759.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_006210955.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_005378918.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_004766674.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_006891298.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_004387304.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_004766676.1|  PREDICTED: peroxisomal targeting signal 1 re...  93.2    5e-18   
ref|XP_005378920.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    5e-18   
ref|XP_007935341.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    6e-18   
ref|XP_004643565.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    6e-18   
ref|XP_007935343.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    6e-18   
ref|XP_004643566.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    6e-18   
ref|XP_006173074.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.8    6e-18   
ref|XP_005031877.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.8    6e-18   
gb|EPY89778.1|  peroxisomal targeting signal 1 receptor               92.8    6e-18   
ref|XP_004643568.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    6e-18   
ref|XP_004387303.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    6e-18   
ref|XP_002712800.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    6e-18   
ref|XP_010962340.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    6e-18   
ref|XP_010962416.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.4    6e-18   
ref|XP_008577462.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.8    6e-18   
ref|XP_004387305.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.4    6e-18   
ref|XP_006862676.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.8    6e-18   
ref|XP_004610534.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.4    7e-18   
gb|EMP23960.1|  Peroxisomal targeting signal 1 receptor               92.8    7e-18   
emb|CAB09694.1|  PEX5p                                                92.8    7e-18   
gb|KFZ62747.1|  Peroxisomal targeting signal 1 receptor               92.4    7e-18   
ref|XP_008257998.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.4    7e-18   
ref|XP_006862677.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.4    7e-18   
ref|XP_010170851.1|  PREDICTED: peroxisomal biogenesis factor 5       92.4    7e-18   
ref|XP_008577464.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.4    7e-18   
ref|XP_006862675.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.4    7e-18   
ref|XP_002712799.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.4    7e-18   
ref|NP_033021.2|  peroxisomal biogenesis factor 5 isoform 1           92.4    7e-18   
ref|XP_006862674.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.4    8e-18   
ref|XP_007072394.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.4    8e-18   
ref|NP_787947.1|  peroxisomal biogenesis factor 5 isoform 2           92.4    8e-18   
ref|XP_008257999.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.4    8e-18   
ref|XP_009504748.1|  PREDICTED: peroxisomal biogenesis factor 5       92.0    9e-18   
ref|XP_004345630.1|  peroxisomal biogenesis factor 5                  92.8    9e-18   
ref|XP_009328179.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.4    9e-18   
gb|EDK99735.1|  peroxisome biogenesis factor 5, isoform CRA_c         92.0    9e-18   
gb|KFW91989.1|  Peroxisomal targeting signal 1 receptor               92.0    9e-18   
ref|XP_010179949.1|  PREDICTED: peroxisomal biogenesis factor 5       92.0    9e-18   
ref|XP_004596467.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.0    9e-18   
ref|XP_010289492.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  92.0    9e-18   
ref|XP_009575752.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    9e-18   
ref|XP_009811401.1|  PREDICTED: peroxisomal biogenesis factor 5       92.0    1e-17   
ref|XP_010210676.1|  PREDICTED: peroxisomal biogenesis factor 5       92.0    1e-17   
ref|XP_003410715.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   
ref|XP_010565906.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   
ref|XP_010122761.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   
ref|XP_009869439.1|  PREDICTED: peroxisomal biogenesis factor 5       92.0    1e-17   
gb|KFV96390.1|  Peroxisomal targeting signal 1 receptor               92.0    1e-17   
gb|KGL75718.1|  Peroxisomal targeting signal 1 receptor               92.0    1e-17   
ref|XP_010122760.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   
ref|XP_005146732.1|  PREDICTED: peroxisomal targeting signal 1 re...  92.0    1e-17   
ref|XP_010072289.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   
ref|XP_009926000.1|  PREDICTED: peroxisomal biogenesis factor 5       92.0    1e-17   
ref|XP_010197649.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   
ref|XP_010072290.1|  PREDICTED: peroxisomal biogenesis factor 5 i...  92.0    1e-17   



>emb|CAN71162.1| hypothetical protein VITISV_015705 [Vitis vinifera]
Length=234

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GM+EDSI
Sbjct  125  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMHEDSI  184

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACD+RNLD+LQKEFPL
Sbjct  185  RYYVRALAMNPKADNAWQYLRISLSCASRNDMMEACDARNLDILQKEFPL  234



>gb|AAC69181.1| peroxisomal targeting sequence 1 receptor [Nicotiana tabacum]
Length=332

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  223  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  282

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACD+RNLDVLQKEFPL
Sbjct  283  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDARNLDVLQKEFPL  332



>ref|XP_008811134.1| PREDICTED: peroxisome biogenesis protein 5-like [Phoenix dactylifera]
Length=215

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G++E+SI
Sbjct  106  LKPHDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLHEESI  165

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM EACDSRNLDVLQKEFPL
Sbjct  166  RYYVRALSMNPKADNAWQYLRISLSCASRNDMFEACDSRNLDVLQKEFPL  215



>gb|AAC69180.1| peroxisomal targeting sequence 1 receptor [Nicotiana tabacum]
Length=552

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/110 (96%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  443  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  502

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  503  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  552



>ref|XP_008384983.1| PREDICTED: peroxisome biogenesis protein 5-like [Malus domestica]
Length=463

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  354  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  413

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  414  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  463



>ref|XP_003598273.1| Peroxisomal targeting signal 1 receptor [Medicago truncatula]
Length=216

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  106  LKPQDYSLWNKLGATQANSVQSADAIAAYQQALDLKPNYVRAWANMGISYANQGMYDESI  165

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  166  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  215



>ref|XP_009787957.1| PREDICTED: peroxisome biogenesis protein 5 [Nicotiana sylvestris]
Length=743

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/110 (96%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  634  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  693

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  694  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  743



>ref|XP_002529211.1| peroxisomal targeting signal type 1 (pts1) receptor, putative 
[Ricinus communis]
 gb|EEF33167.1| peroxisomal targeting signal type 1 (pts1) receptor, putative 
[Ricinus communis]
Length=367

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  258  LKPQDYSLWNKLGATQANSVQSADAIYAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  317

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRN+D+LQKEFPL
Sbjct  318  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNIDLLQKEFPL  367



>ref|XP_011095665.1| PREDICTED: peroxisome biogenesis protein 5 [Sesamum indicum]
Length=743

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  634  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  693

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  694  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDILQKEFPL  743



>gb|AAC69177.1| peroxisomal targeting signal 1 receptor [Nicotiana tabacum]
Length=741

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  632  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  691

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACD+RNLDVLQKEFPL
Sbjct  692  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDARNLDVLQKEFPL  741



>ref|XP_004248297.1| PREDICTED: peroxisome biogenesis protein 5 [Solanum lycopersicum]
Length=744

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QS+DAILAYQQALD+KPNYVRAWANMGISYAN GMYEDSI
Sbjct  635  LKPRDYSLWNKLGATQANSVQSSDAILAYQQALDIKPNYVRAWANMGISYANQGMYEDSI  694

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  695  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  744



>ref|XP_006352575.1| PREDICTED: peroxisome biogenesis protein 5-like [Solanum tuberosum]
Length=744

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QS+DAILAYQQALD+KPNYVRAWANMGISYAN GMYEDSI
Sbjct  635  LKPRDYSLWNKLGATQANSVQSSDAILAYQQALDIKPNYVRAWANMGISYANQGMYEDSI  694

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRN+DVLQKEFPL
Sbjct  695  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNIDVLQKEFPL  744



>gb|EYU27520.1| hypothetical protein MIMGU_mgv1a001936mg [Erythranthe guttata]
Length=736

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  627  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  687  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDFLQKEFPL  736



>ref|XP_010089722.1| Peroxisome biogenesis protein 5 [Morus notabilis]
 gb|EXB38283.1| Peroxisome biogenesis protein 5 [Morus notabilis]
Length=403

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GM+EDSI
Sbjct  294  LKPHDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGMHEDSI  353

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCA R+DM+EACDSRNLD+LQKEFPL
Sbjct  354  RYYVRALTMNPKADNAWQYLRISLSCADRSDMLEACDSRNLDILQKEFPL  403



>ref|XP_010644705.1| PREDICTED: peroxisome biogenesis protein 5 isoform X1 [Vitis 
vinifera]
 emb|CBI39871.3| unnamed protein product [Vitis vinifera]
Length=736

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GM+EDSI
Sbjct  627  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMHEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACD+RNLD+LQKEFPL
Sbjct  687  RYYVRALAMNPKADNAWQYLRISLSCASRNDMMEACDARNLDILQKEFPL  736



>ref|XP_010644706.1| PREDICTED: peroxisome biogenesis protein 5 isoform X2 [Vitis 
vinifera]
Length=734

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GM+EDSI
Sbjct  625  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMHEDSI  684

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACD+RNLD+LQKEFPL
Sbjct  685  RYYVRALAMNPKADNAWQYLRISLSCASRNDMMEACDARNLDILQKEFPL  734



>ref|XP_009374433.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=748

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  639  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  698

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  699  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  748



>ref|XP_009374434.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=747

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  638  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  697

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  698  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  747



>emb|CDP13627.1| unnamed protein product [Coffea canephora]
Length=730

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYE+SI
Sbjct  621  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEESI  680

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  681  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDFLQKEFPL  730



>ref|XP_008246513.1| PREDICTED: peroxisome biogenesis protein 5 [Prunus mume]
Length=750

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  641  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  700

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  701  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  750



>ref|XP_007207214.1| hypothetical protein PRUPE_ppa001874mg [Prunus persica]
 gb|EMJ08413.1| hypothetical protein PRUPE_ppa001874mg [Prunus persica]
Length=750

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  641  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  700

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  701  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  750



>ref|XP_006378020.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
 gb|ERP55817.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
Length=750

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GM+EDSI
Sbjct  641  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMHEDSI  700

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM EACDSRN+DVLQKEFPL
Sbjct  701  RYYVRALAMNPKADNAWQYLRISLSCASRNDMFEACDSRNIDVLQKEFPL  750



>ref|XP_011000400.1| PREDICTED: peroxisome biogenesis protein 5 [Populus euphratica]
Length=749

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GM+EDSI
Sbjct  640  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMHEDSI  699

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM EACDSRN+DVLQKEFPL
Sbjct  700  RYYVRALAMNPKADNAWQYLRISLSCASRNDMFEACDSRNIDVLQKEFPL  749



>emb|CDY67858.1| BnaCnng56710D [Brassica napus]
Length=221

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN G+Y++SI
Sbjct  112  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGLYQESI  171

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLRISLSCASR DMIEAC+SRNLD+LQKEFPL
Sbjct  172  PYYVRALSMNPKADNAWQYLRISLSCASRQDMIEACESRNLDLLQKEFPL  221



>ref|XP_008355814.1| PREDICTED: peroxisome biogenesis protein 5-like, partial [Malus 
domestica]
Length=732

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  623  LKPQDYSLWNKLGATQANSVQSADAIFAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  682

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  683  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  732



>ref|XP_003598272.1| Peroxisomal targeting signal 1 receptor [Medicago truncatula]
Length=384

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  274  LKPQDYSLWNKLGATQANSVQSADAIAAYQQALDLKPNYVRAWANMGISYANQGMYDESI  333

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  334  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  383



>ref|XP_009379080.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=745

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  636  LKPQDYSLWNKLGATQANSVQSADAIFAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  695

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  696  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  745



>ref|XP_009379078.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009379079.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=746

 Score =   218 bits (555),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  637  LKPQDYSLWNKLGATQANSVQSADAIFAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  696

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASRNDM+EACDSRNLDVLQKEFPL
Sbjct  697  RYYVRALTMNPKADNGWQYLRISLSCASRNDMLEACDSRNLDVLQKEFPL  746



>ref|XP_004159522.1| PREDICTED: peroxisome biogenesis protein 5-like [Cucumis sativus]
Length=468

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  359  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  418

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +YYVR+L MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  419  KYYVRSLSMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDALQKEFPL  468



>ref|XP_009410316.1| PREDICTED: peroxisome biogenesis protein 5 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGAT+ANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  649  LKPRDYSLWNKLGATRANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  708

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM EACDSRNLD+LQKEFPL
Sbjct  709  RYYVRALAMNPKADNAWQYLRISLSCASRNDMFEACDSRNLDILQKEFPL  758



>ref|XP_007020294.1| Peroxin 5 isoform 4 [Theobroma cacao]
 gb|EOY11819.1| Peroxin 5 isoform 4 [Theobroma cacao]
Length=694

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  585  LQPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  644

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNL++LQKEFPL
Sbjct  645  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLELLQKEFPL  694



>ref|XP_007020291.1| Peroxin 5 isoform 1 [Theobroma cacao]
 gb|EOY11816.1| Peroxin 5 isoform 1 [Theobroma cacao]
Length=735

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  626  LQPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  685

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNL++LQKEFPL
Sbjct  686  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLELLQKEFPL  735



>ref|XP_011461534.1| PREDICTED: peroxisome biogenesis protein 5 [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  640  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  699

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSCASR+DM+EACDSRNLD+LQKEFPL
Sbjct  700  RYYVRALTMNPKADNGWQYLRISLSCASRSDMLEACDSRNLDILQKEFPL  749



>ref|XP_010263067.1| PREDICTED: peroxisome biogenesis protein 5 [Nelumbo nucifera]
Length=758

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  649  LKPRDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  708

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM++ACDSRNLD LQKEFPL
Sbjct  709  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLQACDSRNLDALQKEFPL  758



>gb|KJB63150.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63161.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=740

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYE+SI
Sbjct  631  LKPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEESI  690

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSC SRNDM+EACDSRNL++LQKEFPL
Sbjct  691  RYYVRALAMNPKADNAWQYLRISLSCVSRNDMVEACDSRNLEILQKEFPL  740



>gb|KJB63159.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=741

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYE+SI
Sbjct  632  LKPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEESI  691

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSC SRNDM+EACDSRNL++LQKEFPL
Sbjct  692  RYYVRALAMNPKADNAWQYLRISLSCVSRNDMVEACDSRNLEILQKEFPL  741



>gb|KDP29519.1| hypothetical protein JCGZ_19232 [Jatropha curcas]
Length=749

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYE SI
Sbjct  640  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEQSI  699

