BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045H10

Length=917
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP15498.1|  unnamed protein product                                154   2e-40   Coffea canephora [robusta coffee]
ref|XP_009620424.1|  PREDICTED: cyclin-H1-1 isoform X6                  142   2e-36   
ref|XP_009620422.1|  PREDICTED: cyclin-H1-1 isoform X4                  142   3e-36   Nicotiana tomentosiformis
ref|XP_009620418.1|  PREDICTED: cyclin-H1-1 isoform X1                  142   5e-36   
ref|XP_010320161.1|  PREDICTED: cyclin-H1-1-like isoform X2             140   1e-35   Solanum lycopersicum
ref|XP_004237891.1|  PREDICTED: cyclin-H1-1-like isoform X1             141   2e-35   Solanum lycopersicum
ref|XP_009799573.1|  PREDICTED: cyclin-H1-1 isoform X4                  139   3e-35   Nicotiana sylvestris
ref|XP_009799572.1|  PREDICTED: cyclin-H1-1 isoform X3                  139   4e-35   Nicotiana sylvestris
ref|XP_009620420.1|  PREDICTED: cyclin-H1-1 isoform X2                  139   6e-35   Nicotiana tomentosiformis
ref|XP_009799569.1|  PREDICTED: cyclin-H1-1 isoform X1                  139   7e-35   Nicotiana sylvestris
ref|XP_006354003.1|  PREDICTED: cyclin-H1-1-like isoform X1             138   3e-34   Solanum tuberosum [potatoes]
ref|XP_010918004.1|  PREDICTED: cyclin-H1-1 isoform X2                  138   3e-34   Elaeis guineensis
ref|XP_010917999.1|  PREDICTED: cyclin-H1-1 isoform X1                  138   3e-34   Elaeis guineensis
ref|XP_010271136.1|  PREDICTED: cyclin-H1-1 isoform X2                  137   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010271132.1|  PREDICTED: cyclin-H1-1 isoform X1                  137   7e-34   
gb|EYU42757.1|  hypothetical protein MIMGU_mgv1a009980mg                137   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_009799571.1|  PREDICTED: cyclin-H1-1 isoform X2                  136   9e-34   Nicotiana sylvestris
ref|XP_011076677.1|  PREDICTED: cyclin-H1-1                             135   2e-33   Sesamum indicum [beniseed]
ref|XP_006344638.1|  PREDICTED: cyclin-H1-1-like isoform X2             134   5e-33   Solanum tuberosum [potatoes]
ref|XP_002284178.1|  PREDICTED: cyclin-H1-1                             130   2e-31   Vitis vinifera
ref|XP_010108984.1|  hypothetical protein L484_027180                   129   3e-31   
ref|XP_008811991.1|  PREDICTED: cyclin-H1-1 isoform X2                  129   4e-31   Phoenix dactylifera
ref|XP_007030955.1|  Cyclin H,1 isoform 3                               129   4e-31   
ref|XP_007030954.1|  Cyclin H,1 isoform 2                               129   4e-31   
ref|XP_008811990.1|  PREDICTED: cyclin-H1-1 isoform X1                  129   5e-31   Phoenix dactylifera
ref|XP_009418143.1|  PREDICTED: cyclin-H1-1 isoform X3                  124   1e-30   
ref|XP_004230215.1|  PREDICTED: cyclin-H1-1                             128   1e-30   Solanum lycopersicum
ref|XP_007030953.1|  Cyclin-H1-1 isoform 1                              129   2e-30   
gb|KJB45248.1|  hypothetical protein B456_007G298500                    125   2e-30   Gossypium raimondii
ref|XP_009418142.1|  PREDICTED: cyclin-H1-1 isoform X2                  125   3e-30   
gb|EPS69696.1|  hypothetical protein M569_05066                         126   4e-30   Genlisea aurea
gb|KJB45252.1|  hypothetical protein B456_007G298500                    125   6e-30   Gossypium raimondii
gb|KJB45249.1|  hypothetical protein B456_007G298500                    125   1e-29   Gossypium raimondii
gb|KDP23501.1|  hypothetical protein JCGZ_23334                         125   1e-29   Jatropha curcas
gb|KJB45251.1|  hypothetical protein B456_007G298500                    125   1e-29   Gossypium raimondii
gb|KJB45247.1|  hypothetical protein B456_007G298500                    125   2e-29   Gossypium raimondii
gb|KJB45246.1|  hypothetical protein B456_007G298500                    125   2e-29   Gossypium raimondii
ref|XP_006344637.1|  PREDICTED: cyclin-H1-1-like isoform X1             125   2e-29   Solanum tuberosum [potatoes]
gb|KHG11498.1|  Cyclin-H1-1 -like protein                               125   2e-29   Gossypium arboreum [tree cotton]
ref|XP_009418139.1|  PREDICTED: cyclin-H1-1 isoform X1                  125   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN20228.1|  Cyclin-H1-1                                             120   5e-29   Glycine soja [wild soybean]
ref|XP_008359865.1|  PREDICTED: cyclin-H1-1-like                        124   5e-29   Malus domestica [apple tree]
ref|XP_008440228.1|  PREDICTED: cyclin-H1-1 isoform X3                  122   8e-29   
ref|XP_002512403.1|  cyclin h, putative                                 122   8e-29   
ref|XP_004141934.1|  PREDICTED: cyclin-H1-1-like                        123   9e-29   Cucumis sativus [cucumbers]
ref|XP_008440227.1|  PREDICTED: cyclin-H1-1 isoform X2                  121   2e-28   Cucumis melo [Oriental melon]
ref|XP_009376695.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-H1-1        121   2e-28   
ref|XP_006433378.1|  hypothetical protein CICLE_v10001764mg             122   3e-28   Citrus clementina [clementine]
ref|XP_008440225.1|  PREDICTED: cyclin-H1-1 isoform X1                  121   3e-28   Cucumis melo [Oriental melon]
gb|KHN09714.1|  Cyclin-H1-1                                             121   3e-28   Glycine soja [wild soybean]
ref|XP_007205500.1|  hypothetical protein PRUPE_ppa008262mg             121   4e-28   
gb|KJB45250.1|  hypothetical protein B456_007G298500                    121   4e-28   Gossypium raimondii
gb|KHN42891.1|  Cyclin-H1-1                                             117   5e-28   Glycine soja [wild soybean]
ref|XP_008246397.1|  PREDICTED: cyclin-H1-1                             120   6e-28   Prunus mume [ume]
ref|XP_003526926.1|  PREDICTED: cyclin-H1-1 isoformX1                   120   9e-28   Glycine max [soybeans]
ref|XP_009111750.1|  PREDICTED: cyclin-H1-1-like                        120   1e-27   Brassica rapa
gb|AAD02871.1|  CAK associated cyclinH homolog                          119   2e-27   Populus tremula x Populus tremuloides
gb|ACU23520.1|  unknown                                                 119   2e-27   Glycine max [soybeans]
ref|XP_006394954.1|  hypothetical protein EUTSA_v10004554mg             119   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006382505.1|  hypothetical protein POPTR_0005s02780g             118   4e-27   
ref|XP_011036827.1|  PREDICTED: cyclin-H1-1 isoform X1                  118   4e-27   Populus euphratica
ref|XP_006842697.1|  hypothetical protein AMTR_s00147p00079450          119   5e-27   
ref|XP_010546709.1|  PREDICTED: cyclin-H1-1-like isoform X2             118   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_010546708.1|  PREDICTED: cyclin-H1-1-like isoform X1             118   6e-27   Tarenaya hassleriana [spider flower]
ref|XP_011036828.1|  PREDICTED: cyclin-H1-1 isoform X2                  118   6e-27   Populus euphratica
gb|KJB45253.1|  hypothetical protein B456_007G298500                    117   7e-27   Gossypium raimondii
gb|ABK96417.1|  unknown                                                 118   8e-27   Populus trichocarpa x Populus deltoides
ref|XP_003550146.1|  PREDICTED: cyclin-H1-1-like isoformX1              117   9e-27   Glycine max [soybeans]
emb|CDY19728.1|  BnaA09g03810D                                          117   9e-27   Brassica napus [oilseed rape]
ref|XP_010421593.1|  PREDICTED: cyclin-H1-1-like                        117   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDX99977.1|  BnaC09g03240D                                          117   1e-26   
ref|XP_010455108.1|  PREDICTED: cyclin-H1-1-like                        117   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009151194.1|  PREDICTED: cyclin-H1-1-like                        117   2e-26   Brassica rapa
ref|NP_198114.2|  cyclin H;1                                            116   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874361.1|  CYCH_1                                             115   4e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_006433379.1|  hypothetical protein CICLE_v10001764mg             115   5e-26   Citrus clementina [clementine]
gb|AFK42904.1|  unknown                                                 112   5e-26   Lotus japonicus
ref|XP_006288154.1|  hypothetical protein CARUB_v10001393mg             115   6e-26   
ref|XP_010674709.1|  PREDICTED: cyclin-H1-1 isoform X3                  115   7e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO56276.1|  hypothetical protein CISIN_1g038028mg                   115   7e-26   Citrus sinensis [apfelsine]
ref|XP_010674708.1|  PREDICTED: cyclin-H1-1 isoform X2                  115   7e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674706.1|  PREDICTED: cyclin-H1-1 isoform X1                  115   7e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF88227.1|  unknown                                                 110   2e-25   Zea mays [maize]
ref|XP_010546710.1|  PREDICTED: cyclin-H1-1-like isoform X3             114   2e-25   Tarenaya hassleriana [spider flower]
emb|CDY05569.1|  BnaA02g31220D                                          114   2e-25   
gb|KCW58355.1|  hypothetical protein EUGRSUZ_H01039                     110   3e-25   Eucalyptus grandis [rose gum]
ref|XP_006581842.1|  PREDICTED: cyclin-H1-1 isoform X2                  113   4e-25   Glycine max [soybeans]
emb|CDX86148.1|  BnaA06g28650D                                          112   7e-25   
ref|XP_010043075.1|  PREDICTED: cyclin-H1-1-like isoform X2             111   9e-25   Eucalyptus grandis [rose gum]
ref|XP_010043073.1|  PREDICTED: cyclin-H1-1-like isoform X1             111   1e-24   Eucalyptus grandis [rose gum]
gb|ACN31885.1|  unknown                                                 110   2e-24   Zea mays [maize]
ref|NP_001149855.1|  LOC100283483                                       110   2e-24   Zea mays [maize]
ref|XP_009129870.1|  PREDICTED: cyclin-H1-1                             110   2e-24   Brassica rapa
ref|XP_010042910.1|  PREDICTED: cyclin-H1-1-like isoform X2             110   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010042901.1|  PREDICTED: cyclin-H1-1-like isoform X1             110   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010069853.1|  PREDICTED: uncharacterized protein LOC104456...    109   3e-24   
emb|CDI66532.1|  Cyclin-H1-1                                            110   3e-24   Saccharum hybrid cultivar R570
emb|CDI66557.1|  Cyclin-H1-1                                            110   4e-24   Saccharum hybrid cultivar R570
emb|CDI66493.1|  Cyclin-H1-1                                            110   4e-24   Saccharum hybrid cultivar R570
emb|CDI66513.1|  Cyclin-H1-1                                            110   4e-24   Saccharum hybrid cultivar R570
emb|CDY25030.1|  BnaC02g39780D                                          114   4e-24   Brassica napus [oilseed rape]
ref|XP_006651796.1|  PREDICTED: cyclin-H1-1-like                        109   5e-24   Oryza brachyantha
ref|XP_009760267.1|  PREDICTED: cyclin-H1-1-like isoform X2             106   6e-24   Nicotiana sylvestris
ref|XP_002466497.1|  hypothetical protein SORBIDRAFT_01g008760          108   8e-24   
ref|XP_004981844.1|  PREDICTED: cyclin-H1-1-like isoform X1             108   1e-23   Setaria italica
ref|XP_004302415.1|  PREDICTED: cyclin-H1-1                             107   3e-23   Fragaria vesca subsp. vesca
emb|CDI66519.1|  Cyclin-H1-1                                            107   4e-23   Saccharum hybrid cultivar R570
gb|KCW60766.1|  hypothetical protein EUGRSUZ_H03488                     103   5e-23   Eucalyptus grandis [rose gum]
ref|NP_001051203.1|  Os03g0737600                                       106   6e-23   
gb|AAR07076.1|  cyclin H-1                                              106   6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009760266.1|  PREDICTED: cyclin-H1-1-like isoform X1             102   2e-22   Nicotiana sylvestris
ref|XP_004496023.1|  PREDICTED: cyclin-H1-1-like                        106   2e-22   
ref|XP_007219466.1|  hypothetical protein PRUPE_ppa021360mg             100   2e-22   
gb|AES61374.2|  cyclin H, putative                                      103   1e-21   Medicago truncatula
ref|XP_004507893.1|  PREDICTED: cyclin-H1-1-like                        102   2e-21   
gb|AAU93531.1|  cyclin H-1                                              102   2e-21   Zea mays [maize]
ref|XP_010550979.1|  PREDICTED: cyclin-H1-1-like                        101   3e-21   Tarenaya hassleriana [spider flower]
ref|XP_003591123.1|  Cyclin-H1-1                                        103   4e-21   
gb|AAP03415.1|  cyclin H-1                                              100   6e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560004.1|  PREDICTED: cyclin-H1-1 isoform X2                  100   7e-21   
gb|EMT30492.1|  hypothetical protein F775_06942                       99.8    7e-21   
ref|XP_010230296.1|  PREDICTED: cyclin-H1-1 isoform X1                  100   8e-21   
ref|XP_010674710.1|  PREDICTED: cyclin-H1-1 isoform X4                98.2    4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009620421.1|  PREDICTED: cyclin-H1-1 isoform X3                97.4    6e-20   Nicotiana tomentosiformis
ref|XP_010026956.1|  PREDICTED: uncharacterized protein LOC104417359  97.1    1e-19   
ref|XP_009620423.1|  PREDICTED: cyclin-H1-1 isoform X5                95.9    2e-19   Nicotiana tomentosiformis