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRN+D LQKEFPL
Sbjct  700  RYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNIDFLQKEFPL  749



>ref|XP_010913243.1| PREDICTED: peroxisome biogenesis protein 5-like [Elaeis guineensis]
Length=759

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+S+
Sbjct  650  LKPRDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESL  709

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSC SRNDM EACDSRNLDVLQKEFPL
Sbjct  710  RYYVRALSMNPKADNVWQYLRISLSCVSRNDMFEACDSRNLDVLQKEFPL  759



>ref|XP_008806178.1| PREDICTED: peroxisome biogenesis protein 5-like [Phoenix dactylifera]
Length=757

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+S+
Sbjct  648  LKPRDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESL  707

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADN WQYLRISLSC SRNDM EACDSRNLDVLQKEFPL
Sbjct  708  RYYVRALSMNPKADNVWQYLRISLSCVSRNDMFEACDSRNLDVLQKEFPL  757



>ref|XP_002299082.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
 gb|EEE83887.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
Length=752

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  643  LKPQDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  702

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLS ASRNDM+EACDSRNLD LQKEFPL
Sbjct  703  RYYVRALAMNPKADNAWQYLRISLSFASRNDMLEACDSRNLDALQKEFPL  752



>gb|AAC97489.1| peroxisomal targeting signal-1 receptor [Citrullus lanatus subsp. 
vulgaris]
Length=647

 Score =   213 bits (541),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  538  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  597

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +YYVR+L MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  598  KYYVRSLSMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDALQKEFPL  647



>ref|XP_010676141.1| PREDICTED: peroxisome biogenesis protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=741

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSA+AI AYQQALDLKPNYVRAWANMGISYAN GMYE+SI
Sbjct  632  LKPHDYSLWNKLGATQANSVQSAEAIEAYQQALDLKPNYVRAWANMGISYANQGMYEESI  691

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCASRNDM EACDS NLDVLQKEFPL
Sbjct  692  RYYVRALSMNPKADNAWQYLRISLSCASRNDMFEACDSHNLDVLQKEFPL  741



>ref|XP_006474746.1| PREDICTED: peroxisome biogenesis protein 5-like [Citrus sinensis]
Length=744

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN GMYE+S+
Sbjct  635  LKPQDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYEESV  694

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLS ASRNDM+EACDSRNLDVLQKEFPL
Sbjct  695  RYYVRALAMNPKADNAWQYLRISLSSASRNDMLEACDSRNLDVLQKEFPL  744



>ref|XP_006452789.1| hypothetical protein CICLE_v10007566mg [Citrus clementina]
 gb|ESR66029.1| hypothetical protein CICLE_v10007566mg [Citrus clementina]
Length=744

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN GMYE+S+
Sbjct  635  LKPQDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYEESV  694

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLS ASRNDM+EACDSRNLDVLQKEFPL
Sbjct  695  RYYVRALAMNPKADNAWQYLRISLSSASRNDMLEACDSRNLDVLQKEFPL  744



>gb|KGN55958.1| hypothetical protein Csa_3G039290 [Cucumis sativus]
Length=743

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  634  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  693

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +YYVR+L MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  694  KYYVRSLSMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDALQKEFPL  743



>ref|XP_008448966.1| PREDICTED: peroxisome biogenesis protein 5 [Cucumis melo]
Length=743

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  634  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  693

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +YYVR+L MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  694  KYYVRSLSMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDALQKEFPL  743



>ref|XP_004147973.1| PREDICTED: peroxisome biogenesis protein 5-like [Cucumis sativus]
Length=748

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  639  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  698

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +YYVR+L MNPKADNAWQYLRISLSCASRNDM+EACDSRNLD LQKEFPL
Sbjct  699  KYYVRSLSMNPKADNAWQYLRISLSCASRNDMLEACDSRNLDALQKEFPL  748



>ref|XP_004499675.1| PREDICTED: peroxisome biogenesis protein 5-like [Cicer arietinum]
Length=745

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI+AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  635  LKPQDYSLWNKLGATQANSVQSADAIMAYQQALDLKPNYVRAWANMGISYANQGMYDESI  694

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM EACDSRNLD+LQKEFPL
Sbjct  695  RYYVRALAMNPKAENAWQYLRISLSCASRNDMFEACDSRNLDLLQKEFPL  744



>gb|KHN20585.1| Peroxisome biogenesis protein 5 [Glycine soja]
Length=736

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI+AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  626  LKPQDYSLWNKLGATQANSVQSADAIMAYQQALDLKPNYVRAWANMGISYANQGMYDESI  685

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  686  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  735



>ref|XP_006578359.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X4 [Glycine 
max]
Length=595

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI+AYQQALDLKPNYVRAWANMGISYAN GMY++S+
Sbjct  485  LKPQDYSLWNKLGATQANSVQSADAIMAYQQALDLKPNYVRAWANMGISYANQGMYDESV  544

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  545  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  594



>gb|KHN44770.1| Peroxisome biogenesis protein 5 [Glycine soja]
Length=738

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI+AYQQALDLKPNYVRAWANMGISYAN GMY++S+
Sbjct  628  LKPQDYSLWNKLGATQANSVQSADAIMAYQQALDLKPNYVRAWANMGISYANQGMYDESV  687

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  688  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  737



>ref|XP_003523862.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Glycine 
max]
 ref|XP_006578357.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Glycine 
max]
 ref|XP_006578358.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X3 [Glycine 
max]
Length=738

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI+AYQQALDLKPNYVRAWANMGISYAN GMY++S+
Sbjct  628  LKPQDYSLWNKLGATQANSVQSADAIMAYQQALDLKPNYVRAWANMGISYANQGMYDESV  687

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  688  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  737



>gb|AES68523.2| peroxisomal targeting signal 1 receptor [Medicago truncatula]
Length=744

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  634  LKPQDYSLWNKLGATQANSVQSADAIAAYQQALDLKPNYVRAWANMGISYANQGMYDESI  693

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACDSRNLD+LQKEFPL
Sbjct  694  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDSRNLDLLQKEFPL  743



>ref|XP_007020292.1| Peroxin 5 isoform 2 [Theobroma cacao]
 gb|EOY11817.1| Peroxin 5 isoform 2 [Theobroma cacao]
Length=736

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 106/111 (95%), Gaps = 1/111 (1%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQ-ALDLKPNYVRAWANMGISYANXGMYEDS  511
            L+P DYSLWNKLGATQANS QSADAILAYQQ ALDLKPNYVRAWANMGISYAN GMYEDS
Sbjct  626  LQPNDYSLWNKLGATQANSVQSADAILAYQQQALDLKPNYVRAWANMGISYANQGMYEDS  685

Query  510  IRYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            IRYYVRAL MNPKADNAWQYLRISLSCASRNDM+EACDSRNL++LQKEFPL
Sbjct  686  IRYYVRALAMNPKADNAWQYLRISLSCASRNDMLEACDSRNLELLQKEFPL  736



>ref|XP_010928166.1| PREDICTED: peroxisome biogenesis protein 5-like [Elaeis guineensis]
Length=757

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YE+SI
Sbjct  648  LKPHDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEESI  707

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPK DNAWQYLRISLS ASRNDM EACD+RNLDVLQKEFPL
Sbjct  708  RYYVRALSMNPKGDNAWQYLRISLSSASRNDMFEACDARNLDVLQKEFPL  757



>ref|XP_007148691.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
 ref|XP_007148692.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
 gb|ESW20685.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
 gb|ESW20686.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
Length=733

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAI+AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  623  LKPQDYSLWNKLGATQANSIQSADAIMAYQQALDLKPNYVRAWANMGISYANQGMYDESI  682

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKA+NAWQYLRISLSCASRNDM+EACD RNLD+LQKEFPL
Sbjct  683  RYYVRALAMNPKAENAWQYLRISLSCASRNDMLEACDRRNLDLLQKEFPL  732



>gb|EPS66664.1| peroxisomal targeting signal 1 receptor [Genlisea aurea]
Length=742

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGAT+ANS +SADAI AYQ ALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  633  LKPRDYSLWNKLGATKANSIRSADAIYAYQHALDLKPNYVRAWANMGISYANQGMYEDSI  692

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLSCA+R+DMIEACD RNLD LQKEFPL
Sbjct  693  RYYVRALAMNPKADNAWQYLRISLSCATRDDMIEACDVRNLDALQKEFPL  742



>gb|AAX11256.1| peroxisomal targeting signal 1 receptor short form [Oryza sativa 
Japonica Group]
Length=679

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  570  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  629

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  630  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  679



>dbj|BAD08811.1| putative peroxisomal targeting signal 1 receptor [Oryza sativa 
Japonica Group]
Length=679

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  570  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  629

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  630  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  679



>ref|XP_006659548.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Oryza 
brachyantha]
Length=679

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  570  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  629

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  630  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  679



>ref|XP_006659547.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Oryza 
brachyantha]
Length=736

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  627  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  687  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  736



>gb|AAX11255.1| peroxisomal targeting signal 1 receptor long form [Oryza sativa 
Japonica Group]
Length=736

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  627  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  687  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  736



>ref|NP_001062153.1| Os08g0500100 [Oryza sativa Japonica Group]
 dbj|BAD08812.1| putative peroxisomal targeting signal 1 receptor [Oryza sativa 
Japonica Group]
 dbj|BAF24067.1| Os08g0500100 [Oryza sativa Japonica Group]
 dbj|BAG89368.1| unnamed protein product [Oryza sativa Japonica Group]
Length=736

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  627  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  687  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  736



>gb|EEC83824.1| hypothetical protein OsI_29764 [Oryza sativa Indica Group]
 gb|EEE68947.1| hypothetical protein OsJ_27829 [Oryza sativa Japonica Group]
Length=750

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  641  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  700

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACDSRNLDVLQKEFPL
Sbjct  701  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDSRNLDVLQKEFPL  750



>ref|XP_010061377.1| PREDICTED: peroxisome biogenesis protein 5 [Eucalyptus grandis]
 gb|KCW68312.1| hypothetical protein EUGRSUZ_F01979 [Eucalyptus grandis]
Length=729

 Score =   208 bits (530),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  620  LKPNDYSLWNKLGATQANSVQSADAILAYQKALDLKPNYVRAWANMGISYANQGLYEDSI  679

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLRISLS ASR+DM+ ACDSRNLDVLQKEFPL
Sbjct  680  RYYVRALSMNPKADNAWQYLRISLSSASRHDMLNACDSRNLDVLQKEFPL  729



>ref|XP_009120148.1| PREDICTED: LOW QUALITY PROTEIN: peroxisome biogenesis protein 
5-like [Brassica rapa]
Length=726

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN G+Y++SI
Sbjct  617  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGLYQESI  676

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLRISLSCASR DMIEAC+SRNLD+LQKEFPL
Sbjct  677  PYYVRALSMNPKADNAWQYLRISLSCASRQDMIEACESRNLDLLQKEFPL  726



>ref|XP_008666997.1| PREDICTED: uncharacterized protein LOC100191477 isoform X2 [Zea 
mays]
Length=679

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  570  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  629

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  630  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  679



>gb|AAC62012.1| peroxisomal targeting signal type 1 receptor [Arabidopsis thaliana]
Length=728

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  619  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  678

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR DMIEAC+SRNLD+LQKEFPL
Sbjct  679  PYYVRALAMNPKADNAWQYLRLSLSCASRQDMIEACESRNLDLLQKEFPL  728



>ref|XP_003574713.1| PREDICTED: peroxisome biogenesis protein 5 [Brachypodium distachyon]
Length=737

 Score =   206 bits (525),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADA+LAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  628  LKPHDYSLWNKLGATQANSIQSADAVLAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  687

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISL  ASR+DM  ACDSRNLDVLQKEFPL
Sbjct  688  RYYVRAVSMNPKADNAWQYLRISLGNASRSDMTAACDSRNLDVLQKEFPL  737



>ref|XP_002445936.1| hypothetical protein SORBIDRAFT_07g028340 [Sorghum bicolor]
 gb|EES15431.1| hypothetical protein SORBIDRAFT_07g028340 [Sorghum bicolor]
Length=734

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  625  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  684

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  685  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  734



>tpg|DAA47839.1| TPA: hypothetical protein ZEAMMB73_779817 [Zea mays]
Length=736

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  627  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  687  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  736



>ref|NP_200440.1| peroxisome biogenesis protein 5 [Arabidopsis thaliana]
 sp|Q9FMA3.1|PEX5_ARATH RecName: Full=Peroxisome biogenesis protein 5; AltName: Full=Peroxin-5; 
Short=AtPEX5; AltName: Full=Peroxisomal targeting 
signal type 1 receptor; AltName: Full=Pex5p [Arabidopsis thaliana]
 dbj|BAB11256.1| peroxisomal targeting signal type 1 receptor [Arabidopsis thaliana]
 gb|AAL07148.1| putative peroxisomal targeting signal type 1 receptor protein 
[Arabidopsis thaliana]
 gb|AAM20313.1| putative peroxisomal targeting signal type 1 receptor protein 
[Arabidopsis thaliana]
 gb|AED96745.1| peroxin 5 [Arabidopsis thaliana]
Length=728

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  619  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  678

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR DMIEAC+SRNLD+LQKEFPL
Sbjct  679  PYYVRALAMNPKADNAWQYLRLSLSCASRQDMIEACESRNLDLLQKEFPL  728



>ref|XP_008666974.1| PREDICTED: uncharacterized protein LOC100191477 isoform X1 [Zea 
mays]
Length=734

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  625  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  684

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  685  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  734



>ref|NP_001130381.1| uncharacterized protein LOC100191477 [Zea mays]
 gb|ACF78574.1| unknown [Zea mays]
Length=736

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  627  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  686

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  687  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  736



>ref|XP_004973819.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Setaria 
italica]
Length=677

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  568  LKPQDYSLWNKLGATQANSIQSADAILAYQKALDLKPNYVRAWANMGISYANQGLYEDSI  627

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  628  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  677



>ref|XP_010450900.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Camelina 
sativa]
Length=728

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  619  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  678

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  679  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  728



>ref|XP_004973818.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Setaria 
italica]
Length=734

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  625  LKPQDYSLWNKLGATQANSIQSADAILAYQKALDLKPNYVRAWANMGISYANQGLYEDSI  684

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISLS ASR DMI ACD+RNLD LQKEFPL
Sbjct  685  RYYVRAVAMNPKADNAWQYLRISLSNASRADMIAACDARNLDALQKEFPL  734



>ref|XP_010483103.1| PREDICTED: peroxisome biogenesis protein 5 [Camelina sativa]
Length=728

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  619  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  678

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  679  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  728



>ref|XP_008679528.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X3 [Zea 
mays]
Length=678

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  569  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  628

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISL  ASR DMI ACD+RNLD LQKEFPL
Sbjct  629  RYYVRAVTMNPKADNAWQYLRISLGNASRADMIAACDARNLDALQKEFPL  678



>gb|AFW65172.1| hypothetical protein ZEAMMB73_964933 [Zea mays]
Length=720

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  611  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  670

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISL  ASR DMI ACD+RNLD LQKEFPL
Sbjct  671  RYYVRAVTMNPKADNAWQYLRISLGNASRADMIAACDARNLDALQKEFPL  720



>ref|XP_002864444.1| hypothetical protein ARALYDRAFT_495719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40703.1| hypothetical protein ARALYDRAFT_495719 [Arabidopsis lyrata subsp. 
lyrata]
Length=726

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  617  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  676

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  677  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  726



>ref|XP_010443280.1| PREDICTED: peroxisome biogenesis protein 5-like [Camelina sativa]
Length=729

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  620  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  679

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  680  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  729



>ref|XP_008679527.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Zea 
mays]
Length=713

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  604  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  663

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISL  ASR DMI ACD+RNLD LQKEFPL
Sbjct  664  RYYVRAVTMNPKADNAWQYLRISLGNASRADMIAACDARNLDALQKEFPL  713



>ref|XP_006401353.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
 gb|ESQ42806.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
Length=727

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  618  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  677

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  678  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  727



>ref|XP_006401352.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
 gb|ESQ42805.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
Length=725

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  616  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  675

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  676  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  725



>ref|XP_008679526.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Zea 
mays]
Length=735

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/110 (89%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  626  LKPQDYSLWNKLGATQANSIQSADAILAYQQALDLKPNYVRAWANMGISYANQGLYEDSI  685

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRA+ MNPKADNAWQYLRISL  ASR DMI ACD+RNLD LQKEFPL
Sbjct  686  RYYVRAVTMNPKADNAWQYLRISLGNASRADMIAACDARNLDALQKEFPL  735



>emb|CDY36789.1| BnaA03g10970D [Brassica napus]
Length=755

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  646  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  705

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR+D+IEAC++RNLD+LQKEFPL
Sbjct  706  PYYVRALAMNPKADNAWQYLRLSLSCASRHDLIEACEARNLDLLQKEFPL  755



>ref|XP_009132316.1| PREDICTED: peroxisome biogenesis protein 5-like [Brassica rapa]
Length=730

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  621  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  680

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR+D+IEAC++RNLD+LQKEFPL
Sbjct  681  PYYVRALAMNPKADNAWQYLRLSLSCASRHDLIEACEARNLDLLQKEFPL  730



>emb|CDY11941.1| BnaC03g13670D [Brassica napus]
Length=730

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  621  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  680

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR+D+IEAC++RNLD+LQKEFPL
Sbjct  681  PYYVRALAMNPKADNAWQYLRLSLSCASRHDLIEACEARNLDLLQKEFPL  730



>ref|XP_010539370.1| PREDICTED: peroxisome biogenesis protein 5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  598  LKPNDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYKESI  657

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYL+ISLSCASR DM++AC+SRNLD+LQKEFPL
Sbjct  658  PYYVRALAMNPKADNAWQYLKISLSCASRQDMLQACESRNLDLLQKEFPL  707



>gb|ABB92565.1| peroxisomal import receptor PTS1 [Brassica napus]
Length=731

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  622  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  681

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR+D+IEAC++RNLD+LQKEFPL
Sbjct  682  PYYVRALAMNPKADNAWQYLRLSLSCASRHDLIEACEARNLDLLQKEFPL  731



>ref|XP_010539369.1| PREDICTED: peroxisome biogenesis protein 5 isoform X1 [Tarenaya 
hassleriana]
Length=729

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  620  LKPNDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYKESI  679

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYL+ISLSCASR DM++AC+SRNLD+LQKEFPL
Sbjct  680  PYYVRALAMNPKADNAWQYLKISLSCASRQDMLQACESRNLDLLQKEFPL  729



>emb|CDY49390.1| BnaC09g53570D [Brassica napus]
Length=697

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYS WNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN G+Y++SI
Sbjct  588  LKPNDYSFWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGLYKESI  647

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLRISLSCA R DMIEAC+SRNLD+LQKEFPL
Sbjct  648  PYYVRALSMNPKADNAWQYLRISLSCAPRQDMIEACESRNLDLLQKEFPL  697



>gb|KFK27205.1| hypothetical protein AALP_AA8G349500 [Arabis alpina]
Length=728

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  619  LKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  678

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSC SR D++EAC+SRNLD+LQKEFPL
Sbjct  679  PYYVRALAMNPKADNAWQYLRLSLSCVSRQDLLEACESRNLDLLQKEFPL  728



>ref|XP_006857544.1| hypothetical protein AMTR_s00061p00043210 [Amborella trichopoda]
 gb|ERN19011.1| hypothetical protein AMTR_s00061p00043210 [Amborella trichopoda]
Length=729

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAI AYQQALDLKPNYVRAWANMGIS+AN G+Y+ SI
Sbjct  620  LKPHDYSLWNKLGATQANSVQSADAIYAYQQALDLKPNYVRAWANMGISFANQGLYDKSI  679

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKA+NAWQYLRISL CASR DM+ ACD+RNLD LQKEFPL
Sbjct  680  SYYVRALSMNPKAENAWQYLRISLGCASRYDMLNACDTRNLDALQKEFPL  729



>gb|EMT18446.1| Peroxisomal targeting signal 1 receptor [Aegilops tauschii]
Length=790

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 104/151 (69%), Gaps = 41/151 (27%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYAN--------  532
            LKP+DYSLWNKLGATQANS QSADA+LAYQQALDLKPNYVRAWANMGISYAN        
Sbjct  640  LKPQDYSLWNKLGATQANSIQSADAVLAYQQALDLKPNYVRAWANMGISYANQGFVFGAE  699

Query  531  ---------------------------------XGMYEDSIRYYVRALGMNPKADNAWQY  451
                                              G+YEDSIRYYVRA+ MNPKADNAWQY
Sbjct  700  HRQVGPVEGVGAGVEASMAMIAEAYEVRGMAMVEGLYEDSIRYYVRAVSMNPKADNAWQY  759

Query  450  LRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            LRISL  ASR+DMI ACDSRNLDVLQKEFPL
Sbjct  760  LRISLGNASRSDMIAACDSRNLDVLQKEFPL  790



>ref|XP_010450908.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Camelina 
sativa]
Length=694

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            + P D  +   LGATQANS QSADAI AYQQALDLKPNYVRAWANMGISYAN GMY++SI
Sbjct  585  MHPEDADVHIVLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESI  644

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL MNPKADNAWQYLR+SLSCASR D+IEAC+SRNLD+LQKEFPL
Sbjct  645  PYYVRALAMNPKADNAWQYLRLSLSCASRQDLIEACESRNLDLLQKEFPL  694



>ref|XP_002980203.1| hypothetical protein SELMODRAFT_444455 [Selaginella moellendorffii]
 gb|EFJ18463.1| hypothetical protein SELMODRAFT_444455 [Selaginella moellendorffii]
Length=724

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS +S+DAI AYQ+AL+LKPNYVRAW+NMGI YAN   Y++SI
Sbjct  616  LKPRDYSLWNKLGATQANSARSSDAIYAYQEALNLKPNYVRAWSNMGIGYANQAQYQESI  675

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLR+SLS A+R D+++ACD R+L+ LQ EFPL
Sbjct  676  RYYVRALCMNPKADNAWQYLRMSLS-ATRTDLLDACDKRDLETLQAEFPL  724



>ref|XP_001772418.1| predicted protein [Physcomitrella patens]
 gb|EDQ62700.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYA--NXGMYED  514
            LKPRDYSLWNKLGATQANS +SA+AI AYQ+ALDLKPNYVRAW+NMGI+    N G+YE+
Sbjct  457  LKPRDYSLWNKLGATQANSSRSAEAIYAYQEALDLKPNYVRAWSNMGIALRKNNKGLYEE  516

Query  513  SIRYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            SIRYYVRAL MNPKADNAWQYLRISLS ASRND+++A + ++L  L KEFPL
Sbjct  517  SIRYYVRALEMNPKADNAWQYLRISLSIASRNDLLDAVERKDLSALAKEFPL  568



>ref|XP_002963119.1| hypothetical protein SELMODRAFT_78782 [Selaginella moellendorffii]
 gb|EFJ36582.1| hypothetical protein SELMODRAFT_78782 [Selaginella moellendorffii]
Length=742

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKPRDYSLWNKLGATQANS +S+DAI AYQ+AL+LKPNYVRAW+NMGI YAN   Y++SI
Sbjct  632  LKPRDYSLWNKLGATQANSARSSDAIYAYQEALNLKPNYVRAWSNMGIGYANQAQYQESI  691

Query  507  RYYVRALGMNPKADNAWQYLRISLS-CASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL MNPKADNAWQYLR+SL   A+R D+++ACD R+L+ LQ EFPL
Sbjct  692  RYYVRALCMNPKADNAWQYLRMSLRFVATRTDLLDACDKRDLETLQAEFPL  742



>emb|CDY66435.1| BnaC02g12360D [Brassica napus]
Length=116

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 2/97 (2%)
 Frame = -2

Query  642  QANSXQSADAILAYQQALDLKPNYVRAWANMGISYANX--GMYEDSIRYYVRALGMNPKA  469
            QANS QSADAI AYQQALDLKPNYVRA ANMGISYAN   GMY++SI YYVRAL MNPKA
Sbjct  20   QANSVQSADAISAYQQALDLKPNYVRALANMGISYANQDRGMYKESIPYYVRALAMNPKA  79

Query  468  DNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            DNAWQYLR+SLSCASR ++I+AC++RNLDVLQKEFPL
Sbjct  80   DNAWQYLRLSLSCASRQNLIQACEARNLDVLQKEFPL  116



>gb|KDO73933.1| hypothetical protein CISIN_1g024618mg [Citrus sinensis]
Length=265

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP+DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN GMYE+S+
Sbjct  169  LKPQDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYEESV  228

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASR  421
            RYYVRAL MNPKADNAWQYLRISL  A R
Sbjct  229  RYYVRALAMNPKADNAWQYLRISLRYAGR  257



>ref|XP_003056940.1| peroxisomal protein importer family [Micromonas pusilla CCMP1545]
 gb|EEH58585.1| peroxisomal protein importer family [Micromonas pusilla CCMP1545]
Length=707

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            + P DYSLWNKLGATQANS +SADA+ AYQ+ALDLKPNYVRAW NMGI YAN G YE+S+
Sbjct  598  VAPSDYSLWNKLGATQANSARSADAMSAYQRALDLKPNYVRAWCNMGIGYANQGKYEESV  657

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +YYVRAL MNP A++AW YLRISL C  R +++EA D ++L+VLQ+EFPL
Sbjct  658  KYYVRALSMNPNAESAWGYLRISLGCCGRIELMEAVDRKDLEVLQREFPL  707



>ref|XP_007020293.1| Peroxin 5 isoform 3 [Theobroma cacao]
 gb|EOY11818.1| Peroxin 5 isoform 3 [Theobroma cacao]
Length=735

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 94/114 (82%), Gaps = 8/114 (7%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  626  LQPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  685

Query  507  RYY-VRALGMNPKADNAWQYLRI---SLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYY +  L + P       Y+ +   S SCASRNDM+EACDSRNL++LQKEFPL
Sbjct  686  RYYTIYGLIIMPTT----TYISLFPSSCSCASRNDMLEACDSRNLELLQKEFPL  735



>ref|XP_007020296.1| Peroxin 5 isoform 6 [Theobroma cacao]
 gb|EOY11821.1| Peroxin 5 isoform 6 [Theobroma cacao]
Length=669

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/84 (94%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN GMYEDSI
Sbjct  585  LQPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYANQGMYEDSI  644

Query  507  RYYVRALGMNPKADNAWQYLRISL  436
            RYYVRAL MNPKADNAWQYLRISL
Sbjct  645  RYYVRALAMNPKADNAWQYLRISL  668



>ref|XP_002502498.1| peroxisomal protein importer family [Micromonas sp. RCC299]
 gb|ACO63756.1| peroxisomal protein importer family [Micromonas sp. RCC299]
Length=822

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            + P DYS+WNKLGATQANS +SADA+ AYQ+ALDLKPNYVRAW NMGI++AN G Y DS+
Sbjct  713  IAPNDYSMWNKLGATQANSARSADAMAAYQRALDLKPNYVRAWCNMGIAFANQGKYADSV  772

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL +NP+A++AW YLRISL C  R +++EA D ++L++LQ+EFPL
Sbjct  773  AYYVRALSLNPQAESAWGYLRISLGCCGRIELMEAVDRKDLELLQREFPL  822



>gb|KCW68311.1| hypothetical protein EUGRSUZ_F01979 [Eucalyptus grandis]
Length=720

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP DYSLWNKLGATQANS QSADAILAYQ+ALDLKPNYVRAWANMGISYAN G+YEDSI
Sbjct  620  LKPNDYSLWNKLGATQANSVQSADAILAYQKALDLKPNYVRAWANMGISYANQGLYEDSI  679

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRND  415
            RYYVRAL MNPKADNAWQYLRISL  +S  D
Sbjct  680  RYYVRALSMNPKADNAWQYLRISLRRSSPYD  710



>gb|KJB63152.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63162.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=665