ref|XP_002984036.1|  hypothetical protein SELMODRAFT_445744           96.3    2e-19   Selaginella moellendorffii
ref|XP_006606942.1|  PREDICTED: cyclin-H1-1-like                      87.8    2e-17   
ref|XP_009760268.1|  PREDICTED: cyclin-H1-1-like isoform X3           88.2    2e-17   Nicotiana sylvestris
ref|XP_010024316.1|  PREDICTED: uncharacterized protein LOC104414...  80.1    2e-13   
ref|XP_010024315.1|  PREDICTED: uncharacterized protein LOC104414...  79.7    2e-13   
ref|XP_010024314.1|  PREDICTED: uncharacterized protein LOC104414...  79.7    3e-13   
gb|KJB45254.1|  hypothetical protein B456_007G298500                  76.6    5e-13   Gossypium raimondii
emb|CBB36490.1|  Oryza sativa protein similar to cyclin H-1 AAP03415  76.6    5e-13   Saccharum hybrid cultivar R570
emb|CBB36468.1|  Oryza sativa protein similar to cyclin H-1 AAP03415  76.3    7e-13   Saccharum hybrid cultivar R570
emb|CDI66546.1|  Cyclin-H1-1                                          76.3    8e-13   Saccharum hybrid cultivar R570
emb|CDX80636.1|  BnaC07g28080D                                        77.0    1e-12   
gb|KCW59459.1|  hypothetical protein EUGRSUZ_H02201                   72.0    1e-12   Eucalyptus grandis [rose gum]
ref|XP_001779669.1|  predicted protein                                74.3    8e-12   
ref|XP_002960101.1|  hypothetical protein SELMODRAFT_163567           70.5    1e-10   
ref|XP_007144723.1|  hypothetical protein PHAVU_007G1793000g          65.1    7e-09   Phaseolus vulgaris [French bean]
ref|XP_003078137.1|  Cyclin H (IC)                                    65.5    1e-08   Ostreococcus tauri
ref|XP_008235971.1|  PREDICTED: cyclin-H1-1-like                      61.2    1e-07   Prunus mume [ume]
ref|XP_007436277.1|  PREDICTED: cyclin-H isoform X3                   57.8    2e-06   
ref|XP_007436275.1|  PREDICTED: cyclin-H isoform X1                   57.8    3e-06   Python bivittatus
ref|XP_007436276.1|  PREDICTED: cyclin-H isoform X2                   57.8    4e-06   
ref|XP_009605486.1|  PREDICTED: cyclin-H1-1-like isoform X1           56.2    6e-06   
ref|XP_003747552.1|  PREDICTED: cyclin-H-like                         55.8    2e-05   Galendromus occidentalis
gb|ETE70238.1|  Cyclin-H                                              55.5    2e-05   Ophiophagus hannah
ref|XP_005651240.1|  cyclin-like protein                              55.5    3e-05   Coccomyxa subellipsoidea C-169
ref|XP_006007316.1|  PREDICTED: cyclin-H                              54.3    3e-05   
ref|XP_007144722.1|  hypothetical protein PHAVU_007G1793001g          51.6    4e-05   Phaseolus vulgaris [French bean]
ref|XP_006023909.1|  PREDICTED: cyclin-H                              54.3    4e-05   Alligator sinensis
ref|XP_006266776.1|  PREDICTED: cyclin-H                              54.7    5e-05   
ref|XP_010203998.1|  PREDICTED: cyclin-H                              53.5    6e-05   Colius striatus
gb|KFQ07173.1|  Cyclin-H                                              53.5    6e-05   Haliaeetus albicilla
ref|XP_009921041.1|  PREDICTED: cyclin-H isoform X2                   53.5    6e-05   Haliaeetus albicilla
ref|XP_001416639.1|  predicted protein                                53.5    6e-05   Ostreococcus lucimarinus CCE9901
gb|KGL94801.1|  Cyclin-H                                              53.9    6e-05   Charadrius vociferus
ref|XP_009885181.1|  PREDICTED: cyclin-H                              53.9    6e-05   Charadrius vociferus
ref|XP_009921040.1|  PREDICTED: cyclin-H isoform X1                   53.1    7e-05   Haliaeetus albicilla
ref|XP_004335911.1|  cyclin, Nterminal domain containing protein      53.9    8e-05   Acanthamoeba castellanii str. Neff
ref|XP_009478986.1|  PREDICTED: cyclin-H                              53.1    9e-05   Pelecanus crispus
ref|XP_010576352.1|  PREDICTED: cyclin-H isoform X4                   53.5    1e-04   Haliaeetus leucocephalus
ref|XP_008490370.1|  PREDICTED: cyclin-H                              53.1    1e-04   
ref|XP_010576350.1|  PREDICTED: cyclin-H isoform X3                   53.1    1e-04   Haliaeetus leucocephalus
ref|NP_001159785.1|  cyclin-H                                         53.1    1e-04   Sus scrofa [pigs]
ref|XP_010576348.1|  PREDICTED: cyclin-H isoform X1                   53.1    1e-04   Haliaeetus leucocephalus
gb|KFQ50591.1|  Cyclin-H                                              52.8    1e-04   Pelecanus crispus
ref|XP_010576349.1|  PREDICTED: cyclin-H isoform X2                   53.1    1e-04   Haliaeetus leucocephalus
ref|XP_005288208.1|  PREDICTED: cyclin-H isoform X3                   53.1    1e-04   
ref|XP_005661600.1|  PREDICTED: cyclin-H isoform X1                   53.1    1e-04   Sus scrofa [pigs]
ref|XP_008165695.1|  PREDICTED: cyclin-H isoform X1                   53.1    1e-04   
ref|XP_004703558.1|  PREDICTED: cyclin-H-like                         53.1    1e-04   Echinops telfairi [lesser hedgehog tenrec]
gb|AAD46521.1|AF154914_1  cyclin H                                    53.1    1e-04   Rattus norvegicus [brown rat]
ref|XP_005288207.1|  PREDICTED: cyclin-H isoform X2                   52.8    2e-04   
gb|EMP41150.1|  Cyclin-H                                              52.4    2e-04   Chelonia mydas [green seaturtle]
ref|XP_009506738.1|  PREDICTED: cyclin-H                              52.4    2e-04   Phalacrocorax carbo [common cormorant]
ref|XP_006132433.1|  PREDICTED: cyclin-H                              52.8    2e-04   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006197703.1|  PREDICTED: cyclin-H                              52.4    2e-04   Vicugna pacos
ref|XP_009909870.1|  PREDICTED: cyclin-H                              52.0    2e-04   Picoides pubescens
gb|KFW93046.1|  Cyclin-H                                              52.4    2e-04   Phalacrocorax carbo [common cormorant]
ref|XP_005430313.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-H         52.4    2e-04   Geospiza fortis
ref|XP_003899955.1|  PREDICTED: cyclin-H isoform X2                   52.4    2e-04   Papio anubis [baboon]
ref|XP_006167867.1|  PREDICTED: cyclin-H-like isoform X2              52.0    3e-04   Tupaia chinensis
ref|XP_007054155.1|  PREDICTED: cyclin-H                              52.8    3e-04   
ref|XP_009206995.1|  PREDICTED: cyclin-H isoform X1                   52.0    3e-04   Papio anubis [baboon]
ref|XP_005533098.1|  PREDICTED: cyclin-H                              52.0    3e-04   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004375070.1|  PREDICTED: cyclin-H                              50.1    3e-04   Trichechus manatus latirostris
gb|KFQ22791.1|  Cyclin-H                                              52.0    3e-04   Mesitornis unicolor
gb|KFV19419.1|  Cyclin-H                                              51.2    3e-04   Tauraco erythrolophus
gb|KFV63722.1|  Cyclin-H                                              51.6    3e-04   Picoides pubescens
ref|XP_010182595.1|  PREDICTED: cyclin-H-like                         51.6    3e-04   Mesitornis unicolor
ref|XP_006167866.1|  PREDICTED: cyclin-H-like isoform X1              51.6    4e-04   Tupaia chinensis
gb|KFV39824.1|  Cyclin-H                                              51.2    4e-04   Gavia stellata
ref|XP_001510964.2|  PREDICTED: cyclin-H                              52.0    4e-04   
gb|KFU89734.1|  Cyclin-H                                              51.2    4e-04   Chaetura pelagica
ref|XP_006188022.1|  PREDICTED: cyclin-H isoform X2                   51.2    4e-04   Camelus ferus
ref|XP_009639419.1|  PREDICTED: cyclin-H                              51.2    5e-04   Egretta garzetta
ref|XP_010960711.1|  PREDICTED: cyclin-H isoform X2                   51.2    5e-04   Camelus bactrianus [camel]
gb|KFP17934.1|  Cyclin-H                                              50.8    5e-04   Egretta garzetta
ref|XP_009986914.1|  PREDICTED: cyclin-H                              50.8    5e-04   Tauraco erythrolophus
ref|XP_010172276.1|  PREDICTED: cyclin-H                              50.4    5e-04   Antrostomus carolinensis
ref|XP_010960710.1|  PREDICTED: cyclin-H isoform X1                   51.2    6e-04   Camelus bactrianus [camel]
ref|XP_010960712.1|  PREDICTED: cyclin-H isoform X3                   51.2    6e-04   Camelus bactrianus [camel]
ref|XP_009996142.1|  PREDICTED: cyclin-H                              51.2    6e-04   Chaetura pelagica
ref|XP_009810013.1|  PREDICTED: cyclin-H                              50.4    6e-04   Gavia stellata
ref|XP_006188021.1|  PREDICTED: cyclin-H isoform X1                   50.8    6e-04   
ref|XP_010830200.1|  PREDICTED: cyclin-H isoform X9                   50.8    6e-04   Bison bison bison
ref|XP_006080286.1|  PREDICTED: cyclin-H isoform X3                   50.8    7e-04   Bubalus bubalis [domestic water buffalo]
gb|KFP86075.1|  Cyclin-H                                              50.4    7e-04   Acanthisitta chloris
gb|KFQ90021.1|  Cyclin-H                                              50.8    7e-04   Phoenicopterus ruber ruber
ref|XP_009078568.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-H         50.4    7e-04   Acanthisitta chloris
ref|XP_004009122.1|  PREDICTED: cyclin-H isoform 1                    50.8    7e-04   Ovis aries [domestic sheep]
ref|XP_006080288.1|  PREDICTED: cyclin-H isoform X5                   50.8    7e-04   Bubalus bubalis [domestic water buffalo]
ref|XP_010150658.1|  PREDICTED: cyclin-H                              50.4    7e-04   Eurypyga helias
ref|XP_005209795.1|  PREDICTED: cyclin-H isoform X4                   50.8    7e-04   Bos taurus [bovine]
ref|XP_006080287.1|  PREDICTED: cyclin-H isoform X4                   50.8    7e-04   Bubalus bubalis [domestic water buffalo]
ref|XP_005905881.1|  PREDICTED: cyclin-H isoform X2                   50.8    7e-04   Bos mutus
ref|NP_001073256.1|  cyclin-H                                         50.8    7e-04   Bos taurus [bovine]
ref|XP_004009123.1|  PREDICTED: cyclin-H isoform 2                    50.8    7e-04   
ref|XP_005683469.1|  PREDICTED: cyclin-H isoform X2                   50.8    7e-04   
ref|XP_001762420.1|  predicted protein                                50.4    7e-04   
ref|XP_006080285.1|  PREDICTED: cyclin-H isoform X2                   50.8    7e-04   Bubalus bubalis [domestic water buffalo]
ref|XP_005209793.1|  PREDICTED: cyclin-H isoform X2                   50.8    7e-04   Bos taurus [bovine]
ref|XP_009286535.1|  PREDICTED: cyclin-H                              50.4    7e-04   Aptenodytes forsteri
ref|XP_004640998.1|  PREDICTED: cyclin-H                              50.8    7e-04   Octodon degus
gb|ELR49021.1|  Cyclin-H                                              50.8    8e-04   Bos mutus
ref|XP_003216333.1|  PREDICTED: cyclin-H                              50.8    8e-04   Anolis carolinensis [Carolina anole]
gb|KFM13561.1|  Cyclin-H                                              50.1    8e-04   Aptenodytes forsteri
ref|XP_010830193.1|  PREDICTED: cyclin-H isoform X2                   50.8    8e-04   Bison bison bison
ref|XP_010830194.1|  PREDICTED: cyclin-H isoform X3                   50.8    8e-04   Bison bison bison
ref|XP_007350373.1|  cyclin-like protein                              50.8    8e-04   
ref|XP_005618200.1|  PREDICTED: cyclin-H isoform X2                   50.4    8e-04   
ref|NP_001186118.1|  cyclin-H isoform 2                               50.4    9e-04   Homo sapiens [man]
gb|KFR11498.1|  Cyclin-H                                              50.1    9e-04   Opisthocomus hoazin [hoatzin]
ref|XP_006080284.1|  PREDICTED: cyclin-H isoform X1                   50.4    9e-04   Bubalus bubalis [domestic water buffalo]
ref|XP_005683468.1|  PREDICTED: cyclin-H isoform X1                   50.4    9e-04   Capra hircus [domestic goat]
ref|XP_005495402.1|  PREDICTED: cyclin-H isoform X2                   50.4    9e-04   
ref|XP_010830192.1|  PREDICTED: cyclin-H isoform X1                   50.4    9e-04   Bison bison bison
ref|XP_010116176.1|  PREDICTED: cyclin-H                              50.1    9e-04   Chlamydotis macqueenii
ref|XP_005209792.1|  PREDICTED: cyclin-H isoform X1                   50.4    9e-04   Bos taurus [bovine]
ref|XP_005618199.1|  PREDICTED: cyclin-H isoform X1                   50.4    9e-04   Canis lupus familiaris [dogs]
ref|XP_010830195.1|  PREDICTED: cyclin-H isoform X4                   50.4    9e-04   Bison bison bison
ref|XP_007941582.1|  PREDICTED: cyclin-H                              50.4    0.001   Orycteropus afer afer
ref|XP_011376101.1|  PREDICTED: cyclin-H isoform X2                   50.4    0.001   
ref|XP_010081158.1|  PREDICTED: cyclin-H                              50.4    0.001   Pterocles gutturalis
gb|KFP78906.1|  Cyclin-H                                              50.1    0.001   Apaloderma vittatum
ref|XP_009239158.1|  PREDICTED: cyclin-H isoform X5                   50.1    0.001   Pongo abelii [orang utan]
ref|XP_011231158.1|  PREDICTED: cyclin-H isoform X3                   50.1    0.001   
gb|KFV14767.1|  Cyclin-H                                              50.1    0.001   Pterocles gutturalis
ref|XP_536300.3|  PREDICTED: cyclin-H isoform X3                      50.4    0.001   Canis lupus familiaris [dogs]
gb|KFW73498.1|  Cyclin-H                                              50.1    0.001   Pygoscelis adeliae
ref|XP_005495401.1|  PREDICTED: cyclin-H isoform X1                   50.4    0.001   



>emb|CDP15498.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF GA+ E    L  L ESA +E D+ M TDA LLFPPGQLAL ALRR+NE   +F
Sbjct  188  NDVEEFCGAKEEQLAMLGSLHESAKVEVDKIMRTDAPLLFPPGQLALAALRRSNEACGIF  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGLh  557
            +FERYL+ +L+RQ PT S SDL+  L  ++S +NKLE+P++KDVKHIDRKLKSCLDPG H
Sbjct  248  DFERYLKSVLSRQHPTLSNSDLAVFLNAVDSSVNKLETPTSKDVKHIDRKLKSCLDPGSH  307

Query  556  dkskkrkhrskdsSNEVHDMA  494
            DKSKKRKHRSK+SSN++ DM+
Sbjct  308  DKSKKRKHRSKESSNDILDMS  328



>ref|XP_009620424.1| PREDICTED: cyclin-H1-1 isoform X6 [Nicotiana tomentosiformis]
Length=267

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  +TLK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    +
Sbjct  125  SDMEEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHDI  184

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  185  LDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  244



>ref|XP_009620422.1| PREDICTED: cyclin-H1-1 isoform X4 [Nicotiana tomentosiformis]
Length=286

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 95/120 (79%), Gaps = 2/120 (2%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  +TLK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    +
Sbjct  144  SDMEEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHDI  203

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  204  LDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  263



>ref|XP_009620418.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620419.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana tomentosiformis]
Length=328

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  +TLK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    +
Sbjct  186  SDMEEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHDI  245

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  246  LDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  305

Query  562  LhdkskkrkhrskdsSNEVHDMA  494
             HDKSKKRKHRSK+SS EV D++
Sbjct  306  SHDKSKKRKHRSKESSTEVQDLS  328



>ref|XP_010320161.1| PREDICTED: cyclin-H1-1-like isoform X2 [Solanum lycopersicum]
Length=285

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPP-DTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEF GA+ E     LK   ++A IEAD+ M +D  LLFPPGQLALTAL RAN    +
Sbjct  144  SDLEEFCGAKDEDQLVALKGSLDTARIEADKIMRSDGPLLFPPGQLALTALHRANAVHSI  203

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            F+FERYL  +L+R QP H+IS+L+G +  I+SLI KL +P++KDVKH+DRKLKSCLDPG
Sbjct  204  FDFERYLRSVLSRYQPAHAISELTGSIDAIDSLIGKLLTPTSKDVKHVDRKLKSCLDPG  262



>ref|XP_004237891.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010320159.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010320160.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum lycopersicum]
Length=327

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPP-DTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEF GA+ E     LK   ++A IEAD+ M +D  LLFPPGQLALTAL RAN    +
Sbjct  186  SDLEEFCGAKDEDQLVALKGSLDTARIEADKIMRSDGPLLFPPGQLALTALHRANAVHSI  245

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            F+FERYL  +L+R QP H+IS+L+G +  I+SLI KL +P++KDVKH+DRKLKSCLDPG
Sbjct  246  FDFERYLRSVLSRYQPAHAISELTGSIDAIDSLIGKLLTPTSKDVKHVDRKLKSCLDPG  304



>ref|XP_009799573.1| PREDICTED: cyclin-H1-1 isoform X4 [Nicotiana sylvestris]
Length=267

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  + LK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    +
Sbjct  125  SDMEEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHGI  184

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  185  LDFERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  244



>ref|XP_009799572.1| PREDICTED: cyclin-H1-1 isoform X3 [Nicotiana sylvestris]
Length=286

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  + LK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    +
Sbjct  144  SDMEEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHGI  203

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  204  LDFERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  263



>ref|XP_009620420.1| PREDICTED: cyclin-H1-1 isoform X2 [Nicotiana tomentosiformis]
Length=305

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = -2

Query  910  IEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            ++EFRGA + +  +TLK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    + +
Sbjct  165  LQEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHDILD  224

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPGLh  557
            FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG H
Sbjct  225  FERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPGSH  284

Query  556  dkskkrkhrskdsSNEVHDMA  494
            DKSKKRKHRSK+SS EV D++
Sbjct  285  DKSKKRKHRSKESSTEVQDLS  305



>ref|XP_009799569.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009799570.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana sylvestris]
Length=328

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  + LK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    +
Sbjct  186  SDMEEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHGI  245

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  246  LDFERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  305

Query  562  LhdkskkrkhrskdsSNEVHDMA  494
             HDKSKKRKHRSK+SS EV D++
Sbjct  306  SHDKSKKRKHRSKESSTEVQDLS  328



>ref|XP_006354003.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum tuberosum]
 ref|XP_006354004.1| PREDICTED: cyclin-H1-1-like isoform X2 [Solanum tuberosum]
 ref|XP_006354005.1| PREDICTED: cyclin-H1-1-like isoform X3 [Solanum tuberosum]
 ref|XP_006354006.1| PREDICTED: cyclin-H1-1-like isoform X4 [Solanum tuberosum]
Length=327

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPP-DTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEF GA+ E     LK   ++A IEAD+ M +D  LLFPPGQLALTAL RAN    +
Sbjct  186  SDLEEFCGAKDEDQLVALKGSLDTARIEADKIMRSDGPLLFPPGQLALTALHRANAAHSI  245

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            F+FERYL  +L+  +P H+IS+L+G +  I+SL+ KL +P++KDVKH+DRKLKSCLDPG
Sbjct  246  FDFERYLRSVLSHYEPAHAISELAGSINAIDSLVGKLLTPTSKDVKHVDRKLKSCLDPG  304



>ref|XP_010918004.1| PREDICTED: cyclin-H1-1 isoform X2 [Elaeis guineensis]
Length=341

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+EEF  A  E  +  + L E+A +E D+ MLTDA LL+PPGQLAL ALRR+NE  RV +
Sbjct  188  DMEEFGQARNEEQEKFQDLRETAKLEVDKIMLTDAPLLYPPGQLALAALRRSNEAHRVLD  247

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYLE I +RQ+ +HSIS L+  +K I+ ++ KL+ PS KD++HIDRKLKSC DP 
Sbjct  248  FERYLESIFSRQRSSHSISQLNESMKTIDFMLGKLKIPSTKDMRHIDRKLKSCWDPS  304



>ref|XP_010917999.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
 ref|XP_010918000.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
 ref|XP_010918001.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
 ref|XP_010918002.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
Length=351

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+EEF  A  E  +  + L E+A +E D+ MLTDA LL+PPGQLAL ALRR+NE  RV +
Sbjct  198  DMEEFGQARNEEQEKFQDLRETAKLEVDKIMLTDAPLLYPPGQLALAALRRSNEAHRVLD  257

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYLE I +RQ+ +HSIS L+  +K I+ ++ KL+ PS KD++HIDRKLKSC DP 
Sbjct  258  FERYLESIFSRQRSSHSISQLNESMKTIDFMLGKLKIPSTKDMRHIDRKLKSCWDPS  314



>ref|XP_010271136.1| PREDICTED: cyclin-H1-1 isoform X2 [Nelumbo nucifera]
Length=304

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EEF  A+      LK L E++ +E D+TMLTDA LLFPPGQLAL ALRR+NE  RV 
Sbjct  155  DDMEEFCQAKNGQLQMLKDLRETSKLEVDKTMLTDAPLLFPPGQLALAALRRSNEVHRVL  214

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDP  566
            +FERYLE I++RQ   HSI +L+  L  I+S + KL  P+ KD++HIDRKLKSCLDP
Sbjct  215  DFERYLENIISRQHSAHSILELTESLDDIDSWVRKLNIPTTKDMRHIDRKLKSCLDP  271



>ref|XP_010271132.1| PREDICTED: cyclin-H1-1 isoform X1 [Nelumbo nucifera]
 ref|XP_010271133.1| PREDICTED: cyclin-H1-1 isoform X1 [Nelumbo nucifera]
 ref|XP_010271134.1| PREDICTED: cyclin-H1-1 isoform X1 [Nelumbo nucifera]
Length=337

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EEF  A+      LK L E++ +E D+TMLTDA LLFPPGQLAL ALRR+NE  RV 
Sbjct  188  DDMEEFCQAKNGQLQMLKDLRETSKLEVDKTMLTDAPLLFPPGQLALAALRRSNEVHRVL  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDP  566
            +FERYLE I++RQ   HSI +L+  L  I+S + KL  P+ KD++HIDRKLKSCLDP
Sbjct  248  DFERYLENIISRQHSAHSILELTESLDDIDSWVRKLNIPTTKDMRHIDRKLKSCLDP  304



>gb|EYU42757.1| hypothetical protein MIMGU_mgv1a009980mg [Erythranthe guttata]
 gb|EYU42758.1| hypothetical protein MIMGU_mgv1a009980mg [Erythranthe guttata]
Length=325

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  913  DIEEFRGAE-GEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            D+EE  GA+     + +K L ESA +E D+ MLT+A LLFPPGQLAL ALRR+ E  +V 
Sbjct  189  DMEEIYGAKMAGQTEIIKNLHESAKLEVDKIMLTEAPLLFPPGQLALAALRRSCEVHKVN  248

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERY++ +L+RQ P H +SDL   L  I+ LINKLE+P++KDVKHIDRKLKSCLDP 
Sbjct  249  DFERYIKSMLSRQHPAHGLSDLHLPLNAIDILINKLETPTSKDVKHIDRKLKSCLDPS  306



>ref|XP_009799571.1| PREDICTED: cyclin-H1-1 isoform X2 [Nicotiana sylvestris]
Length=305

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 112/141 (79%), Gaps = 2/141 (1%)
 Frame = -2

Query  910  IEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            ++EFRGA + +  + LK++ E+A +EAD+ M T+A LLFPPGQLAL ALRRAN    + +
Sbjct  165  LQEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHGILD  224

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPGLh  557
            FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG H
Sbjct  225  FERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPGSH  284

Query  556  dkskkrkhrskdsSNEVHDMA  494
            DKSKKRKHRSK+SS EV D++
Sbjct  285  DKSKKRKHRSKESSTEVQDLS  305



>ref|XP_011076677.1| PREDICTED: cyclin-H1-1 [Sesamum indicum]
 ref|XP_011076678.1| PREDICTED: cyclin-H1-1 [Sesamum indicum]
Length=328

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EE   A+    +T+K L ESA  E D+ M TDA LL+PPGQLAL ALRRA E  ++ 
Sbjct  188  SDLEESYDAKLGQSETIKSLHESAKAEVDKIMRTDAPLLYPPGQLALAALRRACEVHKLI  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYL+ + +RQ P H+ S+L+  L  I+ LINKLE+P++KDVKHIDRKLKSCLDP 
Sbjct  248  DFERYLQNMFSRQHPAHATSELNLALNVIDMLINKLETPTSKDVKHIDRKLKSCLDPS  305



>ref|XP_006344638.1| PREDICTED: cyclin-H1-1-like isoform X2 [Solanum tuberosum]
Length=328

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPP-DTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEF GA+ +     LK   ++A IEAD+ M +D  LLFPPGQLAL AL RAN    +
Sbjct  186  SDLEEFCGAQDDDQLVALKGALDTARIEADKIMRSDGPLLFPPGQLALAALHRANAAHGI  245

Query  739  FEFERYLERILARQ-QPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            F+FERYL  +L+   QP H+IS+L+G +  I+SLI KL +P++KDVKHIDRKLKSCLDPG
Sbjct  246  FDFERYLRSVLSHHDQPGHAISELTGSINAIDSLIGKLLTPTSKDVKHIDRKLKSCLDPG  305

Query  562  LhdkskkrkhrskdsSNEVHDMA  494
             HDKSKKRKHRSKDSSNEV D++
Sbjct  306  SHDKSKKRKHRSKDSSNEVTDIS  328



>ref|XP_002284178.1| PREDICTED: cyclin-H1-1 [Vitis vinifera]
 emb|CBI39478.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EEF  A+ +    LK L ++A +E D+TMLTDA LLFPPGQLAL ALRR+NE  +V 
Sbjct  188  DDMEEFCQAKNDRLQMLKDLHKTAKMEVDKTMLTDAPLLFPPGQLALAALRRSNEVHQVL  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYL  IL+RQ  +H+ S+L+  L  I+S + K + P+ +D+KHIDRKLK CLDP 
Sbjct  248  DFERYLSSILSRQDFSHAFSELTESLNAIDSWVMKHQVPTTEDMKHIDRKLKFCLDPS  305



>ref|XP_010108984.1| hypothetical protein L484_027180 [Morus notabilis]
 gb|EXC20624.1| hypothetical protein L484_027180 [Morus notabilis]
Length=332

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EEF G++ +    LK L E+A +E D+ MLTDA LLFPPGQLAL ALR +NE  RV 
Sbjct  185  DDMEEFCGSKDDQLQALKNLHETARMEVDKIMLTDAPLLFPPGQLALAALRSSNEVHRVI  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL+RIL RQ   H++S+L   L  I+S + + + PS KD+KHI+RKLKSC 
Sbjct  245  DFERYLKRILTRQNSAHTMSELIESLNAIDSWVKRYKFPSEKDLKHINRKLKSCW  299



>ref|XP_008811991.1| PREDICTED: cyclin-H1-1 isoform X2 [Phoenix dactylifera]
Length=320