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -2

Query  609  LAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRALGMNPKADNAWQYLRISLSC  430
            L Y  ALDLKPNYVRAWANMGISYAN GMYE+SIRYYVRAL MNPKADNAWQYLRISLSC
Sbjct  582  LYYADALDLKPNYVRAWANMGISYANQGMYEESIRYYVRALAMNPKADNAWQYLRISLSC  641

Query  429  ASRNDMIEACDSRNLDVLQKEFPL  358
             SRNDM+EACDSRNL++LQKEFPL
Sbjct  642  VSRNDMVEACDSRNLEILQKEFPL  665



>ref|XP_005645163.1| TPR-like protein, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE20619.1| TPR-like protein, partial [Coccomyxa subellipsoidea C-169]
Length=592

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+PRDYSLWNKLGAT ANS  S +AI AYQ+ALDLKPNY+RAW NMGI+ AN G YE S 
Sbjct  483  LRPRDYSLWNKLGATLANSTHSHEAIAAYQKALDLKPNYMRAWTNMGIAQANVGNYEQSA  542

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            R+YVRALG+NPKA + W YLR SL+CASR D+++     +LD L KE PL
Sbjct  543  RFYVRALGLNPKAASVWGYLRTSLACASRMDLMQHVHESDLDTLTKELPL  592



>gb|KDD74974.1| hypothetical protein H632_c953p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=143

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGAT ANS +S +A+ AY++ALDLKPNY+RAW NMGI +AN G YE S 
Sbjct  32   LRPHDYSLWNKLGATLANSSRSGEALDAYRRALDLKPNYMRAWTNMGIGFANLGEYERSA  91

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             +YVRAL +NP+A + W YLR SL+CA R D++E   + NL  +Q+  PL
Sbjct  92   SFYVRALSLNPRATSVWSYLRTSLTCAGRADLMEHAAAENLPAMQQALPL  141



>ref|XP_003079364.1| putative peroxisomal targeting signal 1 rece (ISS) [Ostreococcus 
tauri]
Length=607

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P D+SLWNK+GAT+AN  +S+DAI AY++ALD+KPNYVRAW+NMGI+YAN G Y +S+
Sbjct  497  LRPDDHSLWNKVGATRANGAESSDAIGAYRRALDIKPNYVRAWSNMGIAYANQGRYAESL  556

Query  507  RYYVRALGMNPKADNA-WQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL +NP  ++A W Y++ISL C+ R D++  CD+R++  L +EFPL
Sbjct  557  PYYVRALSLNPSPESANWGYVQISLGCSGRLDLMPRCDARDIGALAREFPL  607



>ref|XP_005849526.1| hypothetical protein CHLNCDRAFT_21245 [Chlorella variabilis]
 gb|EFN57424.1| hypothetical protein CHLNCDRAFT_21245 [Chlorella variabilis]
Length=503

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P+DYSLWNKLGAT ANS +S++AI AYQ+ALDLKPNY+RAW NMGIS AN   Y+ S 
Sbjct  393  LRPQDYSLWNKLGATLANSSRSSEAISAYQKALDLKPNYMRAWTNMGISLANCADYDGSA  452

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL +N KA   W YLR SL+CA R D++ A D+ +L  LQ+  PL
Sbjct  453  RYYVRALALNSKAGAVWGYLRTSLTCAERADLLPAVDAHDLPALQQALPL  502



>emb|CEF97993.1| Tetratricopeptide repeat [Ostreococcus tauri]
Length=703

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P D+SLWNK+GAT+AN  +S+DAI AY++ALD+KPNYVRAW+NMGI+YAN G Y +S+
Sbjct  593  LRPDDHSLWNKVGATRANGAESSDAIGAYRRALDIKPNYVRAWSNMGIAYANQGRYAESL  652

Query  507  RYYVRALGMNPKADNA-WQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YYVRAL +NP  ++A W Y++ISL C+ R D++  CD+R++  L +EFPL
Sbjct  653  PYYVRALSLNPSPESANWGYVQISLGCSGRLDLMPRCDARDIGALAREFPL  703



>ref|XP_001418009.1| peroxisomal targeting signal 1 receptor [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO96302.1| peroxisomal targeting signal 1 receptor [Ostreococcus lucimarinus 
CCE9901]
Length=712

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P D+SLWNK+GATQAN  +SADA+ AY++AL +KPNYVRAW+NMGISYAN G Y +S+
Sbjct  602  LRPDDHSLWNKIGATQANGAESADAVGAYRRALTIKPNYVRAWSNMGISYANQGRYAESM  661

Query  507  RYYVRALGMNPKADN-AWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YY+RAL MNP  ++  W Y+RISL C  R D++E  D  ++  L++EFPL
Sbjct  662  PYYIRALSMNPNPESPTWGYVRISLGCTGRLDLLEHVDKHDIGALRREFPL  712



>ref|XP_002945667.1| hypothetical protein VOLCADRAFT_120154 [Volvox carteri f. nagariensis]
 gb|EFJ52662.1| hypothetical protein VOLCADRAFT_120154 [Volvox carteri f. nagariensis]
Length=851

 Score =   145 bits (365),  Expect = 8e-36, Method: Composition-based stats.
 Identities = 65/110 (59%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGAT AN+ +S +A+ AYQ+ALDLKPNY+RAW NM IS+AN G Y+ S 
Sbjct  742  LRPSDYSLWNKLGATLANNGRSGEALAAYQKALDLKPNYMRAWTNMAISFANLGDYDRSA  801

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             +YVRALG+N  A++ W Y+R+ L+C+ R D++EA +S++L VLQ+ FPL
Sbjct  802  AFYVRALGLNASAEHVWNYMRVVLTCSGRIDLLEAVESKDLAVLQEAFPL  851



>ref|XP_007514089.1| TPR repeat-containing protein [Bathycoccus prasinos]
 emb|CCO15526.1| TPR repeat-containing protein [Bathycoccus prasinos]
Length=732

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L P+D+ L NK+GAT+AN+ +S++AI +Y+ ALDLKPNY RAW NMGI +AN G YE S+
Sbjct  620  LNPQDHRLHNKIGATKANAAKSSEAISSYRSALDLKPNYTRAWTNMGIGFANQGRYEASV  679

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             YY+RAL +NP A+NAW YLRISL C  R D++   D +N+  L +EFP+
Sbjct  680  AYYLRALELNPNAENAWGYLRISLGCTGRIDLMPLVDEKNVRALAREFPV  729



>ref|XP_001690276.1| peroxisomal targeting signal 1 receptor [Chlamydomonas reinhardtii]
 gb|EDP10014.1| peroxisomal targeting signal 1 receptor [Chlamydomonas reinhardtii]
Length=846

 Score =   140 bits (352),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 65/110 (59%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGAT AN+ +S +A+ AYQ+ALDLKPNY+RAW NMGISYAN G+Y  S 
Sbjct  736  LRPGDYSLWNKLGATLANNGRSGEALAAYQKALDLKPNYMRAWTNMGISYANLGVYNRSA  795

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             +YVRALG+N  A++ W YLR SL+CA + +++ A D+++L  LQ   PL
Sbjct  796  AFYVRALGLNAAAEHVWGYLRTSLACAGKLELMGAVDAKDLTQLQAALPL  845



>ref|XP_011395784.1| Peroxisome biogenesis protein 5 [Auxenochlorella protothecoides]
 gb|KFM22918.1| Peroxisome biogenesis protein 5 [Auxenochlorella protothecoides]
Length=565

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P+DYSLWNKLGAT ANS QS DA+ AY++AL+LKPNY+RAW NMGISY+N   Y+ S 
Sbjct  456  LRPQDYSLWNKLGATLANSSQSRDAVPAYRKALELKPNYMRAWTNMGISYSNLADYDASA  515

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            RYYVRAL +N +A   W YLR +L C  R D++    + ++  L  E PL
Sbjct  516  RYYVRALSLNSRAAAVWSYLRTALMCGGRTDLLPVAQAEDIQRLSAELPL  565



>gb|KIZ06207.1| peroxin-5 [Monoraphidium neglectum]
Length=827

 Score =   127 bits (318),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 67/110 (61%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L P DYSLWNKLGAT AN   S +AI AYQ+ALDLKPNY+RAW NMG++YAN G Y  S 
Sbjct  718  LAPGDYSLWNKLGATLANHSHSGEAISAYQRALDLKPNYMRAWTNMGVAYANVGDYTRSA  777

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             +Y RAL +NP AD+ W YLR SL+CA + DM+ A D R+L  LQ   PL
Sbjct  778  AFYARALSLNPGADHVWGYLRTSLACAGQTDMLAAADRRDLAALQAGLPL  827



>gb|EWM20982.1| peroxisomal targeting signal 1 receptor, partial [Nannochloropsis 
gaditana]
Length=236

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P DYSLWNKLGAT ANS +S +A+ AY +ALDLKP Y R W N+GIS+AN G YE++ R
Sbjct  128  RPSDYSLWNKLGATLANSQRSDEALPAYHRALDLKPKYARGWLNLGISHANLGRYEEAAR  187

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             Y+RAL +NP+A + W YLR++ +   R D+++    ++  + + EF
Sbjct  188  CYLRALRLNPEAGHMWGYLRVTFTSMERFDLVQLAGQQDPSLFEAEF  234



>ref|XP_005708204.1| peroxisomal targeting signal type 1 (PTS1) receptor PEX5-like 
protein [Galdieria sulphuraria]
 gb|EME31684.1| peroxisomal targeting signal type 1 (PTS1) receptor PEX5-like 
protein [Galdieria sulphuraria]
Length=688

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P D+ LWNKLGAT ANS QS +A+ AY++A+DLKP+YVRAW N+G SYAN G+YE + 
Sbjct  553  LQPNDHRLWNKLGATLANSYQSREALSAYRRAVDLKPSYVRAWVNVGTSYANQGIYEQAC  612

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL*IQKMWHASN  328
            RYY++AL MNP+ ++ W YLR SL    +ND++   D  +  VL +     +   W +S 
Sbjct  613  RYYLKALQMNPRINHVWNYLRTSLIAMGKNDLLVLTDQYDPQVLVQAMDADLSAAWRSST  672

Query  327  T  325
            +
Sbjct  673  S  673



>ref|XP_009841352.1| hypothetical protein H257_15069 [Aphanomyces astaci]
 gb|ETV69099.1| hypothetical protein H257_15069 [Aphanomyces astaci]
Length=613

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P +YSLWNKLGAT ANS +S +AI +Y +AL++KP Y R W N+GIS+AN G YED+   
Sbjct  503  PEEYSLWNKLGATLANSSRSNEAIPSYHRALEIKPKYARGWLNLGISHANLGQYEDAAHC  562

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            Y++AL  N +AD+ W YLRI+ +C  R D+++  D+++++  + EF L
Sbjct  563  YLQALQQNDQADHIWSYLRIAFTCMERFDLVKLTDTKDVEAFRSEFQL  610



>ref|XP_009521756.1| hypothetical protein PHYSODRAFT_556029 [Phytophthora sojae]
 gb|EGZ26468.1| hypothetical protein PHYSODRAFT_556029 [Phytophthora sojae]
Length=673

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNK+GAT ANS +S++AI AY +AL+LKP Y R W N+GIS+AN G YE++ +
Sbjct  562  RPDEYALWNKIGATLANSARSSEAIPAYHRALELKPRYARGWLNLGISHANLGNYEEATK  621

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++  D+R++   ++EF L
Sbjct  622  CYLQALSLNNRADHIWSYLRICFTCMERFDLVKVADTRDIAHFREEFKL  670



>gb|ETK76697.1| hypothetical protein L915_16963 [Phytophthora parasitica]
 gb|ETL30130.1| hypothetical protein L916_16863 [Phytophthora parasitica]
 gb|ETP06289.1| hypothetical protein F441_17310 [Phytophthora parasitica CJ01A1]
Length=672

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNK+GAT ANS +S++AI AY +AL+LKP Y R W N+GIS+AN G YE++ +
Sbjct  561  RPDEYALWNKIGATLANSARSSEAIPAYHRALELKPRYARGWLNLGISHANLGNYEEATK  620

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++  D++++   ++EF L
Sbjct  621  CYLQALSLNNRADHIWSYLRICFTCMERFDLVKIADTKDIARFREEFKL  669



>ref|XP_008895910.1| hypothetical protein PPTG_03877 [Phytophthora parasitica INRA-310]
 gb|ETM36577.1| hypothetical protein L914_16778 [Phytophthora parasitica]
 gb|ETN18209.1| hypothetical protein PPTG_03877 [Phytophthora parasitica INRA-310]
 gb|ETO65187.1| hypothetical protein F444_17480 [Phytophthora parasitica P1976]
 gb|ETP34368.1| hypothetical protein F442_17293 [Phytophthora parasitica P10297]
Length=672

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNK+GAT ANS +S++AI AY +AL+LKP Y R W N+GIS+AN G YE++ +
Sbjct  561  RPDEYALWNKIGATLANSARSSEAIPAYHRALELKPRYARGWLNLGISHANLGNYEEATK  620

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++  D++++   ++EF L
Sbjct  621  CYLQALSLNNRADHIWSYLRICFTCMERFDLVKIADTKDIARFREEFKL  669



>gb|ETI36422.1| hypothetical protein F443_17442 [Phytophthora parasitica P1569]
 gb|ETI36423.1| hypothetical protein, variant [Phytophthora parasitica P1569]
Length=672

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNK+GAT ANS +S++AI AY +AL+LKP Y R W N+GIS+AN G YE++ +
Sbjct  561  RPDEYALWNKIGATLANSARSSEAIPAYHRALELKPRYARGWLNLGISHANLGNYEEATK  620

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++  D++++   ++EF L
Sbjct  621  CYLQALSLNNRADHIWSYLRICFTCMERFDLVKIADTKDIARFREEFKL  669



>gb|KDO20672.1| hypothetical protein SPRG_13424 [Saprolegnia parasitica CBS 223.65]
Length=605

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNKLGAT ANS +S++AI  Y +AL++KP Y R W N+GIS+AN G YE++ +
Sbjct  494  RPDEYALWNKLGATLANSSRSSEAIPTYHRALEIKPKYARGWLNLGISHANLGQYEEAAK  553