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+EEF     E  +  + L  +A +E D+ MLTDA LL+ PGQLAL ALRR+NE  RV +
Sbjct  167  DMEEFCQVRNEEQEKFQDLRGTAKLEVDKIMLTDAPLLYAPGQLALAALRRSNEVHRVLD  226

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYLE I +RQ+ +HSIS L   +K I+ ++ KL+ PS KD++HIDRKLKSC DP 
Sbjct  227  FERYLESIFSRQRSSHSISQLIESMKTIDFMLGKLKIPSTKDMRHIDRKLKSCWDPS  283



>ref|XP_007030955.1| Cyclin H,1 isoform 3 [Theobroma cacao]
 gb|EOY11457.1| Cyclin H,1 isoform 3 [Theobroma cacao]
Length=332

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF GA+ E    LK L E+A IE D+ MLTDA  LFPPGQLAL ALR ANE  +V 
Sbjct  186  NDMEEFCGAKDEQNQILKDLQETARIEVDKIMLTDAPHLFPPGQLALAALRSANEMHKVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL RQ   H+IS L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFERYLRSILTRQNSEHTISQLIESLNAIDTWVRKYKFPTEKDMKHINRKLKSCW  300



>ref|XP_007030954.1| Cyclin H,1 isoform 2 [Theobroma cacao]
 gb|EOY11456.1| Cyclin H,1 isoform 2 [Theobroma cacao]
Length=331

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF GA+ E    LK L E+A IE D+ MLTDA  LFPPGQLAL ALR ANE  +V 
Sbjct  186  NDMEEFCGAKDEQNQILKDLQETARIEVDKIMLTDAPHLFPPGQLALAALRSANEMHKVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL RQ   H+IS L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFERYLRSILTRQNSEHTISQLIESLNAIDTWVRKYKFPTEKDMKHINRKLKSCW  300



>ref|XP_008811990.1| PREDICTED: cyclin-H1-1 isoform X1 [Phoenix dactylifera]
Length=341

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+EEF     E  +  + L  +A +E D+ MLTDA LL+ PGQLAL ALRR+NE  RV +
Sbjct  188  DMEEFCQVRNEEQEKFQDLRGTAKLEVDKIMLTDAPLLYAPGQLALAALRRSNEVHRVLD  247

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYLE I +RQ+ +HSIS L   +K I+ ++ KL+ PS KD++HIDRKLKSC DP 
Sbjct  248  FERYLESIFSRQRSSHSISQLIESMKTIDFMLGKLKIPSTKDMRHIDRKLKSCWDPS  304



>ref|XP_009418143.1| PREDICTED: cyclin-H1-1 isoform X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009418144.1| PREDICTED: cyclin-H1-1 isoform X3 [Musa acuminata subsp. malaccensis]
Length=170

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D++EF  A  E  +  K   ++A  E DR MLTDA LL+PPGQL+L +L RANE   V +
Sbjct  26   DMQEFCHARDEEQEKFKNFLQTANAEVDRIMLTDAPLLYPPGQLSLASLHRANEVHGVLD  85

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYL  +L+RQ   +S S L   LK I++L+ KL  P+AKD++HIDRKLKSC DP 
Sbjct  86   FERYLNILLSRQHSAYSTSQLFESLKSIDTLVGKLNIPTAKDMRHIDRKLKSCWDPS  142



>ref|XP_004230215.1| PREDICTED: cyclin-H1-1 [Solanum lycopersicum]
Length=328

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = -2

Query  916  NDIEEFRGAE-GEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +++EEF GA+  +    LK   ++A IEAD+ M +D  LLFPPGQLALTAL RA+    +
Sbjct  186  SNLEEFCGAQDNDQLLALKGALDTARIEADKIMRSDGPLLFPPGQLALTALHRADAAHGI  245

Query  739  FEFERYLERILARQ-QPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            F+FERYL  +L+   QP H+IS+L+  +  I+SL+ KL +P++KDVKHIDRKLKSCLDPG
Sbjct  246  FDFERYLRSVLSHHDQPGHAISELTDSINVIDSLVGKLLTPTSKDVKHIDRKLKSCLDPG  305

Query  562  LhdkskkrkhrskdsSNEVHDMA  494
             HDKSKKRKHRSKDSSNEV D++
Sbjct  306  SHDKSKKRKHRSKDSSNEVTDIS  328



>ref|XP_007030953.1| Cyclin-H1-1 isoform 1 [Theobroma cacao]
 gb|EOY11455.1| Cyclin-H1-1 isoform 1 [Theobroma cacao]
Length=426

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF GA+ E    LK L E+A IE D+ MLTDA  LFPPGQLAL ALR ANE  +V 
Sbjct  186  NDMEEFCGAKDEQNQILKDLQETARIEVDKIMLTDAPHLFPPGQLALAALRSANEMHKVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL RQ   H+IS L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFERYLRSILTRQNSEHTISQLIESLNAIDTWVRKYKFPTEKDMKHINRKLKSCW  300



>gb|KJB45248.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=243

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  98   NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  157

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  158  DFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  212



>ref|XP_009418142.1| PREDICTED: cyclin-H1-1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D++EF  A  E  +  K   ++A  E DR MLTDA LL+PPGQL+L +L RANE   V +
Sbjct  109  DMQEFCHARDEEQEKFKNFLQTANAEVDRIMLTDAPLLYPPGQLSLASLHRANEVHGVLD  168

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYL  +L+RQ   +S S L   LK I++L+ KL  P+AKD++HIDRKLKSC DP 
Sbjct  169  FERYLNILLSRQHSAYSTSQLFESLKSIDTLVGKLNIPTAKDMRHIDRKLKSCWDPS  225



>gb|EPS69696.1| hypothetical protein M569_05066, partial [Genlisea aurea]
Length=321

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = -2

Query  916  NDIEEFR-GAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            NDIE  R   E    D LK + ESA +E D+ M TDA LLFPPGQLAL ALRR+ E  + 
Sbjct  191  NDIEATRESQEVYQLDKLKNVHESAKLEVDKIMRTDAPLLFPPGQLALAALRRSVEAHKF  250

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             EFERYL  IL+RQ+P   + +++  L  I+ L+N+LE+P++KDVKHIDRKLKSCLDP 
Sbjct  251  MEFERYLGSILSRQKPV--VPEMNASLNAIDLLVNRLETPTSKDVKHIDRKLKSCLDPS  307



>gb|KJB45252.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=272

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  127  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  186

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  187  DFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  241



>gb|KJB45249.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=289

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  144  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  203

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  204  DFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  258



>gb|KDP23501.1| hypothetical protein JCGZ_23334 [Jatropha curcas]
Length=350

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A  +    LK+L  SA  E D+ M TDA LLFPPGQLAL ALR ANE  +V 
Sbjct  203  NDMEEFCHATDDQIQMLKELQSSAVAEVDKIMFTDAPLLFPPGQLALAALRSANEMHQVL  262

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  ILARQ   H++SDL   L  I S + K + P+ KD+KHI+RKLKSC 
Sbjct  263  DFERYLGDILARQNSIHTMSDLFESLDAINSWVKKYKFPTEKDMKHINRKLKSCW  317



>gb|KJB45251.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=332

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  300



>gb|KJB45247.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=331

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  300



>gb|KJB45246.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=332

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  300



>ref|XP_006344637.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum tuberosum]
Length=342

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 109/157 (69%), Gaps = 16/157 (10%)
 Frame = -2

Query  916  NDIEEFRGAEGEPP-DTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEF GA+ +     LK   ++A IEAD+ M +D  LLFPPGQLAL AL RAN    +
Sbjct  186  SDLEEFCGAQDDDQLVALKGALDTARIEADKIMRSDGPLLFPPGQLALAALHRANAAHGI  245

Query  739  FEFER--------------YLERILARQ-QPTHSISDLSGLLKPIESLINKLESPSAKDV  605
            F+FER              YL  +L+   QP H+IS+L+G +  I+SLI KL +P++KDV
Sbjct  246  FDFERSQSLSHLDRSTIIRYLRSVLSHHDQPGHAISELTGSINAIDSLIGKLLTPTSKDV  305

Query  604  KHIDRKLKSCLDPGLhdkskkrkhrskdsSNEVHDMA  494
            KHIDRKLKSCLDPG HDKSKKRKHRSKDSSNEV D++
Sbjct  306  KHIDRKLKSCLDPGSHDKSKKRKHRSKDSSNEVTDIS  342



>gb|KHG11498.1| Cyclin-H1-1 -like protein [Gossypium arboreum]
Length=332

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFEGYLRRILARQNSEHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  300



>ref|XP_009418139.1| PREDICTED: cyclin-H1-1 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009418140.1| PREDICTED: cyclin-H1-1 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009418141.1| PREDICTED: cyclin-H1-1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=332

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 0/117 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D++EF  A  E  +  K   ++A  E DR MLTDA LL+PPGQL+L +L RANE   V +
Sbjct  188  DMQEFCHARDEEQEKFKNFLQTANAEVDRIMLTDAPLLYPPGQLSLASLHRANEVHGVLD  247

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            FERYL  +L+RQ   +S S L   LK I++L+ KL  P+AKD++HIDRKLKSC DP 
Sbjct  248  FERYLNILLSRQHSAYSTSQLFESLKSIDTLVGKLNIPTAKDMRHIDRKLKSCWDPS  304



>gb|KHN20228.1| Cyclin-H1-1 [Glycine soja]
Length=174

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A     + LK L E+A  E D+ MLTDA LLFPPGQLAL ALR +N   RV 
Sbjct  27   NDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNSNALHRVI  86

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  87   DFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLKSCW  141



>ref|XP_008359865.1| PREDICTED: cyclin-H1-1-like [Malus domestica]
Length=328

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 79/115 (69%), Gaps = 3/115 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G E    + L+ L ++A +E D+ MLTDA LLFPPGQLAL ALR AN   RV 
Sbjct  182  NDMEEFCGLED---NQLQHLKDAAKMEVDKIMLTDAPLLFPPGQLALAALRSANHVCRVA  238

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL+RQ   H+IS+L   L  I+S   + + PS KD+KHI+RKLKSC 
Sbjct  239  DFERYLSSILSRQSSAHTISELVEFLNAIDSWAKRYKFPSDKDLKHINRKLKSCW  293



>ref|XP_008440228.1| PREDICTED: cyclin-H1-1 isoform X3 [Cucumis melo]
Length=275

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            NDIEE      E  + L+ L  +A ++ D+ MLTDA LLFPPGQLAL ALRR+NE   V 
Sbjct  131  NDIEELFH---ENAEMLQMLKATASLDVDKIMLTDAPLLFPPGQLALAALRRSNEVHGVI  187

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+KHI+RKLKSC   G
Sbjct  188  DFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLKHINRKLKSCWGLG  245



>ref|XP_002512403.1| cyclin h, putative [Ricinus communis]
 gb|EEF49855.1| cyclin h, putative [Ricinus communis]
Length=312

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F  A  +    LK L  SA  E D+ M TDA LLFPPGQLAL ALR AN   RV 
Sbjct  167  NDMEDFCHATDDQTQMLKDLQVSAVAEVDKIMFTDAPLLFPPGQLALAALRSANGMHRVL  226

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL+RQ   H+IS+L+  L  I+S + K + P+ KD+KHI+RKLKSC 
Sbjct  227  DFERYLRDILSRQNLVHTISNLTESLDAIDSWVKKYKFPTEKDMKHINRKLKSCW  281



>ref|XP_004141934.1| PREDICTED: cyclin-H1-1-like [Cucumis sativus]
 ref|XP_004169380.1| PREDICTED: cyclin-H1-1-like [Cucumis sativus]
 gb|KGN48487.1| hypothetical protein Csa_6G490020 [Cucumis sativus]
Length=332

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            NDIEE      E  + L+ L  +A +E D+ MLTDA LLFPPGQLAL ALRR+NE   V 
Sbjct  188  NDIEELFN---ENAEMLQMLKVTASLEVDKIMLTDAPLLFPPGQLALAALRRSNEVHGVI  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+KHI+RKLKSC   G
Sbjct  245  DFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLKHINRKLKSCWGLG  302



>ref|XP_008440227.1| PREDICTED: cyclin-H1-1 isoform X2 [Cucumis melo]
Length=290

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 79/118 (67%), Gaps = 3/118 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            NDIEE      E    L+ L  +A ++ D+ MLTDA LLFPPGQLAL ALRR+NE   V 
Sbjct  146  NDIEELFHENAE---MLQMLKATASLDVDKIMLTDAPLLFPPGQLALAALRRSNEVHGVI  202

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+KHI+RKLKSC   G
Sbjct  203  DFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLKHINRKLKSCWGLG  260



>ref|XP_009376695.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-H1-1, partial [Pyrus x 
bretschneideri]
Length=313

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 0/113 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+EEF G E      LK +  +A  E D+ MLTDA LLFPPGQLAL ALR AN+  RV +
Sbjct  176  DMEEFCGLEDNQLQYLKVIVGAAKTEVDKIMLTDAPLLFPPGQLALAALRSANQVCRVAD  235

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            FER+L  IL+RQ   H+IS+L   L  I+S   + + PS KD+KHI+RKLKSC
Sbjct  236  FERFLSSILSRQSSAHTISELVEFLNAIDSWAKRYKFPSDKDIKHINRKLKSC  288



>ref|XP_006433378.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 ref|XP_006472056.1| PREDICTED: cyclin-H1-1-like isoform X3 [Citrus sinensis]
 gb|ESR46618.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
Length=331

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F   +      LK L E+A +E D+ MLTDA LLFPPGQLAL ALR +N+  RV 
Sbjct  188  NDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQLALAALRNSNKVQRVV  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            ++E YL  IL+RQ   H ISDL+  L  I+S + K + PS KD+KHI+RKLKSC   G
Sbjct  248  DYESYLSSILSRQNSGHIISDLTENLDTIDSWVMKYKFPSEKDMKHINRKLKSCWGHG  305



>ref|XP_008440225.1| PREDICTED: cyclin-H1-1 isoform X1 [Cucumis melo]
 ref|XP_008440226.1| PREDICTED: cyclin-H1-1 isoform X1 [Cucumis melo]
Length=332