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL  N +A++ W YLRI+ +C  R D+++  D +++   Q EFP+
Sbjct  554  CYLQALHQNNQAEHIWSYLRIAFTCLERFDLVKMTDMKDVMSFQHEFPI  602



>emb|CCA20458.1| peroxisomal targeting signal 1 receptor putative [Albugo laibachii 
Nc14]
Length=621

 Score =   121 bits (304),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P ++SLWNKLGAT ANS  SA+AI AY +AL+LKP Y R W N+GIS+AN G Y+ +  
Sbjct  510  RPNEHSLWNKLGATLANSSHSAEAIPAYLRALELKPRYARGWQNLGISHANLGNYKSAAN  569

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLR+  +C  R D+++A +SR+L   + EF +
Sbjct  570  CYLQALSLNDQADHIWSYLRVCFTCMERFDLVQATESRDLQQFRDEFKI  618



>gb|ETL83352.1| hypothetical protein L917_16701 [Phytophthora parasitica]
Length=672

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNK+GAT ANS +S++AI AY +AL+LKP Y R W N+GIS+AN G YE++ +
Sbjct  561  RPDEYALWNKIGATLANSARSSEAIPAYHRALELKPRYARGWLNLGISHANLGNYEEATK  620

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++  D++++   ++EF L
Sbjct  621  CYLQALSLNNRADHIWSYLRICFTCMERFDLVKIADTKDIARFREEFKL  669



>ref|XP_002900734.1| peroxisomal targeting signal 1 receptor, putative [Phytophthora 
infestans T30-4]
 gb|EEY59541.1| peroxisomal targeting signal 1 receptor, putative [Phytophthora 
infestans T30-4]
Length=667

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNK+GAT ANS +S++AI AY +AL+LKP Y R W N+GIS+AN G YE++ +
Sbjct  556  QPDEYALWNKIGATLANSARSSEAIPAYHRALELKPRYARGWLNLGISHANLGNYEEATK  615

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++  D++++   ++EF L
Sbjct  616  CYLQALSLNNRADHIWSYLRICFTCMERFDLVKIADTKDIARFREEFKL  664



>emb|CCI42503.1| unnamed protein product [Albugo candida]
Length=482

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P ++SLWNKLGAT ANS  S +AI AY +AL++KP Y R W N+GIS+AN G Y+ +  
Sbjct  371  RPDEHSLWNKLGATLANSSHSTEAIPAYLRALEIKPRYARGWQNLGISHANLGNYKSAAN  430

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +N +AD+ W YLRI  +C  R D+++A +SR+L   + EF +
Sbjct  431  CYLQALSLNEQADHIWSYLRICFTCMERLDLVQATESRDLRQFRDEFKI  479



>ref|XP_008609900.1| hypothetical protein SDRG_05933 [Saprolegnia diclina VS20]
 gb|EQC36479.1| hypothetical protein SDRG_05933 [Saprolegnia diclina VS20]
Length=607

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 79/109 (72%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P +Y+LWNKLGAT ANS +S++AI  Y +AL++KP Y R W N+GIS+AN G YE++ +
Sbjct  496  RPDEYALWNKLGATLANSSRSSEAIPTYHRALEIKPKYARGWLNLGISHANLGQYEEAAK  555

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL  N +A++ W YLRI+ +C  R D+++  D +++   + EFP+
Sbjct  556  CYLQALHQNNQAEHIWSYLRIAFTCLERFDLVKMTDMKDVLSFRNEFPI  604



>ref|XP_002177392.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51855.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=575

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P DY LWNKLGAT AN  QS +A+ AY +AL LKP Y RAW NM IS++N   Y+++ R
Sbjct  463  RPDDYQLWNKLGATLANGNQSQEALPAYHKALQLKPKYARAWLNMAISHSNLQNYDEAAR  522

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             Y++ L +NP A + W YLRI+LSC+ R D+I+   S+NL+  +  F
Sbjct  523  CYLQTLSLNPAAIHCWSYLRIALSCSERWDLIQHAASQNLEAFKDLF  569



>ref|XP_008874240.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETV96994.1| hypothetical protein, variant [Aphanomyces invadans]
Length=603

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P ++SLWNKLGAT ANS +S +AI  Y +AL +KP Y R W N+GIS+AN G YED+  
Sbjct  492  RPDEHSLWNKLGATLANSSRSNEAIPTYYRALQIKPKYARGWLNLGISHANLGQYEDAAH  551

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL  N +AD+ W YLRI+ +C  R D+++  D +++   + EF L
Sbjct  552  CYLQALQQNDQADHIWSYLRIAFTCMERFDLVKLTDIKDVGAFRSEFNL  600



>ref|XP_008874239.1| hypothetical protein H310_09842 [Aphanomyces invadans]
 gb|ETV96993.1| hypothetical protein H310_09842 [Aphanomyces invadans]
Length=609

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P ++SLWNKLGAT ANS +S +AI  Y +AL +KP Y R W N+GIS+AN G YED+  
Sbjct  498  RPDEHSLWNKLGATLANSSRSNEAIPTYYRALQIKPKYARGWLNLGISHANLGQYEDAAH  557

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL  N +AD+ W YLRI+ +C  R D+++  D +++   + EF L
Sbjct  558  CYLQALQQNDQADHIWSYLRIAFTCMERFDLVKLTDIKDVGAFRSEFNL  606



>ref|WP_028830491.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=253

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 0/104 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P DYSLWNKLGATQAN  ++ +A+ +Y +A++LKP Y RAW NMGIS AN   Y++++R 
Sbjct  147  PGDYSLWNKLGATQANGNRNEEALPSYLRAIELKPKYARAWLNMGISNANMQNYKEALRG  206

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQK  370
            Y +AL +N  A + W Y+RI+  C  R DMI+  D++NL    +
Sbjct  207  YAKALELNNNATHVWSYIRIACVCMERFDMIQHVDAKNLSAFNQ  250



>ref|XP_005826999.1| hypothetical protein GUITHDRAFT_114013 [Guillardia theta CCMP2712]
 gb|EKX40019.1| hypothetical protein GUITHDRAFT_114013 [Guillardia theta CCMP2712]
Length=410

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 70/105 (67%), Gaps = 0/105 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            + P+DYSLWNKLGAT AN  +S +A+ AY QAL +KPNYVRA AN+GI+Y+N  MYE+  
Sbjct  301  INPQDYSLWNKLGATLANFSKSDEAVDAYIQALSIKPNYVRALANLGIAYSNQEMYEEGA  360

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQ  373
              Y++AL +NP A + W  LR       R+D+   CD+ N +  +
Sbjct  361  SCYLKALSINPGASHIWSSLRSVFHFMDRSDLAARCDTENAEAFR  405



>ref|XP_005536540.1| similar to peroxisomal targeting signal type 1 receptor PEX5 
[Cyanidioschyzon merolae strain 10D]
 dbj|BAM80504.1| similar to peroxisomal targeting signal type 1 receptor PEX5 
[Cyanidioschyzon merolae strain 10D]
Length=654

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 72/105 (69%), Gaps = 0/105 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DY LWN+LGAT AN  +S +A+ AY+ A+D +PN+VRAW N+G SYAN G Y  +I
Sbjct  540  LRPDDYRLWNRLGATLANHFRSMEALRAYRSAIDRRPNFVRAWVNVGTSYANQGSYPQAI  599

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQ  373
            RYY++AL  NP+A + W YLR +    +R D++   +  N D L+
Sbjct  600  RYYIQALQRNPRALHIWSYLRTAAIAMNRLDILAMAEDMNQDNLE  644



>gb|ETO35826.1| hypothetical protein RFI_01236 [Reticulomyxa filosa]
Length=215

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P D +LWNKLGATQAN  +   A+ AY +AL LKPNYVRA +N+GIS+AN  M+ ++ +
Sbjct  107  RPNDPTLWNKLGATQANGQKCHLAVSAYSKALQLKPNYVRALSNLGISFANQKMHREACQ  166

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             Y+ +L +NP A++ W YL +SL    R D++     R++   +K F
Sbjct  167  SYLASLRLNPHAESIWDYLTMSLLYLGREDLMLLTQQRDVSQFEKHF  213



>gb|EMS62055.1| Peroxisome biogenesis protein 5 [Triticum urartu]
Length=962

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  528  GMYEDSIRYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            G+YEDSIRYYVRA+ MNPKADNAWQYLRISL  ASR+DMI ACDSRNLDVLQKEFPL
Sbjct  906  GLYEDSIRYYVRAVSMNPKADNAWQYLRISLGNASRSDMIAACDSRNLDVLQKEFPL  962


 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYAN  532
            LKP+DYSLWNKLGATQANS QSADA+LAYQQALDLKPNYVRAWANMGISYAN
Sbjct  639  LKPQDYSLWNKLGATQANSIQSADAVLAYQQALDLKPNYVRAWANMGISYAN  690



>ref|XP_002294361.1| peroxisomal targeting signal receptor [Thalassiosira pseudonana 
CCMP1335]
 gb|EED88195.1| peroxisomal targeting signal receptor, partial [Thalassiosira 
pseudonana CCMP1335]
Length=286

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY L NKLGAT ANS +S +A+ +Y++AL LKP Y R W NM IS++N   Y ++ 
Sbjct  179  VRPDDYQLRNKLGATLANSNRSEEALPSYRKALSLKPKYARGWLNMAISHSNLHNYSEAA  238

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            R Y++ L +NP+A + W YLRI+L+C  R D++    S+NL    + F
Sbjct  239  RCYLQTLSLNPEAKHVWSYLRIALTCDERWDLLPLAASQNLSQFHEFF  286



>emb|CDJ61272.1| TPR domain-containing protein, putative [Eimeria maxima]
Length=805

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 50/103 (49%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            SLWNK+GAT ANS +SA A+LAY+Q L LKPNY RAWAN+G++ AN G  E+++++Y+ A
Sbjct  669  SLWNKIGATLANSGRSAAALLAYKQTLKLKPNYPRAWANLGVAKANLGEMEEALQHYLVA  728

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP+A + W Y+R +L   +R + I   ++R+L+  +K  P
Sbjct  729  LELNPEATHLWHYVRSALISLNRYNWIVYTENRDLEGFRKVLP  771



>emb|CBJ48315.1| conserved unknown protein [Ectocarpus siliculosus]
Length=739

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P D+SLWNKLGAT ANS QS  A+ AY++A+  KP Y RAW NMGIS AN   YE++  
Sbjct  624  RPNDHSLWNKLGATLANSRQSEAALPAYRRAIASKPGYARAWLNMGISQANLNRYEEASS  683

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
             Y++AL +NP+A + W YLRI  S   R D+++     +  + + +F L
Sbjct  684  CYLQALRLNPEAKHIWSYLRIVFSSMERFDLVQKAGKEDAGLFEDDFDL  732



>ref|XP_006819303.1| PREDICTED: peroxisomal targeting signal 1 receptor-like [Saccoglossus 
kowalevskii]
Length=618

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 11/125 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D  LWNKLGAT ANS +S +AI AY +AL L+P ++R+  N+GIS  N G + ++I
Sbjct  494  VRPEDSLLWNKLGATLANSNKSEEAITAYHRALQLRPGFIRSRYNLGISCINLGTHNEAI  553

Query  507  RYYVRALGM-----NPK------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M      P+      +DN W  LR+++S   RND+  A D RNLD+L KEF 
Sbjct  554  EHFLVALNMQNAVGGPRGDQSVMSDNIWSTLRMAISLLGRNDLYNAADQRNLDMLNKEFN  613

Query  360  L*IQK  346
            +  +K
Sbjct  614  IKTEK  618



>gb|ETO25949.1| hypothetical protein RFI_11184 [Reticulomyxa filosa]
Length=421

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P D SLWNKLGATQAN  +   AI AY +AL+LKPNYVRA +N+GIS+AN   + ++ +
Sbjct  222  RPSDPSLWNKLGATQANGQKCQIAIHAYSKALELKPNYVRALSNLGISFANQKKHTEACQ  281

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRN  388
             Y+ +L +NP A   W +LR SL    RND++E  + R+
Sbjct  282  SYLASLKLNPHAMPIWDHLRTSLMHLGRNDLMELIEKRD  320



>gb|EJK69679.1| hypothetical protein THAOC_09039 [Thalassiosira oceanica]
Length=163

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DY L NKLGAT AN  +S +A+ +Y+ AL LKP Y R W NM I ++N   Y ++ 
Sbjct  51   LRPGDYQLRNKLGATLANGNRSEEALPSYRAALGLKPKYARGWLNMAIGHSNLRNYSEAA  110

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            R Y++ L +NP+A + W YLR++L+C  R D++    S++L   ++ F
Sbjct  111  RCYLQTLSLNPEARHVWSYLRVALTCDERWDLLPLAASQDLGGFREHF  158



>ref|XP_004027388.1| hypothetical protein IMG5_184450 [Ichthyophthirius multifiliis]
 gb|EGR28043.1| hypothetical protein IMG5_184450 [Ichthyophthirius multifiliis]
Length=640

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            + P +YSLWNKLGAT A   ++ +AI AY +AL+LKPNYVR W N+GI++A  G Y ++ 
Sbjct  490  IDPNNYSLWNKLGATLAQLGRADEAIEAYHRALELKPNYVRVWVNLGIAHAYKGDYVEAA  549

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            R Y+ AL  NP+A + W YL+    C  R D++    + N    Q EF +
Sbjct  550  RLYLNALSFNPEAKHLWSYLQTCFMCMQRFDLVGKIQNNNPLEFQDEFEI  599



>ref|XP_007020297.1| Peroxin 5 isoform 7 [Theobroma cacao]
 gb|EOY11822.1| Peroxin 5 isoform 7 [Theobroma cacao]
Length=642

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYAN  532
            L+P DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN
Sbjct  585  LQPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYAN  636



>ref|XP_007020295.1| Peroxin 5 isoform 5 [Theobroma cacao]
 gb|EOY11820.1| Peroxin 5 isoform 5 [Theobroma cacao]
Length=683