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 80/118 (68%), Gaps = 3/118 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            NDIEE      E  + L+ L  +A ++ D+ MLTDA LLFPPGQLAL ALRR+NE   V 
Sbjct  188  NDIEELFH---ENAEMLQMLKATASLDVDKIMLTDAPLLFPPGQLALAALRRSNEVHGVI  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+KHI+RKLKSC   G
Sbjct  245  DFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLKHINRKLKSCWGLG  302



>gb|KHN09714.1| Cyclin-H1-1 [Glycine soja]
Length=332

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A     + LK L E+A  E DR MLTDA LLFPPGQLAL ALR +N   RV 
Sbjct  185  NDMEEFFNAGDNQLEMLKTLQETARFEVDRMMLTDAPLLFPPGQLALAALRNSNALHRVI  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  245  DFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLKSCW  299



>ref|XP_007205500.1| hypothetical protein PRUPE_ppa008262mg [Prunus persica]
 gb|EMJ06699.1| hypothetical protein PRUPE_ppa008262mg [Prunus persica]
Length=339

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EEF G   +    L+ L  +A +E D+ MLTDA LLFPPGQLAL ALR AN+  +V 
Sbjct  185  DDMEEFCGINDDRLQILQNLLHAAKMEVDKIMLTDAPLLFPPGQLALAALRSANQVHKVV  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL+RQ   H++S+L   L  I+S   K + PS KD+KHI+RKLKSC 
Sbjct  245  DFERYLRSILSRQSSEHTVSELVEFLNAIDSWARKYKFPSDKDLKHINRKLKSCW  299



>gb|KJB45250.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=339

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 7/122 (6%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFE-------RYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKS  578
            +FE       RYL RILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKS
Sbjct  246  DFEGLCCVLCRYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKS  305

Query  577  CL  572
            C 
Sbjct  306  CW  307



>gb|KHN42891.1| Cyclin-H1-1 [Glycine soja]
Length=187

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A  +  + LK L E+A  E D+ MLTDA LLFPPGQLAL AL  +N   RV 
Sbjct  40   NDVEEFCNAGDDQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALSNSNALHRVI  99

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ YL  I + +   H++S+LS  L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  100  DFDSYLRGIFSHENSMHTMSELSESLNAIDSWVRKYKSPSEKELKHINRKLKSCW  154



>ref|XP_008246397.1| PREDICTED: cyclin-H1-1 [Prunus mume]
Length=337

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+EEF G   +    L+ L  +A +E D+ MLTDA LLFPPGQLAL ALR AN+  +V 
Sbjct  188  DDMEEFCGINDDQLQILQNLLHAAKMEVDKIMLTDAPLLFPPGQLALAALRGANQVHKVV  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYL  IL+RQ   H++S+L   L  I+S   K + PS KD+KHI+RKLKSC 
Sbjct  248  DFERYLRSILSRQSSEHTVSELIEFLNAIDSWARKYKFPSDKDLKHINRKLKSCW  302



>ref|XP_003526926.1| PREDICTED: cyclin-H1-1 isoformX1 [Glycine max]
Length=335

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A     + LK L E+A  E D+ MLTDA LLFPPGQLAL ALR +N   RV 
Sbjct  188  NDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNSNAFHRVI  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  248  DFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLKSCW  302



>ref|XP_009111750.1| PREDICTED: cyclin-H1-1-like [Brassica rapa]
Length=334

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            ++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V +
Sbjct  187  NMEEFLQARDDEIQKLQSLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANGILGVVD  246

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            F+RYLE I+++    H+ SDLS LL  IESL+   + PS KD+KHI+RKLKSCL
Sbjct  247  FDRYLENIVSQPNSEHTASDLSKLLDGIESLVKNYKYPSEKDMKHINRKLKSCL  300



>gb|AAD02871.1| CAK associated cyclinH homolog [Populus tremula x Populus tremuloides]
Length=332

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -2

Query  913  DIEEFRGAEGEPPD-TLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            DIEEF      P D  ++KL E A  E D+ MLTDA ++FPPGQLAL AL+ ANE  RV 
Sbjct  189  DIEEF----CHPTDENIEKLKEIAVAEVDKIMLTDAPVMFPPGQLALAALQSANEMHRVL  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYLE +L+RQ   H IS++S  L  +E  + K   P+ KD+KHI+RKLKSC 
Sbjct  245  DFERYLESVLSRQNSAHMISEISESLHAVEKWVRKYSFPTDKDMKHINRKLKSCW  299



>gb|ACU23520.1| unknown [Glycine max]
Length=335

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A     + LK L E+A  E D+ MLTDA LLFPPGQLAL ALR +N   RV 
Sbjct  188  NDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNSNAFHRVI  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ Y   I +R+   H++S+LS  L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  248  DFDSYFRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLKSCW  302



>ref|XP_006394954.1| hypothetical protein EUTSA_v10004554mg [Eutrema salsugineum]
 gb|ESQ32240.1| hypothetical protein EUTSA_v10004554mg [Eutrema salsugineum]
Length=334

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +++E+F  A+ +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  186  SNMEDFLQAQDDEIQKLENLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANRILGVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +++RYLE I+++    H+ S+L+ LL  IESL+   +SPS KD+KHI+RKLKSCL
Sbjct  246  DYDRYLENIVSQPNSEHTTSELTKLLDDIESLVKNYKSPSEKDMKHINRKLKSCL  300



>ref|XP_006382505.1| hypothetical protein POPTR_0005s02780g [Populus trichocarpa]
 gb|ERP60302.1| hypothetical protein POPTR_0005s02780g [Populus trichocarpa]
Length=334

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -2

Query  913  DIEEFRGAEGEPPD-TLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            DIEEF      P D  ++KL E A  E D+ MLTDA ++FPPGQLAL AL+ ANE  RV 
Sbjct  191  DIEEF----CHPTDENIEKLKEIAVAEIDKIMLTDAPVMFPPGQLALAALQSANEVHRVL  246

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYLE +L+RQ   H IS++S  L  +E  + K   P+ KD+KHI+RKLKSC 
Sbjct  247  DFERYLESVLSRQNSAHMISEISESLHAVEKWVRKYSFPTDKDMKHINRKLKSCW  301



>ref|XP_011036827.1| PREDICTED: cyclin-H1-1 isoform X1 [Populus euphratica]
Length=335

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -2

Query  913  DIEEFRGAEGEPPD-TLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            DIEEF      P D  ++KL E A  E D+ MLTDA +LFPPGQLAL AL+ ANE  RV 
Sbjct  189  DIEEF----CHPTDENIEKLKEIAVAEVDKIMLTDAPVLFPPGQLALAALQSANEVHRVL  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYLE +L+RQ   H IS++S  L  ++  + K   P+ KD+KHI+RKLKSC 
Sbjct  245  DFERYLESVLSRQNSAHMISEISESLHAVKKWVRKYSFPTDKDMKHINRKLKSCW  299



>ref|XP_006842697.1| hypothetical protein AMTR_s00147p00079450 [Amborella trichopoda]
 gb|ERN04372.1| hypothetical protein AMTR_s00147p00079450 [Amborella trichopoda]
Length=396

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F  A  +    LK L E+  +E D+TMLTDA LLFPPGQLAL ALRR+NE  +V 
Sbjct  250  NDMEDFSHALDD--GKLKALGEATKLEVDKTMLTDAPLLFPPGQLALAALRRSNEVHKVL  307

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
            +F+RYLE + ++Q   H+  +L+  L  I+S+++ L+ P AKD++H+DRKLK C +P L
Sbjct  308  DFKRYLESLCSQQNGAHTSHELTKCLSAIDSVVSTLKIPEAKDMRHVDRKLKFCRNPSL  366



>ref|XP_010546709.1| PREDICTED: cyclin-H1-1-like isoform X2 [Tarenaya hassleriana]
Length=327

 Score =   118 bits (295),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E F  A  +    LK + ++A  E D+ MLTDA LLFPPGQLAL ALR AN  +   
Sbjct  180  DDMEAFFQARDDEVQKLKDVLKAATAETDKIMLTDAPLLFPPGQLALAALRMANGIVGAV  239

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
             F+RYLE I+AR    H++S+L+ LL  IESL+   + PS KD+KHI+RKLKSCL
Sbjct  240  YFDRYLENIVARPNSGHTVSELTNLLDAIESLVKNYKFPSEKDMKHINRKLKSCL  294



>ref|XP_010546708.1| PREDICTED: cyclin-H1-1-like isoform X1 [Tarenaya hassleriana]
Length=333

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E F  A  +    LK + ++A  E D+ MLTDA LLFPPGQLAL ALR AN  +   
Sbjct  186  DDMEAFFQARDDEVQKLKDVLKAATAETDKIMLTDAPLLFPPGQLALAALRMANGIVGAV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
             F+RYLE I+AR    H++S+L+ LL  IESL+   + PS KD+KHI+RKLKSCL
Sbjct  246  YFDRYLENIVARPNSGHTVSELTNLLDAIESLVKNYKFPSEKDMKHINRKLKSCL  300



>ref|XP_011036828.1| PREDICTED: cyclin-H1-1 isoform X2 [Populus euphratica]
 ref|XP_011036829.1| PREDICTED: cyclin-H1-1 isoform X2 [Populus euphratica]
Length=332

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -2

Query  913  DIEEFRGAEGEPPD-TLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            DIEEF      P D  ++KL E A  E D+ MLTDA +LFPPGQLAL AL+ ANE  RV 
Sbjct  189  DIEEF----CHPTDENIEKLKEIAVAEVDKIMLTDAPVLFPPGQLALAALQSANEVHRVL  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYLE +L+RQ   H IS++S  L  ++  + K   P+ KD+KHI+RKLKSC 
Sbjct  245  DFERYLESVLSRQNSAHMISEISESLHAVKKWVRKYSFPTDKDMKHINRKLKSCW  299



>gb|KJB45253.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=331

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 77/115 (67%), Gaps = 1/115 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FE Y E ILARQ   H+I  L   L  I++ + K + P+ KD+KHI+RKLKSC 
Sbjct  246  DFEGY-ELILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMKHINRKLKSCW  299



>gb|ABK96417.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 77/115 (67%), Gaps = 5/115 (4%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDT-LKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            DIEEF      P D  ++KL E A  E D+ MLTDA ++FPPGQLAL AL+ ANE  RV 
Sbjct  189  DIEEF----CHPTDEDIEKLKEIAVAEIDKIMLTDAPVMFPPGQLALAALQSANEVHRVL  244

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +FERYLE +L+RQ   H IS++S  L  +E  + K   P+ KD+KHI+RKLKSC 
Sbjct  245  DFERYLESVLSRQNSAHMISEISESLHAVEKWVKKYSFPTDKDMKHINRKLKSCW  299



>ref|XP_003550146.1| PREDICTED: cyclin-H1-1-like isoformX1 [Glycine max]
Length=335

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 77/115 (67%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A  +  + LK L E+A  E D+ MLTDA LLFPPGQLAL AL  +N   RV 
Sbjct  188  NDVEEFCNAGDDQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALSNSNALHRVI  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ YL  I + +   H++S+LS  L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  248  DFDSYLRGIFSHENSMHTMSELSESLNAIDSWVRKYKSPSEKELKHINRKLKSCW  302



>emb|CDY19728.1| BnaA09g03810D [Brassica napus]
Length=331

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  183  SNMEEFLQARDDEIQKLQSLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANGILGVV  242

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ SDL  LL  IESL+   + PS KD+KHI+RKLKSCL
Sbjct  243  DFDRYLENIVSQPNSEHTASDLLKLLDGIESLVKNYKYPSEKDMKHINRKLKSCL  297



>ref|XP_010421593.1| PREDICTED: cyclin-H1-1-like [Camelina sativa]
 ref|XP_010421594.1| PREDICTED: cyclin-H1-1-like [Camelina sativa]
Length=335

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            N++EEF     +    LK L E+A   AD+ +LTDA LLFPPGQLAL +L  AN  LRV 
Sbjct  186  NNMEEFLQVRDDEIQKLKSLLEAATAVADKVILTDAPLLFPPGQLALASLSIANGALRVI  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +F+RYLE I++++   H+ S+L+ LL  IE L+     P+ KD+KHI+RKLKSCL  G
Sbjct  246  DFDRYLENIVSQRNSEHTTSELTKLLDDIEYLVKNYNCPTDKDMKHINRKLKSCLGHG  303



>emb|CDX99977.1| BnaC09g03240D [Brassica napus]
Length=331

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +++EEF  A  +    L+ L ++A  EAD+ MLTDA LLF PGQLAL ALR AN  L V 
Sbjct  183  SNMEEFLQARDDEIQKLQSLLKAATAEADKVMLTDAPLLFSPGQLALAALRIANGVLGVI  242

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE IL++    H+ S+LS LL  IESL+   + PS KD+KHI+RKLKSCL
Sbjct  243  DFDRYLENILSQPNSEHTTSELSKLLDGIESLVKNYKYPSEKDMKHINRKLKSCL  297



>ref|XP_010455108.1| PREDICTED: cyclin-H1-1-like [Camelina sativa]
Length=335

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            N++EEF     +    LK L E+A   AD+ +LTDA LLFPPGQLAL +LR AN  LRV 
Sbjct  186  NNMEEFLQVRDDEIQKLKSLLEAATAVADKVILTDAPLLFPPGQLALASLRIANGALRVI  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ S+L+ LL  IE L+     P+ KD+KHI+RKLKSCL
Sbjct  246  DFDRYLENIVSQPNSEHTTSELTKLLDDIEYLVKNYNCPTDKDMKHINRKLKSCL  300



>ref|XP_009151194.1| PREDICTED: cyclin-H1-1-like [Brassica rapa]
Length=336

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
             ++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  188  GNMEEFLQARDDEIQKLEILLKAATGEADKVMLTDAPLLFPPGQLALAALRIANGVLGVV  247