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/52 (94%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYAN  532
            L+P DYSLWNKLGATQANS QSADAILAYQQALDLKPNYVRAWANMGISYAN
Sbjct  626  LQPNDYSLWNKLGATQANSVQSADAILAYQQALDLKPNYVRAWANMGISYAN  677



>gb|KFG55362.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
FOU]
Length=172

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  34   TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  93

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  94   LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  136



>ref|XP_005769450.1| hypothetical protein EMIHUDRAFT_459060 [Emiliania huxleyi CCMP1516]
 gb|EOD17021.1| hypothetical protein EMIHUDRAFT_459060 [Emiliania huxleyi CCMP1516]
Length=474

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGATQAN+   A A+  Y +AL+L+PNYVRA  N+GISY N      + 
Sbjct  365  LRPEDYSLWNKLGATQANAMSCAAAVPCYVRALELRPNYVRALTNLGISYGNLSEQRAAA  424

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            + Y++AL +N  A + W YL +  S   R D ++   + +L  L  EF
Sbjct  425  QCYLKALSLNQDAAHVWTYLTMVFSAMGRTDYVQMATATDLAALCAEF  472



>emb|CDI79114.1| TPR domain-containing protein, putative [Eimeria acervulina]
Length=2541

 Score =   102 bits (254),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 46/103 (45%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            S+WNK+GAT ANS +SA A+ AY+Q L LKPNY RAWAN+G++ AN G  E+++++Y+ A
Sbjct  669  SIWNKIGATLANSGRSAAALPAYRQTLKLKPNYPRAWANLGVAKANLGQMEEALQHYIVA  728

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP+A + W Y+R +L   ++   I   ++R+++ L++  P
Sbjct  729  LELNPEATHLWHYIRSALISLNQYSWIVYAENRDMEGLRRVVP  771



>ref|XP_005784618.1| hypothetical protein EMIHUDRAFT_449555 [Emiliania huxleyi CCMP1516]
 gb|EOD32189.1| hypothetical protein EMIHUDRAFT_449555 [Emiliania huxleyi CCMP1516]
Length=474

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P DYSLWNKLGATQAN+   A A+  Y +AL+L+PNYVRA  N+GISY N      + 
Sbjct  365  LRPEDYSLWNKLGATQANAMSCAAAVPCYVRALELRPNYVRALTNLGISYGNLSEQRAAA  424

Query  507  RYYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            + Y++AL +N  A + W YL +  S   R D ++   + +L  L  EF
Sbjct  425  QCYLKALSLNQDAAHVWTYLTMVFSAMGRTDYVQMAAATDLAALCAEF  472



>ref|XP_002113707.1| hypothetical protein TRIADDRAFT_57411 [Trichoplax adhaerens]
 gb|EDV24181.1| hypothetical protein TRIADDRAFT_57411 [Trichoplax adhaerens]
Length=645

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 7/114 (6%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            KP D  LWNKLGAT ANS +S +AILAY  AL L P YVRA  N+GIS  N   Y ++I 
Sbjct  528  KPDDPELWNKLGATLANSNKSEEAILAYHTALSLSPGYVRARYNLGISCINLKAYREAIE  587

Query  504  YYVRALGM-------NPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            +++ AL M          +DN W  LR++LS   ++D+ +A D R+L  L KEF
Sbjct  588  HFLIALNMQRNDYGSTTMSDNIWSTLRMALSYNGKSDLFQAVDERDLATLNKEF  641



>gb|KFW07374.1| Peroxisomal targeting signal 1 receptor, partial [Eurypyga helias]
Length=174

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  54   VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  113

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  114  EHFLEALHMQQKSRGPRGQHGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  173

Query  360  L  358
            L
Sbjct  174  L  174



>emb|CDW84760.1| peroxisome biogenesis protein 5-like [Stylonychia lemnae]
Length=574

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P D++LWNK GA  AN+     AI  Y QA+DL+PNYVR  AN+G+++ N   + +SI Y
Sbjct  445  PTDHTLWNKYGAALANNHDIERAIKTYHQAIDLRPNYVRTLANIGLAHRNQARFPESIPY  504

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            ++ AL +NP+A + W+Y+R S    +R D++E  +  + ++ + EFPL
Sbjct  505  FLNALLLNPQAKHIWRYIRSSFLQMNRLDLVEKMNFNDPNLFRDEFPL  552



>gb|KFH17395.1| tetratricopeptide repeat-containing protein, partial [Toxoplasma 
gondii MAS]
Length=264

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  126  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  185

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  186  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  228



>emb|CDJ63704.1| TPR domain-containing protein, putative [Eimeria necatrix]
Length=795

 Score =   100 bits (248),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            SLWNK+GAT ANS +SA A++AY Q L LKPNY RAW NMG++ AN G  E+++++Y+ A
Sbjct  663  SLWNKIGATLANSGRSAAALVAYSQTLKLKPNYPRAWTNMGVAKANLGQMEEALQHYLVA  722

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W +     + A R D I   D+R+L+ L+K  P
Sbjct  723  LELNPAATHLWVW----AAAADRYDWISLTDNRDLEGLRKVVP  761



>ref|XP_010668551.1| PREDICTED: peroxisome biogenesis protein 5-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=220

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            LKP D  LWNKLGATQAN   S  A+ +Y++AL+LKPNYVRA AN+GIS+AN GM+ ++ 
Sbjct  142  LKPDDPRLWNKLGATQANGSHSLAAVQSYKRALELKPNYVRALANLGISFANQGMHTEAA  201

Query  507  RYYVRALGMNPKADNAWQY  451
            + Y+  L  NP A++ W Y
Sbjct  202  QAYLATLARNPNAEHVWSY  220



>gb|AAI11710.1| Pex5 protein [Rattus norvegicus]
Length=197

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  75   VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  134

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  135  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLPALLTMFG  194

Query  360  L  358
            L
Sbjct  195  L  195



>ref|XP_010152181.1| PREDICTED: peroxisomal targeting signal 1 receptor-like, partial 
[Eurypyga helias]
Length=283

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  161  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  220

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  221  EHFLEALHMQQKSRGPRGQHGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  280

Query  360  L  358
            L
Sbjct  281  L  281



>ref|XP_001013887.2| TPR Domain containing protein [Tetrahymena thermophila]
Length=704

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P +YSLWNKLGAT A   ++ +AI AY +AL+LKPNYVR W N+GI++A    ++++ R 
Sbjct  559  PSNYSLWNKLGATLAQLGKADEAINAYYRALELKPNYVRVWVNLGIAHAYKQDFDEAARL  618

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            Y+ AL  NP+A + W YL+    C  R D++      N  +   EF +
Sbjct  619  YLNALSFNPEAKHLWSYLQTCFMCLQRFDLVSKISDHNPALFADEFEI  666



>gb|KFQ90424.1| Peroxisomal targeting signal 1 receptor, partial [Phoenicopterus 
ruber ruber]
Length=175

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 75/121 (62%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  54   VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  113

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+ +L  L + F 
Sbjct  114  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADAHDLPTLLQAFG  173

Query  360  L  358
            L
Sbjct  174  L  174



>gb|EAR93642.3| tetratricopeptide repeat protein [Tetrahymena thermophila SB210]
Length=673

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P +YSLWNKLGAT A   ++ +AI AY +AL+LKPNYVR W N+GI++A    ++++ R 
Sbjct  528  PSNYSLWNKLGATLAQLGKADEAINAYYRALELKPNYVRVWVNLGIAHAYKQDFDEAARL  587

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            Y+ AL  NP+A + W YL+    C  R D++      N  +   EF +
Sbjct  588  YLNALSFNPEAKHLWSYLQTCFMCLQRFDLVSKISDHNPALFADEFEI  635



>dbj|GAM24309.1| hypothetical protein SAMD00019534_074840 [Acytostelium subglobosum 
LB1]
Length=640

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P DY LWNKLGAT ANS +S +A+ AY QAL+ KP+YVRA +N+GISY    MY ++ + 
Sbjct  532  PSDYQLWNKLGATLANSNRSQEALGAYFQALEQKPSYVRARSNLGISYLALNMYTEAAQT  591

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            ++ AL ++P+A + W  L++      RND+++  D+R+++   ++F  
Sbjct  592  FLGALSIHPEAVHIWDNLKMVFRLMERNDLVDKADNRDVNDFVQDFKF  639



>dbj|GAM24169.1| hypothetical protein SAMD00019534_073440, partial [Acytostelium 
subglobosum LB1]
Length=494

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P DY LWNKLGAT ANS +S +A+ AY QAL+ KP+YVRA +N+GISY    MY ++ + 
Sbjct  386  PSDYQLWNKLGATLANSNRSQEALGAYFQALEQKPSYVRARSNLGISYLALNMYNEAAQT  445

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            ++ AL ++P+A + W  L++      R+D++E  + R+++   ++F  
Sbjct  446  FLGALSIHPEAVHIWDNLKMVFRLMGRDDLVEKVERRDVNEFAQDFKF  493



>ref|XP_009010553.1| hypothetical protein HELRODRAFT_183274 [Helobdella robusta]
 gb|ESO11331.1| hypothetical protein HELRODRAFT_183274 [Helobdella robusta]
Length=187

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P D  LWNKLGAT AN   S  AI AY QAL+L+P YVR   N+G++  N G Y +++ +
Sbjct  70   PEDSMLWNKLGATLANGQMSEQAITAYHQALNLRPGYVRTRFNLGVACVNLGAYREAVEH  129

Query  501  YVRALGM-----NPK-ADNA---WQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            ++ AL +      PK A N    W  LR++LS     D++++CD  +L  L   F L
Sbjct  130  FLSALTLKDQTKGPKTASNGNIIWSSLRMALSLLGSTDLLDSCDKHDLQFLNAHFKL  186



>gb|KFG63721.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
RUB]
Length=437

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  299  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  358

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  359  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  401



>ref|XP_011431303.1| PREDICTED: peroxisomal targeting signal 1 receptor-like [Crassostrea 
gigas]
 gb|EKC35915.1| Peroxisomal targeting signal 1 receptor [Crassostrea gigas]
Length=354

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 12/120 (10%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            +KP+D  LWNKLGAT AN  +S +A+ AY  AL + P Y+R+  N+GI+  N G++++++
Sbjct  231  VKPQDALLWNKLGATLANGNRSEEAVEAYHHALQISPGYIRSRYNLGIACINLGVHKEAV  290

Query  507  RYYVRALGMNPKAD------------NAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             +++ AL M  K+             N W  LR+++S   R D+ +ACD+++LD L  EF
Sbjct  291  EHFLTALNMQRKSQQGMKDPQVVMSKNIWSTLRMAVSLLGRPDLYDACDNQDLDRLNSEF  350



>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2
Length=305

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  183  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  242

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  243  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  302

Query  360  L  358
            L
Sbjct  303  L  303



>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex 
With The Tpr Domain Of Human Pex5p
 pdb|3R9A|D Chain D, Human Alanine-Glyoxylate Aminotransferase In Complex 
With The Tpr Domain Of Human Pex5p
 pdb|4KXK|B Chain B, Alanine-glyoxylate Aminotransferase Variant K390a/k391a 
In Complex With The Tpr Domain Of Human Pex5p
 pdb|4KXK|D Chain D, Alanine-glyoxylate Aminotransferase Variant K390a/k391a 
In Complex With The Tpr Domain Of Human Pex5p
 pdb|4KYO|B Chain B, Alanine-glyoxylate Aminotransferase Variant K390a In 
Complex With The Tpr Domain Of Human Pex5p
 pdb|4KYO|D Chain D, Alanine-glyoxylate Aminotransferase Variant K390a In 
Complex With The Tpr Domain Of Human Pex5p
Length=328

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  206  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  265

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  266  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  325

Query  360  L  358
            L
Sbjct  326  L  326



>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p
 pdb|2J9Q|B Chain B, A Novel Conformation For The Tpr Domain Of Pex5p
Length=328

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  206  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  265

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  266  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  325

Query  360  L  358
            L
Sbjct  326  L  326



>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor
 pdb|2C0M|B Chain B, Apo Form Of The Tpr Domain Of The Pex5p Receptor
 pdb|2C0M|C Chain C, Apo Form Of The Tpr Domain Of The Pex5p Receptor
 pdb|2C0M|F Chain F, Apo Form Of The Tpr Domain Of The Pex5p Receptor
Length=319

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  197  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  256

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  257  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  316

Query  360  L  358
            L
Sbjct  317  L  317



>gb|KGG51182.1| hypothetical protein DI09_42p250 [Microsporidia sp. UGP3]
 gb|KGG52695.1| hypothetical protein DI09_142p80 [Microsporidia sp. UGP3]
Length=520

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 11/116 (9%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P DY LWN+LGAT AN+ QS  AI  Y++AL LKP+++RA  N+G+S  N G Y+++  Y
Sbjct  388  PSDYLLWNRLGATLANNHQSEKAIAMYEKALSLKPSFIRALHNLGVSCMNVGCYQEAAEY  447

Query  501  YVRAL-------GMNPKADNA----WQYLRISLSCASRNDMIEACDSRNLDVLQKE  367
             +RAL       GM P A N     W+ LR +     R DM   C+SR+LD +  E
Sbjct  448  LIRALKAQYLHPGMPPPAKNISTNLWETLRRTFIFGDRIDMAALCESRSLDQILAE  503



>ref|XP_003287008.1| hypothetical protein DICPUDRAFT_47119 [Dictyostelium purpureum]
 gb|EGC36495.1| hypothetical protein DICPUDRAFT_47119 [Dictyostelium purpureum]
Length=661

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 72/106 (68%), Gaps = 1/106 (1%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P DY LWNKLGAT ANS +S +A+ AY +AL+ KP+YVRA +N+GISY +  M+ ++   
Sbjct  554  PEDYQLWNKLGATLANSNRSQEALGAYFKALEHKPSYVRARSNLGISYLSLNMFNEAAST  613

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            ++ A+ ++P A N W  L++     +R D+++ CD+R+++    EF
Sbjct  614  FLGAIAIHP-AQNIWDNLKMVFRLMNREDLVQKCDTRDVNQFLDEF  658