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ S+L+ LL  IESL+ K + PS KD+KHI+RKLKSCL
Sbjct  248  DFDRYLENIVSQPNSEHTTSELTRLLDDIESLVKKYKYPSEKDMKHINRKLKSCL  302



>ref|NP_198114.2| cyclin H;1 [Arabidopsis thaliana]
 sp|Q8W5S1.1|CCH11_ARATH RecName: Full=Cyclin-H1-1; Short=CycH1;1 [Arabidopsis thaliana]
 dbj|BAB72144.1| cyclin H [Arabidopsis thaliana]
 dbj|BAC43301.1| putative cyclin H AtCycH1 [Arabidopsis thaliana]
 gb|AED93707.1| cyclin H;1 [Arabidopsis thaliana]
Length=336

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            N++EEF  A  +    L+ L + A  EAD+ MLTDA LLFPPGQLAL +LR AN  L V 
Sbjct  186  NNMEEFLQARDDEIQKLESLLKGATAEADKVMLTDAPLLFPPGQLALASLRIANGVLGVI  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ S+L+ LL  IE L+   + PS KD+KHI+RKLKSCL
Sbjct  246  DFDRYLENIVSQPNSEHTTSELTKLLDNIEYLVKNYKCPSEKDMKHINRKLKSCL  300



>ref|XP_002874361.1| CYCH_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50620.1| CYCH_1 [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            N++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL +LR AN  L V 
Sbjct  186  NNMEEFLQARDDQIQKLESLLKAATAEADKVMLTDAPLLFPPGQLALASLRIANGVLGVI  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ S+L+  L  IE L+   + PS KD+KHI+RKLKSCL
Sbjct  246  DFDRYLENIVSQPNSEHTTSELTKFLDDIEFLVKNYKKPSEKDMKHINRKLKSCL  300



>ref|XP_006433379.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 ref|XP_006433380.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 ref|XP_006472054.1| PREDICTED: cyclin-H1-1-like isoform X1 [Citrus sinensis]
 ref|XP_006472055.1| PREDICTED: cyclin-H1-1-like isoform X2 [Citrus sinensis]
 gb|ESR46619.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 gb|ESR46620.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
Length=337

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 79/124 (64%), Gaps = 6/124 (5%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQ------LALTALRRAN  755
            ND+E+F   +      LK L E+A +E D+ MLTDA LLFPPGQ      LAL ALR +N
Sbjct  188  NDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQVLSVIQLALAALRNSN  247

Query  754  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            +  RV ++E YL  IL+RQ   H ISDL+  L  I+S + K + PS KD+KHI+RKLKSC
Sbjct  248  KVQRVVDYESYLSSILSRQNSGHIISDLTENLDTIDSWVMKYKFPSEKDMKHINRKLKSC  307

Query  574  LDPG  563
               G
Sbjct  308  WGHG  311



>gb|AFK42904.1| unknown [Lotus japonicus]
Length=178

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A       LK L ++A +E  + MLTDA LLFPPGQLAL ALR +N   +V 
Sbjct  31   NDMEEFCNAGDAQLQMLKTLQDTAKLEVVKMMLTDAPLLFPPGQLALAALRNSNALHKVV  90

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +F+ YL  I  RQ   H++S+L      I+S + K ++PS K++KHI+RKLKSC   G
Sbjct  91   DFDSYLRSIFPRQNSMHTMSELIESFNAIDSWVRKYKTPSEKELKHINRKLKSCWGHG  148



>ref|XP_006288154.1| hypothetical protein CARUB_v10001393mg [Capsella rubella]
 gb|EOA21052.1| hypothetical protein CARUB_v10001393mg [Capsella rubella]
Length=334

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            N++EEF     +    L+ L ++A  EAD  MLTDA LLFPPGQLAL  LR AN  L V 
Sbjct  186  NNMEEFLQVRDDEMLKLENLLKAATAEADIVMLTDAPLLFPPGQLALACLRIANGALGVI  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE+I+++    H+IS+L+ LL  IE +I   + PS KD+KHI+RKLKSCL
Sbjct  246  DFDRYLEKIVSQPNSEHTISELTELLDNIEYMIKNYKKPSEKDMKHINRKLKSCL  300



>ref|XP_010674709.1| PREDICTED: cyclin-H1-1 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=328

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F  A     D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN++L V 
Sbjct  179  NDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKANDELLVL  238

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYLE IL+R    HSI +L+  L  I+ LI +++  + +++K + +KLKSC D G
Sbjct  239  DFERYLESILSRHHSAHSILELNQGLNAIDLLIKRIKISNDEEMKRVAKKLKSCQDTG  296



>gb|KDO56276.1| hypothetical protein CISIN_1g038028mg [Citrus sinensis]
Length=337

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 6/124 (5%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQ------LALTALRRAN  755
            ND+E+F   +      LK L E+A +E D+ MLTDA LLFPPGQ      LAL ALR +N
Sbjct  188  NDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQVLSVIQLALAALRNSN  247

Query  754  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            +  RV  +E YL  IL+RQ   H ISDL+  L  I+S + K + PS KD+KHI+RKLKSC
Sbjct  248  KVQRVVNYESYLSSILSRQNSGHIISDLTENLDTIDSWVMKYKFPSEKDMKHINRKLKSC  307

Query  574  LDPG  563
               G
Sbjct  308  WGHG  311



>ref|XP_010674708.1| PREDICTED: cyclin-H1-1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F  A     D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN++L V 
Sbjct  186  NDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKANDELLVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYLE IL+R    HSI +L+  L  I+ LI +++  + +++K + +KLKSC D G
Sbjct  246  DFERYLESILSRHHSAHSILELNQGLNAIDLLIKRIKISNDEEMKRVAKKLKSCQDTG  303



>ref|XP_010674706.1| PREDICTED: cyclin-H1-1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674707.1| PREDICTED: cyclin-H1-1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=335

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 81/118 (69%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F  A     D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN++L V 
Sbjct  186  NDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKANDELLVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYLE IL+R    HSI +L+  L  I+ LI +++  + +++K + +KLKSC D G
Sbjct  246  DFERYLESILSRHHSAHSILELNQGLNAIDLLIKRIKISNDEEMKRVAKKLKSCQDTG  303



>gb|ACF88227.1| unknown [Zea mays]
 tpg|DAA51219.1| TPA: cyclin-H isoform 1 [Zea mays]
 tpg|DAA51220.1| TPA: cyclin-H isoform 2 [Zea mays]
 tpg|DAA51221.1| TPA: cyclin-H isoform 3, partial [Zea mays]
Length=168

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  25   DDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  84

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYLE I +RQ     I      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  85   DFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  142



>ref|XP_010546710.1| PREDICTED: cyclin-H1-1-like isoform X3 [Tarenaya hassleriana]
Length=319

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -2

Query  901  FRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERY  722
            +R  EG   D ++ + ++A  E D+ MLTDA LLFPPGQLAL ALR AN  +    F+RY
Sbjct  178  YRAIEG-FVDDMEDVLKAATAETDKIMLTDAPLLFPPGQLALAALRMANGIVGAVYFDRY  236

Query  721  LERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            LE I+AR    H++S+L+ LL  IESL+   + PS KD+KHI+RKLKSCL
Sbjct  237  LENIVARPNSGHTVSELTNLLDAIESLVKNYKFPSEKDMKHINRKLKSCL  286



>emb|CDY05569.1| BnaA02g31220D [Brassica napus]
Length=331

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
             ++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  183  TNMEEFLQARDDEIQKLESLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANGVLGVV  242

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ S+L  LL  IE L+   + PS KD+KHI+RKLKSCL
Sbjct  243  DFDRYLENIVSQPNSEHTTSELLKLLDEIEYLVKNYKYPSEKDMKHINRKLKSCL  297



>gb|KCW58355.1| hypothetical protein EUGRSUZ_H01039 [Eucalyptus grandis]
Length=181

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLALTALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  64   ETAKEEVDKIMVTDAPLLFPPGQLALTALRHANEVHRVLDYERYLENMLLRQNSIHSSTE  123

Query  673  LSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            L   L  I+SL+   + PS KD+KHI+RKL+SC
Sbjct  124  LIQHLNAIDSLVRTYKFPSEKDMKHINRKLRSC  156



>ref|XP_006581842.1| PREDICTED: cyclin-H1-1 isoform X2 [Glycine max]
Length=343

 Score =   113 bits (282),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 78/123 (63%), Gaps = 8/123 (7%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLK--------KLXESAXIEADRTMLTDATLLFPPGQLALTALRR  761
            ND+EEF  A     + LK         L E+A  E D+ MLTDA LLFPPGQLAL ALR 
Sbjct  188  NDMEEFFNAGDNQLEMLKVLVILLFNTLQETARFEVDKMMLTDAPLLFPPGQLALAALRN  247

Query  760  ANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLK  581
            +N   RV +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++KHI+RKLK
Sbjct  248  SNAFHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELKHINRKLK  307

Query  580  SCL  572
            SC 
Sbjct  308  SCW  310



>emb|CDX86148.1| BnaA06g28650D [Brassica napus]
Length=326

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
             ++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  177  GNMEEFLQARDDEIQKLEILLKAATGEADKVMLTDAPLLFPPGQLALAALRIANGVLGVV  236

Query  736  EFER-YLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+R YLE I+++    H+ S+L+ LL  IESL+ K + PS KD+KHI+RKLKSCL
Sbjct  237  DFDRLYLENIVSQPNSEHTTSELTRLLDDIESLVKKYKYPSEKDMKHINRKLKSCL  292



>ref|XP_010043075.1| PREDICTED: cyclin-H1-1-like isoform X2 [Eucalyptus grandis]
 gb|KCW85106.1| hypothetical protein EUGRSUZ_B01941 [Eucalyptus grandis]
Length=320

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +DI +F  AE    D L+ L E+A  E D++MLTDA LLFPPGQLAL ALRRANE   V 
Sbjct  185  DDIGDFCHAED---DQLQLLKETAKEEVDKSMLTDAPLLFPPGQLALAALRRANEVHGVL  241

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+KHI+RKL+SC 
Sbjct  242  DYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMKHINRKLRSCW  296



>ref|XP_010043073.1| PREDICTED: cyclin-H1-1-like isoform X1 [Eucalyptus grandis]
 ref|XP_010043074.1| PREDICTED: cyclin-H1-1-like isoform X1 [Eucalyptus grandis]
Length=321

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +DI +F  AE    D L+ L E+A  E D++MLTDA LLFPPGQLAL ALRRANE   V 
Sbjct  186  DDIGDFCHAED---DQLQLLKETAKEEVDKSMLTDAPLLFPPGQLALAALRRANEVHGVL  242

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+KHI+RKL+SC 
Sbjct  243  DYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMKHINRKLRSCW  297



>gb|ACN31885.1| unknown [Zea mays]
Length=329

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYLE I +RQ     I      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  DFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>ref|NP_001149855.1| LOC100283483 [Zea mays]
 gb|ACG37017.1| cyclin-H [Zea mays]
Length=329

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            +FERYLE I +RQ     I      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  DFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>ref|XP_009129870.1| PREDICTED: cyclin-H1-1 [Brassica rapa]
Length=335

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (68%), Gaps = 0/115 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  187  SNMEEFLQARDDEIQKLESLLKAATAEADKFMLTDAPLLFPPGQLALAALRIANGVLGVV  246

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+RYLE I+++    H+ S+L  LL  IE  +   + PS KD+KHI+RKLKSCL
Sbjct  247  DFDRYLENIVSQPNSEHTTSELLKLLDEIEYRVKNYKYPSEKDMKHINRKLKSCL  301



>ref|XP_010042910.1| PREDICTED: cyclin-H1-1-like isoform X2 [Eucalyptus grandis]
 gb|KCW85019.1| hypothetical protein EUGRSUZ_B01853 [Eucalyptus grandis]
Length=320

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+ +F  AE    D L+ L E+A  E D++MLTDA LLFPPGQLAL ALRRANE   V 
Sbjct  185  DDLGDFCHAED---DQLQLLKETAKEEVDKSMLTDAPLLFPPGQLALAALRRANEVHGVL  241

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+KHI+RKL+SC 
Sbjct  242  DYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMKHINRKLRSCW  296



>ref|XP_010042901.1| PREDICTED: cyclin-H1-1-like isoform X1 [Eucalyptus grandis]
Length=321

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+ +F  AE    D L+ L E+A  E D++MLTDA LLFPPGQLAL ALRRANE   V 
Sbjct  186  DDLGDFCHAED---DQLQLLKETAKEEVDKSMLTDAPLLFPPGQLALAALRRANEVHGVL  242

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+KHI+RKL+SC 
Sbjct  243  DYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMKHINRKLRSCW  297



>ref|XP_010069853.1| PREDICTED: uncharacterized protein LOC104456698 isoform X1 [Eucalyptus 
grandis]
Length=288

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLALTALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  119  ETAKEEVDKIMVTDAPLLFPPGQLALTALRHANEVHRVLDYERYLENMLLRQNSIHSSTE  178

Query  673  LSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            L   L  I+SL+   + PS KD+KHI+RKL+SC
Sbjct  179  LIQHLNAIDSLVRTYKFPSEKDMKHINRKLRSC  211



>emb|CDI66532.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYLE I +RQ     +      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  NFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>emb|CDI66557.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYLE I +RQ     +      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  NFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>emb|CDI66493.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66498.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66571.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYLE I +RQ     +      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  NFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>emb|CDI66513.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66593.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYLE I +RQ     +      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  NFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>emb|CDY25030.1| BnaC02g39780D [Brassica napus]
Length=1285

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = -2

Query  916   NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
             +++EEF  A  +    L+ L ++A  EAD+ MLTDA LLFPPGQLAL ALR AN  L V 
Sbjct  1137  SNMEEFLQARDDEIQKLESLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANGVLEVV  1196

Query  736   EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
             +F+RYLE I+++    H+ S+L  LL  IE L+   + PS KD+KHI+RKLKSCL
Sbjct  1197  DFDRYLENIVSQPNSEHTTSELIKLLDEIEYLVKNYKYPSEKDMKHINRKLKSCL  1251