>ref|XP_006014027.1| PREDICTED: peroxisomal targeting signal 1 receptor-like [Latimeria 
chalumnae]
Length=578

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 74/119 (62%), Gaps = 11/119 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L P ++R+  N+GIS  N G + +++
Sbjct  456  VRPDDYLLWNKLGATLANGNQSEEAVEAYRRALELHPGFIRSRYNLGISCINLGAHREAV  515

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             +++ AL M  K           ++N W  LR++LS   ++DM  A D+R+LD L   F
Sbjct  516  EHFLEALSMQRKSRGPQGERGAMSENIWSTLRMALSMLGQSDMYTAADNRDLDTLLGAF  574



>ref|XP_003883433.1| putative TPR domain-containing protein [Neospora caninum Liverpool]
 emb|CBZ53401.1| putative TPR domain-containing protein [Neospora caninum Liverpool]
Length=911

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -2

Query  678  RDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYY  499
            R  +LWNK+GAT ANS +SA A+LAY+Q + L+PNY RAW N+G++++N G  + ++R+Y
Sbjct  769  RAATLWNKIGATLANSGRSAAALLAYEQTVALRPNYPRAWTNLGVAHSNLGDTDRALRFY  828

Query  498  VRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            + AL +NP A + W Y+R ++    + D +   ++R+L+ L+   P
Sbjct  829  LTALVLNPAASHLWYYVRSAIIALGKFDWLGLAENRDLEGLRALMP  874



>ref|XP_002586247.1| hypothetical protein BRAFLDRAFT_62718 [Branchiostoma floridae]
 gb|EEN42258.1| hypothetical protein BRAFLDRAFT_62718 [Branchiostoma floridae]
Length=564

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 75/121 (62%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D  LWN+LGAT AN  +S +AI AY+ AL L+P +VR+  N+GIS  N G+Y++++
Sbjct  439  VRPEDSLLWNRLGATLANGNRSEEAIQAYRHALQLRPGFVRSRYNLGISCVNLGVYKEAV  498

Query  507  RYYVRAL-----GMNPK------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL     G  PK      ++N W  LR+++S   R ++   CD ++LD L  EF 
Sbjct  499  EHFLTALNMQRAGKGPKGEAALMSENIWSTLRMAISLMGRPELYAHCDRKDLDALNSEFR  558

Query  360  L  358
            L
Sbjct  559  L  559



>ref|XP_006738309.1| PREDICTED: peroxisomal targeting signal 1 receptor-like [Leptonychotes 
weddellii]
Length=349

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  227  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  286

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  287  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLPTLLAMFG  346

Query  360  L  358
            L
Sbjct  347  L  347



>gb|EJY65472.1| hypothetical protein OXYTRI_14373 [Oxytricha trifallax]
 gb|EJY70594.1| hypothetical protein OXYTRI_08544 [Oxytricha trifallax]
Length=644

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P D++LWNK GA  AN+     AI  YQ ALDL+PNYVR  AN+G++  N   +E+S+ Y
Sbjct  514  PTDHTLWNKYGAALANNTDIDQAIQVYQTALDLRPNYVRTLANIGLAMRNRFKFEESVPY  573

Query  501  YVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            ++ AL +NP+A+  W+YLR S    +R D++E  + ++ ++ + ++ L
Sbjct  574  FLNALVLNPQAEQVWRYLRSSFLQMNRPDLVEKANFKDANLYRDQYTL  621



>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region 
Of Human Pex5
 pdb|1FCH|B Chain B, Crystal Structure Of The Pts1 Complexed To The Tpr Region 
Of Human Pex5
Length=368

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  246  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  305

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  306  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  365

Query  360  L  358
            L
Sbjct  366  L  366



>dbj|BAG61481.1| unnamed protein product [Homo sapiens]
Length=368

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  246  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  305

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  306  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  365

Query  360  L  358
            L
Sbjct  366  L  366



>gb|EPY42762.1| peroxin-5 [Angomonas deanei]
Length=371

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L P D +LWNKLGA+ AN  ++  A+ AY  ALD+ P YVRA  N+ I+Y+N   Y  + 
Sbjct  246  LNPNDATLWNKLGASYANGSKTELALDAYTHALDINPGYVRAIYNLAIAYSNLSKYNTAA  305

Query  507  RYYVRAL-----GMNPKAD-------NAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            +Y+VRA+     G NP  +       N W+ LR++L+   R+D+++   +RNL+   KEF
Sbjct  306  KYFVRAIAAQNGGTNPTTEAAEIATNNIWEMLRMTLNLLDRDDLVQLTYNRNLEPFVKEF  365

Query  363  PL  358
             L
Sbjct  366  GL  367



>ref|XP_002610911.1| hypothetical protein BRAFLDRAFT_60314 [Branchiostoma floridae]
 gb|EEN66921.1| hypothetical protein BRAFLDRAFT_60314 [Branchiostoma floridae]
Length=635

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 75/121 (62%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D  LWN+LGAT AN  +S +AI AY+ AL L+P +VR+  N+GIS  N G+Y++++
Sbjct  510  VRPEDSLLWNRLGATLANGNRSEEAIQAYRHALQLRPGFVRSRYNLGISCVNLGVYKEAV  569

Query  507  RYYVRAL-----GMNPK------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL     G  PK      ++N W  LR+++S   R ++   CD ++LD L  EF 
Sbjct  570  EHFLTALNMQRAGKGPKGEAALMSENIWSTLRMAISLMGRPELYAHCDRKDLDALNSEFR  629

Query  360  L  358
            L
Sbjct  630  L  630



>ref|XP_003771284.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform 3 
[Sarcophilus harrisii]
Length=632

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  510  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  569

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  570  EHFLEALNMQQKSRGPRGKGGAMSENIWSTLRMALSMLGQSDVYGAADARDLPTLLRTFG  629

Query  360  L  358
            L
Sbjct  630  L  630



>ref|XP_002368058.1| TPR domain-containing protein [Toxoplasma gondii ME49]
Length=617

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  479  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  538

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  539  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  581



>ref|XP_006127421.1| PREDICTED: peroxisomal targeting signal 1 receptor, partial [Pelodiscus 
sinensis]
Length=611

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 77/121 (64%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  489  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  548

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+ +A D+R+L  L + F 
Sbjct  549  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYQAADTRDLPTLLQAFG  608

Query  360  L  358
            L
Sbjct  609  L  609



>gb|KFG51068.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
p89]
Length=900

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  762  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  821

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  822  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  864



>gb|KFH11152.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
VAND]
Length=899

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  761  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  820

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  821  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  863



>ref|XP_005420741.1| PREDICTED: peroxisomal targeting signal 1 receptor [Geospiza 
fortis]
Length=607

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  485  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  544

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L K F 
Sbjct  545  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLKAFG  604

Query  360  L  358
            L
Sbjct  605  L  605



>ref|XP_003771282.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform 1 
[Sarcophilus harrisii]
Length=640

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  518  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  577

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  578  EHFLEALNMQQKSRGPRGKGGAMSENIWSTLRMALSMLGQSDVYGAADARDLPTLLRTFG  637

Query  360  L  358
            L
Sbjct  638  L  638



>ref|XP_003771283.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform 2 
[Sarcophilus harrisii]
Length=603

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  481  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  540

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  541  EHFLEALNMQQKSRGPRGKGGAMSENIWSTLRMALSMLGQSDVYGAADARDLPTLLRTFG  600

Query  360  L  358
            L
Sbjct  601  L  601



>gb|EPR64293.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
GT1]
 gb|KFG48566.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
Length=899

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  761  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  820

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  821  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  863



>gb|EPT28915.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
ME49]
 gb|ESS35701.1| tetratricopeptide repeat-containing protein [Toxoplasma gondii 
VEG]
Length=900

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  762  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  821

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + D +   ++R+L+ L+   P
Sbjct  822  LVLNPAASHLWYYVRSATISLGKFDWLGLAENRDLEGLRALLP  864



>ref|XP_005486224.1| PREDICTED: peroxisomal targeting signal 1 receptor [Zonotrichia 
albicollis]
Length=653

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  531  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  590

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L K F 
Sbjct  591  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLKAFG  650

Query  360  L  358
            L
Sbjct  651  L  651



>ref|XP_007503751.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X4 
[Monodelphis domestica]
Length=603

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  481  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  540

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  541  EHFLEALNMQQKSRGPRGKGGAMSENIWSTLRMALSMLGQSDVYGAADARDLPTLLRTFG  600

Query  360  L  358
            L
Sbjct  601  L  601



>ref|XP_009975102.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X3 [Tyto alba]
Length=606

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  484  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  543

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L K F 
Sbjct  544  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLKAFG  603

Query  360  L  358
            L
Sbjct  604  L  604



>ref|XP_009018401.1| hypothetical protein HELRODRAFT_80635, partial [Helobdella robusta]
 gb|ESO03253.1| hypothetical protein HELRODRAFT_80635, partial [Helobdella robusta]
Length=287

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 9/117 (8%)
 Frame = -2

Query  681  PRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRY  502
            P D  LWNKLGAT AN   S  AI AY QAL+L+P YVR   N+G++  N G Y +++ +
Sbjct  170  PEDSMLWNKLGATLANGQMSEQAITAYHQALNLRPGYVRTRFNLGVACVNLGAYREAVEH  229

Query  501  YVRALGM-----NPK-ADNA---WQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            ++ AL +      PK A N    W  LR++LS     D++++CD  +L  L   F L
Sbjct  230  FLSALTLKDQTKGPKTASNGNIIWSSLRMALSLLGSTDLLDSCDKHDLQFLNAHFKL  286



>ref|XP_001370656.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X1 
[Monodelphis domestica]
 ref|XP_007503749.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X2 
[Monodelphis domestica]
 ref|XP_007503750.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X3 
[Monodelphis domestica]
Length=640

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  518  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  577

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  578  EHFLEALNMQQKSRGPRGKGGAMSENIWSTLRMALSMLGQSDVYGAADARDLPTLLRTFG  637

Query  360  L  358
            L
Sbjct  638  L  638



>ref|XP_009975101.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X2 [Tyto alba]
Length=642

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  520  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  579

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L K F 
Sbjct  580  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLKAFG  639

Query  360  L  358
            L
Sbjct  640  L  640



>ref|XP_009975100.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X1 [Tyto alba]
 gb|KFV45209.1| Peroxisomal targeting signal 1 receptor [Tyto alba]
Length=645

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  523  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  582

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L K F 
Sbjct  583  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLKAFG  642

Query  360  L  358
            L
Sbjct  643  L  643



>ref|XP_009100897.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
5 [Serinus canaria]
Length=645

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  523  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  582

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L K F 
Sbjct  583  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLKAFG  642

Query  360  L  358
            L
Sbjct  643  L  643



>ref|XP_004692979.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X3 
[Condylura cristata]
Length=632

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  510  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  569

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A DSR+L  L   F 
Sbjct  570  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADSRDLSTLLSMFG  629

Query  360  L  358
            L
Sbjct  630  L  630



>ref|XP_004692977.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X1 
[Condylura cristata]
Length=649

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  527  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  586

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A DSR+L  L   F 
Sbjct  587  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADSRDLSTLLSMFG  646

Query  360  L  358
            L
Sbjct  647  L  647



>ref|XP_004692980.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X4 
[Condylura cristata]
Length=603

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  481  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  540

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A DSR+L  L   F 
Sbjct  541  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADSRDLSTLLSMFG  600

Query  360  L  358
            L
Sbjct  601  L  601



>ref|XP_011431302.1| PREDICTED: peroxisomal targeting signal 1 receptor-like isoform 
X2 [Crassostrea gigas]
Length=578

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 12/120 (10%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            +KP+D  LWNKLGAT AN  +S +A+ AY  AL + P Y+R+  N+GI+  N G++++++
Sbjct  455  VKPQDALLWNKLGATLANGNRSEEAVEAYHHALQISPGYIRSRYNLGIACINLGVHKEAV  514

Query  507  RYYVRALGMNPKAD------------NAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             +++ AL M  K+             N W  LR+++S   R D+ +ACD+++LD L  EF
Sbjct  515  EHFLTALNMQRKSQQGMKDPQVVMSKNIWSTLRMAVSLLGRPDLYDACDNQDLDRLNSEF  574



>ref|XP_011431301.1| PREDICTED: peroxisomal targeting signal 1 receptor-like isoform 
X1 [Crassostrea gigas]
 gb|EKC35916.1| Peroxisomal targeting signal 1 receptor [Crassostrea gigas]
Length=619

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 12/120 (10%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            +KP+D  LWNKLGAT AN  +S +A+ AY  AL + P Y+R+  N+GI+  N G++++++
Sbjct  496  VKPQDALLWNKLGATLANGNRSEEAVEAYHHALQISPGYIRSRYNLGIACINLGVHKEAV  555

Query  507  RYYVRALGMNPKAD------------NAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             +++ AL M  K+             N W  LR+++S   R D+ +ACD+++LD L  EF
Sbjct  556  EHFLTALNMQRKSQQGMKDPQVVMSKNIWSTLRMAVSLLGRPDLYDACDNQDLDRLNSEF  615



>ref|XP_004692978.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X2 
[Condylura cristata]
Length=640

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  518  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  577

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A DSR+L  L   F 
Sbjct  578  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADSRDLSTLLSMFG  637

Query  360  L  358
            L
Sbjct  638  L  638



>ref|XP_007420463.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal targeting signal 
1 receptor [Python bivittatus]
Length=647

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 76/120 (63%), Gaps = 11/120 (9%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P D+ LWNKLGAT AN  +S +A+ AY+QAL+L+P Y+R+  N+GIS  N G + +++ 
Sbjct  526  RPNDHLLWNKLGATLANGNRSEEAVAAYRQALELQPGYIRSRYNLGISCINLGAHREAVE  585

Query  504  YYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFPL  358
            +++ AL M  K           +DN W  LR++LS   ++++ EA D+R+L  L + F +
Sbjct  586  HFLEALQMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSNLYEAADARDLPTLLQAFAI  645