>ref|XP_006651796.1| PREDICTED: cyclin-H1-1-like [Oryza brachyantha]
Length=328

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 78/119 (66%), Gaps = 2/119 (2%)
 Frame = -2

Query  916  NDIEEF-RGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+E+F R   GE    LK+L ++A  + D+ MLTDA LL+ PGQLAL AL ++N+  R+
Sbjct  184  DDMEDFCRAGNGEH-QRLKELRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSNDMHRI  242

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
              FERYLE + +RQ     +    G +  I  L+++L+ P+ KD++HIDRKLK CLDP 
Sbjct  243  LSFERYLESVFSRQHSDCPVEQFVGSINMINYLVDQLKIPTPKDMRHIDRKLKHCLDPS  301



>ref|XP_009760267.1| PREDICTED: cyclin-H1-1-like isoform X2 [Nicotiana sylvestris]
Length=183

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDT-LKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEF GA+ +     LK   E+A +EAD+ M T+  LLFPPGQLAL AL RAN +  +
Sbjct  72   SDLEEFCGAKDDDQIVALKASLETARMEADKIMRTNGPLLFPPGQLALAALHRANTEHGI  131

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  602
            F+FERYL  +L+R  P H+IS+L+  +  I+SLI KL +P++KDV 
Sbjct  132  FDFERYLRSVLSRHHPAHTISELTASINAIDSLIGKLVTPTSKDVN  177



>ref|XP_002466497.1| hypothetical protein SORBIDRAFT_01g008760 [Sorghum bicolor]
 gb|EER93495.1| hypothetical protein SORBIDRAFT_01g008760 [Sorghum bicolor]
Length=318

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F      P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRVGNGPFQRLKELRQAAVSHVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYLE I +RQ     +      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  NFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDLRHVDRKLKHCWDPS  303



>ref|XP_004981844.1| PREDICTED: cyclin-H1-1-like isoform X1 [Setaria italica]
Length=324

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E F          LK+L ++A   AD+ MLTDA LL+ PGQLAL AL ++N+ LRVF
Sbjct  182  DDLEGFCRVGNGAVQHLKELHQTAMSHADKMMLTDAPLLYTPGQLALAALHKSNDILRVF  241

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLD  569
            +FERYLE I +RQ    ++      +  I  L+++L+ P+ KD++++DRKLK C D
Sbjct  242  DFERYLETIFSRQHSDCTVEQFVQSINAIHYLVDQLKIPTVKDMRYVDRKLKHCWD  297



>ref|XP_004302415.1| PREDICTED: cyclin-H1-1 [Fragaria vesca subsp. vesca]
Length=332

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+E+F G + E    L+ L ++A ++ D+ MLTD  L+FPPGQLAL ALR AN+  RV +
Sbjct  186  DMEDFCGLKDEQLPMLQNLRDAAKMDVDKIMLTDTPLMFPPGQLALAALRSANQVHRVVD  245

Query  733  FERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            F+RYL  +++R+   H+IS+L   L  I+  +++ + PS K++ HI+RKLKSC 
Sbjct  246  FDRYLGSMVSRKSSAHTISELVESLNAIDFWVSRYKFPSDKEILHINRKLKSCW  299



>emb|CDI66519.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66576.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66612.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FE YLE I +RQ     +      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  246  NFEGYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  303



>gb|KCW60766.1| hypothetical protein EUGRSUZ_H03488 [Eucalyptus grandis]
Length=181

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  64   ETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSSTE  123

Query  673  LSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            L   L  I+S +   + PS KD+KHI+R+L+SC
Sbjct  124  LIQHLNAIDSSVRTYKFPSEKDMKHINRELRSC  156



>ref|NP_001051203.1| Os03g0737600 [Oryza sativa Japonica Group]
 sp|Q10D80.1|CCH11_ORYSJ RecName: Full=Cyclin-H1-1; Short=CycH1;1; AltName: Full=Cyclin-H-1; 
Short=CycH-1 [Oryza sativa Japonica Group]
 dbj|BAB11694.1| cyclin H-1 [Oryza sativa]
 gb|ABF98764.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13117.1| Os03g0737600 [Oryza sativa Japonica Group]
 dbj|BAG95259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97262.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76145.1| hypothetical protein OsI_13435 [Oryza sativa Indica Group]
 gb|EEE59890.1| hypothetical protein OsJ_12494 [Oryza sativa Japonica Group]
Length=330

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -2

Query  916  NDIEEF-RGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+E+F R   GE    L+ L ++A  + D+ MLTDA LL+ PGQLAL AL ++N+  ++
Sbjct  186  DDMEDFCRAGNGEH-QRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSNDMHKI  244

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
              FERYLE + +RQ     I    G +  I  L+ +L+ P+ KD++HIDRKLK CLDP 
Sbjct  245  LNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMRHIDRKLKHCLDPS  303



>gb|AAR07076.1| cyclin H-1 [Oryza sativa Japonica Group]
Length=328

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = -2

Query  916  NDIEEF-RGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+E+F R   GE    L+ L ++A  + D+ MLTDA LL+ PGQLAL AL ++N+  ++
Sbjct  186  DDMEDFCRAGNGEH-QRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSNDMHKI  244

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
              FERYLE + +RQ     I    G +  I  L+ +L+ P+ KD++HIDRKLK CLDP 
Sbjct  245  LNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMRHIDRKLKHCLDPS  303



>ref|XP_009760266.1| PREDICTED: cyclin-H1-1-like isoform X1 [Nicotiana sylvestris]
Length=200

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 18/123 (15%)
 Frame = -2

Query  916  NDIEEFRGAEGE------------------PPDTLKKLXESAXIEADRTMLTDATLLFPP  791
            +D+EEF GA+ +                   P  +K   E+A +EAD+ M T+  LLFPP
Sbjct  72   SDLEEFCGAKDDDQIVALKISLLPLLLFLMVPQKIKASLETARMEADKIMRTNGPLLFPP  131

Query  790  GQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAK  611
            GQLAL AL RAN +  +F+FERYL  +L+R  P H+IS+L+  +  I+SLI KL +P++K
Sbjct  132  GQLALAALHRANTEHGIFDFERYLRSVLSRHHPAHTISELTASINAIDSLIGKLVTPTSK  191

Query  610  DVK  602
            DV 
Sbjct  192  DVN  194



>ref|XP_004496023.1| PREDICTED: cyclin-H1-1-like [Cicer arietinum]
Length=511

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 73/113 (65%), Gaps = 0/113 (0%)
 Frame = -2

Query  910  IEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEF  731
            ++EF  A  +   TLK L  +A +E D+ MLTD  LLFPPGQ+AL  LR +N    V +F
Sbjct  201  MKEFCNAGEDELQTLKALQNTATLEIDKMMLTDGPLLFPPGQMALAGLRTSNALHNVVDF  260

Query  730  ERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            + +L RIL+ Q   H++++L   L  I+S + K  SPS K++KHI+RKLKSC 
Sbjct  261  DSFLSRILSHQNSMHTMAELQESLDAIDSWVRKYRSPSEKELKHINRKLKSCW  313



>ref|XP_007219466.1| hypothetical protein PRUPE_ppa021360mg [Prunus persica]
 gb|EMJ20665.1| hypothetical protein PRUPE_ppa021360mg [Prunus persica]
Length=128

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -2

Query  841  IEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGL  662
            +E D+ MLTDA LLFPP QLAL ALR AN+  +V +FERYL    +RQ   H++S+L  L
Sbjct  1    MEVDKIMLTDAPLLFPPEQLALAALRSANQVHKVVDFERYLRSTPSRQSSEHTVSELVEL  60

Query  661  LKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            L  I+S   K + PS KD+KHI+RKLKSC 
Sbjct  61   LNAIDSWARKYKFPSDKDLKHINRKLKSCW  90



>gb|AES61374.2| cyclin H, putative [Medicago truncatula]
Length=331

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = -2

Query  868  LKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPT  689
             K L  +A +E D+ MLTD+ LLFPPGQLAL ALR +N    V +F+ +L RI + Q  T
Sbjct  204  FKALQNTARLEVDKMMLTDSPLLFPPGQLALAALRTSNALHTVVDFDSFLSRIFSHQNST  263

Query  688  HSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            H++++L   L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  264  HTMTELLESLDAIDSWVRKYKSPSEKELKHINRKLKSCW  302



>ref|XP_004507893.1| PREDICTED: cyclin-H1-1-like [Cicer arietinum]
Length=354

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            N +EE   A GE    +  L  +A +E D+ MLTDA LLFPPGQLAL ALR +N   +V 
Sbjct  239  NYMEELCNA-GEDKRQVLALQNTARLEVDKMMLTDAPLLFPPGQLALAALRNSNALHQVV  297

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+ +L R+ + Q  TH++++L   L  I+SL+ K  SPS K+++HI+ KLKSC 
Sbjct  298  DFDSFLSRVFSHQNSTHTMAELLESLDAIDSLVRKYRSPSEKELEHINGKLKSCW  352



>gb|AAU93531.1| cyclin H-1 [Zea mays]
Length=340

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = -2

Query  901  FRGAEGEPPD-TLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFER  725
            F G    P +    +L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV +FER
Sbjct  223  FVGQHSTPYNIAWVELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVVDFER  282

Query  724  YLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            YLE I +RQ     I      +  I  L+++L  P+ KD++H+DRKLK C DP 
Sbjct  283  YLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMRHVDRKLKHCWDPS  336



>ref|XP_010550979.1| PREDICTED: cyclin-H1-1-like [Tarenaya hassleriana]
Length=331

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFP-PGQLALTALRRANEKLRV  740
            ND+E F     +    LK + ++A  E D+ MLTDA  L P PG LAL ALR AN  +  
Sbjct  186  NDMEAFFQVRDDKVQKLKDVLKAATAETDKIMLTDAPPLSPWPGNLALAALRMANGIVGA  245

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
             +F+RYLE I+++ +  H+IS+L+ +L  IESL    + PS KD+KHI+RKLKSCL
Sbjct  246  VDFDRYLENIVSQPKSGHAISELTNVLNAIESLAKSYKFPSEKDMKHINRKLKSCL  301



>ref|XP_003591123.1| Cyclin-H1-1 [Medicago truncatula]
Length=501

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = -2

Query  868  LKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPT  689
             K L  +A +E D+ MLTD+ LLFPPGQLAL ALR +N    V +F+ +L RI + Q  T
Sbjct  215  FKALQNTARLEVDKMMLTDSPLLFPPGQLALAALRTSNALHTVVDFDSFLSRIFSHQNST  274

Query  688  HSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            H++++L   L  I+S + K +SPS K++KHI+RKLKSC 
Sbjct  275  HTMTELLESLDAIDSWVRKYKSPSEKELKHINRKLKSCW  313



>gb|AAP03415.1| cyclin H-1 [Oryza sativa Japonica Group]
Length=328

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = -2

Query  916  NDIEEF-RGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+E+F R   GE    L+ L ++A  + D+ MLTDA LL+ PGQLAL AL ++N+  ++
Sbjct  186  DDMEDFCRAGNGEH-QRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSNDMHKI  244

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
              FERYLE + +RQ     I    G +  I  L  +L+ P+ KD++HIDRKLK CLDP 
Sbjct  245  LNFERYLESVFSRQHSDCPIEQFVGSINMINYL--QLKIPTPKDMRHIDRKLKHCLDPS  301



>ref|XP_003560004.1| PREDICTED: cyclin-H1-1 isoform X2 [Brachypodium distachyon]
Length=328

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 72/118 (61%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D++ F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+  +V 
Sbjct  186  DDMDGFCKAGNGAHQRLKELHQTANSHVDKMMLTDAPLLYSPGQLALAALSKSNDMHQVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYL  + +RQ+    +      +  I  L+++L+ P+ KD++H DRKLK CLDP 
Sbjct  246  NFERYLGSVFSRQKSNCPVEQFVQTINAINYLVDQLQIPTLKDMRHADRKLKHCLDPS  303



>gb|EMT30492.1| hypothetical protein F775_06942 [Aegilops tauschii]
Length=269

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = -2

Query  901  FRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERY  722
            +R  EG   D +  L ++A  E D  MLTDA LL+ PGQLAL AL ++N  L V +FERY
Sbjct  100  YRSIEG-FIDDMDDLHQTANSEVDTMMLTDAPLLYTPGQLALAALYKSNSALSVLDFERY  158

Query  721  LERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
            LE + +RQ     +     ++  I  L+++L+ P  K+++H DRKLK CLDP 
Sbjct  159  LESVFSRQHFDCPVEQFIQIISSINHLVSQLQLPGTKEMRHADRKLKHCLDPS  211



>ref|XP_010230296.1| PREDICTED: cyclin-H1-1 isoform X1 [Brachypodium distachyon]
Length=335

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 72/118 (61%), Gaps = 0/118 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D++ F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+  +V 
Sbjct  190  DDMDGFCKAGNGAHQRLKELHQTANSHVDKMMLTDAPLLYSPGQLALAALSKSNDMHQVL  249

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPG  563
             FERYL  + +RQ+    +      +  I  L+++L+ P+ KD++H DRKLK CLDP 
Sbjct  250  NFERYLGSVFSRQKSNCPVEQFVQTINAINYLVDQLQIPTLKDMRHADRKLKHCLDPS  307



>ref|XP_010674710.1| PREDICTED: cyclin-H1-1 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=318

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+E+F  A     D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN++L V 
Sbjct  186  NDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKANDELLVL  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINK  632
            +FERYLE IL+R    HSI +L+  L  I+ L+ K
Sbjct  246  DFERYLESILSRHHSAHSILELNQGLNAIDLLLEK  280



>ref|XP_009620421.1| PREDICTED: cyclin-H1-1 isoform X3 [Nicotiana tomentosiformis]
Length=302

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 94/143 (66%), Gaps = 28/143 (20%)
 Frame = -2

Query  916  NDIEEFRGA-EGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRV  740
            +D+EEFRGA + +  +TLK                          LAL ALRRAN    +
Sbjct  186  SDMEEFRGANDDDQHETLK--------------------------LALAALRRANVVHDI  219