>ref|XP_008885674.1| tetratricopeptide repeat-containing protein [Hammondia hammondi]
 gb|KEP63737.1| tetratricopeptide repeat-containing protein [Hammondia hammondi]
Length=901

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/103 (43%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            +LWNK+GAT ANS +S  A+LAY+Q L L+PNY RAW N+G++++N G  E ++R+Y+ A
Sbjct  763  TLWNKIGATLANSGRSEAALLAYEQTLALRPNYPRAWTNLGVAHSNLGDTERAMRFYLTA  822

Query  489  LGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
            L +NP A + W Y+R +     + + +   +SR+L+ L+   P
Sbjct  823  LVLNPAASHLWYYVRSAAISLGKFEWLGLAESRDLEGLRALLP  865



>gb|ELV09735.1| Calsyntenin-3 [Tupaia chinensis]
Length=1557

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687   LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
             ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  1435  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  1494

Query  507   RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
              +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  1495  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLPTLLTMFG  1554

Query  360   L  358
             L
Sbjct  1555  L  1555



>ref|XP_001498231.1| PREDICTED: peroxisomal targeting signal 1 receptor isoformX3 
[Equus caballus]
 ref|XP_008537361.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X2 [Equus 
przewalskii]
Length=632

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  510  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  569

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR+SLS   ++D   A D+R+L  L   F 
Sbjct  570  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLSLSMLGQSDAYGAADARDLSTLLAMFG  629

Query  360  L  358
            L
Sbjct  630  L  630



>ref|XP_002769981.1| Peroxisomal targeting signal receptor, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER02678.1| Peroxisomal targeting signal receptor, putative [Perkinsus marinus 
ATCC 50983]
Length=553

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L+P D +LWNKLGAT ANS  S  +++AY QAL LKPNY RAW+N+ I++ N   ++D I
Sbjct  463  LRPEDPTLWNKLGATLANSGLSEASLVAYNQALKLKPNYARAWSNLAIAHCNLNQHQDGI  522

Query  507  RYYVRALGMNPKADNAWQYL  448
            R+Y+ AL ++PKA++ W  L
Sbjct  523  RFYLAALKLSPKAEHLWTLL  542



>gb|KFP04959.1| Peroxisomal targeting signal 1 receptor, partial [Calypte anna]
Length=595

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYRAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>ref|XP_004344039.1| tetratricopeptide repeat-containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20636.1| tetratricopeptide repeat-containing protein [Acanthamoeba castellanii 
str. Neff]
Length=779

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P DY+LWNKLGAT ANS  S +A+  Y ++L +KP Y RA AN+GISY N  MY ++  
Sbjct  671  RPNDYALWNKLGATLANSNHSKEALAPYYRSLKIKPTYTRARANLGISYLNMEMYREAAT  730

Query  504  YYVRALGMNPKADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
             ++  L + P A + W  L+   S   R+D++E     ++D  + EF
Sbjct  731  QFLACLAIQPSAKHIWMSLQTVFSRMERDDLLERSLRYDIDAFRDEF  777



>ref|XP_005610958.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X5 
[Equus caballus]
 ref|XP_008537362.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X3 [Equus 
przewalskii]
Length=628

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  506  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  565

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR+SLS   ++D   A D+R+L  L   F 
Sbjct  566  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLSLSMLGQSDAYGAADARDLSTLLAMFG  625

Query  360  L  358
            L
Sbjct  626  L  626



>ref|XP_004052676.1| PREDICTED: peroxisomal targeting signal 1 receptor-like, partial 
[Gorilla gorilla gorilla]
Length=489

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  367  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  426

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  427  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  486

Query  360  L  358
            L
Sbjct  487  L  487



>ref|XP_009897926.1| PREDICTED: peroxisomal biogenesis factor 5 [Picoides pubescens]
 gb|KFV66739.1| Peroxisomal targeting signal 1 receptor [Picoides pubescens]
Length=645

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 75/121 (62%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  523  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  582

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A DS +L  L K F 
Sbjct  583  EHFLEALHMQQKSRGPRGQHGAMSDNIWSTLRMALSMLGQSDLYGAADSHDLPTLLKAFG  642

Query  360  L  358
            L
Sbjct  643  L  643



>ref|XP_005610960.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X7 
[Equus caballus]
 ref|XP_008537364.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X5 [Equus 
przewalskii]
Length=572

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  450  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  509

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR+SLS   ++D   A D+R+L  L   F 
Sbjct  510  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLSLSMLGQSDAYGAADARDLSTLLAMFG  569

Query  360  L  358
            L
Sbjct  570  L  570



>ref|XP_003223806.2| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
5 [Anolis carolinensis]
Length=647

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 74/118 (63%), Gaps = 11/118 (9%)
 Frame = -2

Query  684  KPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIR  505
            +P D+ LWNKLGAT AN  +S +A+ AY+QAL+L+P Y+R+  N+GIS  N G + +++ 
Sbjct  526  RPNDHLLWNKLGATLANGNRSEEAVAAYRQALELQPGYIRSRYNLGISCINLGAHREAVE  585

Query  504  YYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F
Sbjct  586  HFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAF  643



>gb|KFQ17552.1| Peroxisomal targeting signal 1 receptor, partial [Merops nubicus]
Length=595

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>ref|XP_005610957.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X4 
[Equus caballus]
 ref|XP_008537357.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X1 [Equus 
przewalskii]
 ref|XP_008537358.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X1 [Equus 
przewalskii]
 ref|XP_008537359.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X1 [Equus 
przewalskii]
 ref|XP_008537360.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X1 [Equus 
przewalskii]
Length=640

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  518  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  577

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR+SLS   ++D   A D+R+L  L   F 
Sbjct  578  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLSLSMLGQSDAYGAADARDLSTLLAMFG  637

Query  360  L  358
            L
Sbjct  638  L  638



>gb|KFW74119.1| Peroxisomal targeting signal 1 receptor, partial [Manacus vitellinus]
Length=595

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>gb|EPY41380.1| peroxin-5 [Angomonas deanei]
Length=550

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 12/122 (10%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            L P D +LWNKLGA+ AN  ++  A+ AY  ALD+ P YVRA  N+ I+Y+N   Y  + 
Sbjct  425  LNPNDATLWNKLGASYANGSKTELALDAYTHALDINPGYVRAIYNLAIAYSNLSKYSTAA  484

Query  507  RYYVRAL-----GMNPKAD-------NAWQYLRISLSCASRNDMIEACDSRNLDVLQKEF  364
            +Y+VRA+     G NP  +       N W+ LR++L+   R+D+++   +RNL+   KEF
Sbjct  485  KYFVRAIAAQNGGTNPTTEAAEIATNNIWEMLRMTLNLLDRDDLVQLTYNRNLEPFVKEF  544

Query  363  PL  358
             L
Sbjct  545  GL  546



>ref|XP_005610959.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X6 
[Equus caballus]
 ref|XP_008537363.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X4 [Equus 
przewalskii]
Length=603

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  481  VRPDDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  540

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR+SLS   ++D   A D+R+L  L   F 
Sbjct  541  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLSLSMLGQSDAYGAADARDLSTLLAMFG  600

Query  360  L  358
            L
Sbjct  601  L  601



>emb|CDJ44843.1| TPR domain-containing protein, putative [Eimeria tenella]
Length=391

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 61/82 (74%), Gaps = 3/82 (4%)
 Frame = -2

Query  669  SLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSIRYYVRA  490
            SLWNK+GAT ANS +SA A++AY Q L LKPNY RAW N+G++ AN G  E+++++Y+ A
Sbjct  309  SLWNKIGATLANSGRSAAALVAYSQTLKLKPNYPRAWTNLGVAKANLGQMEEALQHYLVA  368

Query  489  LGMNPKADNAWQYLR---ISLS  433
            L +NP A + W Y+R   ISLS
Sbjct  369  LELNPAATHLWYYIRSALISLS  390



>ref|XP_005235427.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal targeting signal 
1 receptor [Falco peregrinus]
Length=647

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  525  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  584

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  585  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  644

Query  360  L  358
            L
Sbjct  645  L  645



>ref|XP_009460105.1| PREDICTED: peroxisomal biogenesis factor 5 [Nipponia nippon]
Length=609

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  487  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  546

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  547  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  606

Query  360  L  358
            L
Sbjct  607  L  607



>ref|XP_010394441.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X3 [Corvus 
cornix cornix]
Length=579

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  457  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  516

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  517  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  576

Query  360  L  358
            L
Sbjct  577  L  577



>ref|XP_008933539.1| PREDICTED: peroxisomal biogenesis factor 5, partial [Merops nubicus]
Length=617

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  495  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  554

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  555  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  614

Query  360  L  358
            L
Sbjct  615  L  615



>ref|XP_009891125.1| PREDICTED: peroxisomal biogenesis factor 5 [Charadrius vociferus]
Length=600

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  478  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  537

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  538  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  597

Query  360  L  358
            L
Sbjct  598  L  598



>gb|EPQ04457.1| Peroxisomal targeting signal 1 receptor [Myotis brandtii]
Length=449

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  327  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  386

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  387  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSALLTMFG  446

Query  360  L  358
            L
Sbjct  447  L  447



>ref|XP_010394440.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X2 [Corvus 
cornix cornix]
Length=587

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  465  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  524

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  525  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  584

Query  360  L  358
            L
Sbjct  585  L  585



>ref|XP_005434403.1| PREDICTED: peroxisomal targeting signal 1 receptor [Falco cherrug]
Length=610

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  488  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  547

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  548  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  607

Query  360  L  358
            L
Sbjct  608  L  608



>ref|XP_004092183.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform 3 
[Nomascus leucogenys]
Length=548

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  426  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  485

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  486  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  545

Query  360  L  358
            L
Sbjct  546  L  546



>gb|KGL87086.1| Peroxisomal targeting signal 1 receptor, partial [Charadrius 
vociferus]
Length=595

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>ref|XP_009705583.1| PREDICTED: peroxisomal biogenesis factor 5, partial [Cariama 
cristata]
 gb|KFP68530.1| Peroxisomal targeting signal 1 receptor, partial [Cariama cristata]
Length=595

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>gb|KFQ90935.1| Peroxisomal targeting signal 1 receptor, partial [Nipponia nippon]
Length=595

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>ref|XP_004909555.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X1 
[Heterocephalus glaber]
 ref|XP_004909556.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X2 
[Heterocephalus glaber]
 ref|XP_004869547.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X1 
[Heterocephalus glaber]
Length=640

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  518  VRPNDYLLWNKLGATLANGSQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  577

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  578  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYSAADARDLSALLAMFG  637

Query  360  L  358
            L
Sbjct  638  L  638



>ref|XP_009982723.1| PREDICTED: peroxisomal biogenesis factor 5, partial [Tauraco 
erythrolophus]
Length=595

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>ref|XP_009423019.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X5 [Pan troglodytes]
Length=615

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  493  VRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  552

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  553  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFG  612

Query  360  L  358
            L
Sbjct  613  L  613



>ref|XP_004909557.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X3 
[Heterocephalus glaber]
 ref|XP_004869548.1| PREDICTED: peroxisomal targeting signal 1 receptor isoform X2 
[Heterocephalus glaber]
Length=603

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  481  VRPNDYLLWNKLGATLANGSQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  540

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  541  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYSAADARDLSALLAMFG  600

Query  360  L  358
            L
Sbjct  601  L  601



>ref|XP_009476807.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X1 [Pelecanus 
crispus]
 gb|KFQ59141.1| Peroxisomal targeting signal 1 receptor [Pelecanus crispus]
Length=645

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  523  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  582

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  583  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  642

Query  360  L  358
            L
Sbjct  643  L  643



>gb|KFR07406.1| Peroxisomal targeting signal 1 receptor, partial [Opisthocomus 
hoazin]
Length=595

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  473  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  532

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  533  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  592

Query  360  L  358
            L
Sbjct  593  L  593



>ref|XP_009476809.1| PREDICTED: peroxisomal biogenesis factor 5 isoform X2 [Pelecanus 
crispus]
Length=606

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  484  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  543

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  544  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  603

Query  360  L  358
            L
Sbjct  604  L  604



>ref|XP_008928851.1| PREDICTED: peroxisomal biogenesis factor 5 [Manacus vitellinus]
Length=674

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  552  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  611

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  612  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  671

Query  360  L  358
            L
Sbjct  672  L  672



>gb|KFV01478.1| Peroxisomal targeting signal 1 receptor, partial [Tauraco erythrolophus]
Length=601

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  479  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  538

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  539  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  598

Query  360  L  358
            L
Sbjct  599  L  599



>gb|EHB18640.1| Peroxisomal targeting signal 1 receptor, partial [Heterocephalus 
glaber]
Length=629

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P DY LWNKLGAT AN  QS +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  507  VRPNDYLLWNKLGATLANGSQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  566

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           ++N W  LR++LS   ++D   A D+R+L  L   F 
Sbjct  567  EHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYSAADARDLSALLAMFG  626

Query  360  L  358
            L
Sbjct  627  L  627



>ref|XP_009930335.1| PREDICTED: peroxisomal biogenesis factor 5 [Opisthocomus hoazin]
Length=653

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  531  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  590

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  591  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  650

Query  360  L  358
            L
Sbjct  651  L  651



>gb|KFZ65987.1| Peroxisomal targeting signal 1 receptor [Podiceps cristatus]
Length=634

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 76/121 (63%), Gaps = 11/121 (9%)
 Frame = -2

Query  687  LKPRDYSLWNKLGATQANSXQSADAILAYQQALDLKPNYVRAWANMGISYANXGMYEDSI  508
            ++P D+ LWNKLGAT AN  +S +A+ AY++AL+L+P Y+R+  N+GIS  N G + +++
Sbjct  512  VRPNDHLLWNKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAV  571

Query  507  RYYVRALGMNPK-----------ADNAWQYLRISLSCASRNDMIEACDSRNLDVLQKEFP  361
             +++ AL M  K           +DN W  LR++LS   ++D+  A D+R+L  L + F 
Sbjct  572  EHFLEALHMQQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADARDLPTLLQAFG  631

Query  360  L  358
            L
Sbjct  632  L  632



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700