Query  739  FEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVKHIDRKLKSCLDPG  563
             +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVKHIDRKLKSCLDPG
Sbjct  220  LDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVKHIDRKLKSCLDPG  279

Query  562  LhdkskkrkhrskdsSNEVHDMA  494
             HDKSKKRKHRSK+SS EV D++
Sbjct  280  SHDKSKKRKHRSKESSTEVQDLS  302



>ref|XP_010026956.1| PREDICTED: uncharacterized protein LOC104417359 [Eucalyptus grandis]
Length=371

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  226  ETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSSTE  285

Query  673  LSGLLKPIESLINKLESPSAKDVKHIDRKL  584
            L   L  I+S +   + PS KD+KHI+R+L
Sbjct  286  LIQHLNAIDSSVRTYKFPSEKDMKHINREL  315



>ref|XP_009620423.1| PREDICTED: cyclin-H1-1 isoform X5 [Nicotiana tomentosiformis]
Length=279

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -2

Query  787  QLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAK  611
            +LAL ALRRAN    + +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++K
Sbjct  181  KLALAALRRANVVHDILDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSK  240

Query  610  DVKHIDRKLKSCLDPGLhdkskkrkhrskdsSNEVHDMA  494
            DVKHIDRKLKSCLDPG HDKSKKRKHRSK+SS EV D++
Sbjct  241  DVKHIDRKLKSCLDPGSHDKSKKRKHRSKESSTEVQDLS  279



>ref|XP_002984036.1| hypothetical protein SELMODRAFT_445744 [Selaginella moellendorffii]
 gb|EFJ15048.1| hypothetical protein SELMODRAFT_445744 [Selaginella moellendorffii]
Length=331

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = -2

Query  859  LXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSI  680
            L   A  + D  +LTD  LLFPPGQLAL ALR AN + R  + E+YL  +  RQQ  HS 
Sbjct  204  LQSEAIRKVDAMLLTDCPLLFPPGQLALAALRSANVQERAIDMEKYLRGVCERQQQKHSY  263

Query  679  SDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
            S+L G+L  I +L++   +P  ++V+ IDRKLK C +PGL
Sbjct  264  SELVGMLNQIAALVDAARTPIEEEVRRIDRKLKFCRNPGL  303



>ref|XP_006606942.1| PREDICTED: cyclin-H1-1-like [Glycine max]
Length=159

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 59/93 (63%), Gaps = 0/93 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A     + LK L E+A  E D+ MLTDA LLFPPGQLAL AL  +N   RV 
Sbjct  27   NDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALGNSNALHRVI  86

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLI  638
            +F+ YL  I +R+   H++S+LS  L  I+S +
Sbjct  87   DFDSYLRGIFSRENSMHTMSELSESLDAIDSWV  119



>ref|XP_009760268.1| PREDICTED: cyclin-H1-1-like isoform X3 [Nicotiana sylvestris]
Length=182

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 18/110 (16%)
 Frame = -2

Query  916  NDIEEFRGAEGE------------------PPDTLKKLXESAXIEADRTMLTDATLLFPP  791
            +D+EEF GA+ +                   P  +K   E+A +EAD+ M T+  LLFPP
Sbjct  72   SDLEEFCGAKDDDQIVALKISLLPLLLFLMVPQKIKASLETARMEADKIMRTNGPLLFPP  131

Query  790  GQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESL  641
            GQLAL AL RAN +  +F+FERYL  +L+R  P H+IS+L+  +  I+SL
Sbjct  132  GQLALAALHRANTEHGIFDFERYLRSVLSRHHPAHTISELTASINAIDSL  181



>ref|XP_010024316.1| PREDICTED: uncharacterized protein LOC104414824 isoform X3 [Eucalyptus 
grandis]
Length=395

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  128  ETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSSTE  187

Query  673  LSGLLKPIES  644
            L   L  I+S
Sbjct  188  LIQHLNAIDS  197



>ref|XP_010024315.1| PREDICTED: uncharacterized protein LOC104414824 isoform X2 [Eucalyptus 
grandis]
Length=482

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  226  ETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSSTE  285

Query  673  LSGLLKPIES  644
            L   L  I+S
Sbjct  286  LIQHLNAIDS  295



>ref|XP_010024314.1| PREDICTED: uncharacterized protein LOC104414824 isoform X1 [Eucalyptus 
grandis]
Length=493

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  853  ESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISD  674
            E+A  E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS ++
Sbjct  226  ETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSSTE  285

Query  673  LSGLLKPIES  644
            L   L  I+S
Sbjct  286  LIQHLNAIDS  295



>gb|KJB45254.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=256

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF G + +    LK L E+A +E D+ MLTDA  LFPPGQLAL ALR ANE  RV 
Sbjct  186  NDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNANEMHRVL  245

Query  736  EFERY  722
            +FE Y
Sbjct  246  DFEGY  250



>emb|CBB36490.1| Oryza sativa protein similar to cyclin H-1 AAP03415 [Saccharum 
hybrid cultivar R570]
Length=258

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  164  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVI  223

Query  736  EFERYLERILARQQ---PTHSISDLSGLL  659
             FERYLE I +RQ    P      L+ L+
Sbjct  224  NFERYLETIFSRQHSDCPVEQFVQLTSLI  252



>emb|CBB36468.1| Oryza sativa protein similar to cyclin H-1 AAP03415 [Saccharum 
hybrid cultivar R570]
Length=258

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  164  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  223

Query  736  EFERYLERILARQQ---PTHSISDLSGLL  659
             FERYLE I +RQ    P      L+ L+
Sbjct  224  NFERYLETIFSRQHSDCPVEQFVQLTSLI  252



>emb|CDI66546.1| Cyclin-H1-1, partial [Saccharum hybrid cultivar R570]
Length=277

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 60/96 (63%), Gaps = 4/96 (4%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+E+F  A   P   LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV 
Sbjct  186  DDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVV  245

Query  736  EFERYLERILARQQPTHSISDLSGLLKPIESLINKL  629
             FERYLE I +RQ   HS   +   ++ I + IN L
Sbjct  246  NFERYLETIFSRQ---HSDCPVEQFVQSINT-INYL  277



>emb|CDX80636.1| BnaC07g28080D [Brassica napus]
Length=337

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 72/116 (62%), Gaps = 4/116 (3%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
             ++EEF  A  +    L+ L ++A  EAD+ MLTDA L       AL ALR AN  L V 
Sbjct  192  GNMEEFLQARDDEIQKLESLLKAATGEADKVMLTDAPLA---FFFALAALRIANGVLGVV  248

Query  736  EFER-YLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCL  572
            +F+R YLE I+++    H+ S+L+ LL  IESL+     PS KD+KHI+RKLKSCL
Sbjct  249  DFDRLYLESIVSQPNSEHTTSELTRLLDDIESLVKSYRYPSEKDMKHINRKLKSCL  304



>gb|KCW59459.1| hypothetical protein EUGRSUZ_H02201, partial [Eucalyptus grandis]
Length=78

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  784  LALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDV  605
            LAL ALR ANE  RV ++ERYLE +L RQ   HS ++L   L  I+S +   + PS KD+
Sbjct  1    LALAALRHANEVHRVVDYERYLENMLIRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDM  60

Query  604  KHIDRKLKSC  575
            KHI+RKL+SC
Sbjct  61   KHINRKLRSC  70



>ref|XP_001779669.1| predicted protein [Physcomitrella patens]
 gb|EDQ55465.1| predicted protein [Physcomitrella patens]
Length=308

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 1/92 (1%)
 Frame = -2

Query  835  ADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLK  656
             D  MLTDA LL+PPGQLAL ALR AN++ +V + + YL+ +   +    S ++L   L 
Sbjct  204  VDNMMLTDAPLLYPPGQLALAALRIANQEPKV-DLDGYLQALPEHKSLQQSYAELIAKLD  262

Query  655  PIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             I+ L+   + P   +V+HIDRKLK C +P L
Sbjct  263  AIQFLVKGTKQPVEAEVRHIDRKLKYCRNPSL  294



>ref|XP_002960101.1| hypothetical protein SELMODRAFT_163567 [Selaginella moellendorffii]
 gb|EFJ37640.1| hypothetical protein SELMODRAFT_163567 [Selaginella moellendorffii]
Length=293

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  859  LXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSI  680
            L   A  + D  +LTD  LLFPPGQLAL ALR AN + R  + E+YL  +  RQQ  HS 
Sbjct  204  LQSEAIRKVDTMLLTDCPLLFPPGQLALAALRSANVQERAIDMEKYLRGVCERQQQKHSY  263

Query  679  SDLSGLLKPIESL  641
            S+L G+L  I +L
Sbjct  264  SELVGMLNQIAAL  276



>ref|XP_007144723.1| hypothetical protein PHAVU_007G1793000g, partial [Phaseolus vulgaris]
 gb|ESW16717.1| hypothetical protein PHAVU_007G1793000g, partial [Phaseolus vulgaris]
Length=250

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 0/63 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            ND+EEF  A  +    LK L E+A +E D+ MLTDA LLFPPGQLAL AL  +N   +V 
Sbjct  188  NDMEEFCNAGDDQLQMLKTLQETARLEVDKMMLTDAPLLFPPGQLALAALGNSNALHKVV  247

Query  736  EFE  728
            +F+
Sbjct  248  DFD  250



>ref|XP_003078137.1| Cyclin H (IC) [Ostreococcus tauri]
 gb|AAV68602.1| cyclin H [Ostreococcus tauri]
 emb|CAL52877.1| Cyclin C [Ostreococcus tauri]
Length=322

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -2

Query  913  DIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  734
            D+E+  G +G     L +  + A    DR MLTDA L+ PPGQ+AL ALRRA  +    E
Sbjct  168  DVEDG-GCKGATSKQLIECRKKALDIVDRLMLTDAPLIRPPGQIALCALRRAARECGASE  226

Query  733  FERYLERILARQQPTH-SISDLSGLLKPIESLINKLESPSAKDVKHIDRKLK  581
             E+Y E + AR        + L  +L  IES +++   P A  VK ID+KLK
Sbjct  227  LEKYCEDVGARGTTKAPRGAKLKEILDDIESHVDEGVEPDAAVVKEIDKKLK  278



>ref|XP_008235971.1| PREDICTED: cyclin-H1-1-like [Prunus mume]
Length=255

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -2

Query  916  NDIEEFRGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            +D+ EF     +    L+KL   A +E D+ MLTDA LLFPPGQLAL ALR AN+  +V 
Sbjct  184  DDMGEFCAINDDRLQILQKLLHGAKMEVDKIMLTDAPLLFPPGQLALAALRSANQVHKVV  243

Query  736  E  734
            E
Sbjct  244  E  244



>ref|XP_007436277.1| PREDICTED: cyclin-H isoform X3 [Python bivittatus]
Length=247

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+TL+K   +A    +R  LTDA LLF P Q+ALTAL  +  +   F  E YL   L 
Sbjct  108  ENPETLRK---TADDFLNRVSLTDACLLFTPSQIALTALVSSASRAG-FNMESYLSGSLM  163

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   ++S L   +K +++L+ K E P +++V  + +KL+ C  P L
Sbjct  164  LKENKTTLSQLLDGMKCMKNLVKKYELPHSEEVAGLKQKLEKCHSPEL  211



>ref|XP_007436275.1| PREDICTED: cyclin-H isoform X1 [Python bivittatus]
Length=321

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+TL+K   +A    +R  LTDA LLF P Q+ALTAL  +  +   F  E YL   L 
Sbjct  182  ENPETLRK---TADDFLNRVSLTDACLLFTPSQIALTALVSSASRAG-FNMESYLSGSLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   ++S L   +K +++L+ K E P +++V  + +KL+ C  P L
Sbjct  238  LKENKTTLSQLLDGMKCMKNLVKKYELPHSEEVAGLKQKLEKCHSPEL  285



>ref|XP_007436276.1| PREDICTED: cyclin-H isoform X2 [Python bivittatus]
Length=304

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+TL+K   +A    +R  LTDA LLF P Q+ALTAL  +  +   F  E YL   L 
Sbjct  165  ENPETLRK---TADDFLNRVSLTDACLLFTPSQIALTALVSSASRAG-FNMESYLSGSLM  220

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   ++S L   +K +++L+ K E P +++V  + +KL+ C  P L
Sbjct  221  LKENKTTLSQLLDGMKCMKNLVKKYELPHSEEVAGLKQKLEKCHSPEL  268



>ref|XP_009605486.1| PREDICTED: cyclin-H1-1-like isoform X1 [Nicotiana tomentosiformis]
Length=219

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 41/72 (57%), Gaps = 18/72 (25%)
 Frame = -2

Query  916  NDIEEFRGAEGE------------------PPDTLKKLXESAXIEADRTMLTDATLLFPP  791
            +D+EEF GA+ +                   P T+K   E+A +EAD+ M T+  LLFPP
Sbjct  133  SDLEEFCGAKDDDQIVALKISLLPLLLFLMVPQTIKASLETARMEADKIMRTNGPLLFPP  192

Query  790  GQLALTALRRAN  755
            GQLAL ALRRAN
Sbjct  193  GQLALAALRRAN  204



>ref|XP_003747552.1| PREDICTED: cyclin-H-like [Metaseiulus occidentalis]
Length=316

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = -2

Query  832  DRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKP  653
            DR +LTDA+LLF P QLA+ A+  A  K   F+   YL  IL +  P   ++    + K 
Sbjct  197  DRMLLTDASLLFAPSQLAMAAIVYAVNKAH-FDSNEYLN-ILFQDAPPDKLTHARRICKE  254

Query  652  IESLINKLESPSAKDVKHIDRKLKSC  575
            +  +I  +E P+ + VK I++KL+ C
Sbjct  255  MHQMIKAIEMPAKEQVKQIEKKLEKC  280



>gb|ETE70238.1| Cyclin-H, partial [Ophiophagus hannah]
Length=280

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+TL+K   +A    +R  LTDA LLF P Q+ALTA+  +  +   F  E YL   L 
Sbjct  141  ENPETLRK---TADDFLNRISLTDACLLFTPSQIALTAMVSSASRAG-FNMESYLSGTLM  196

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDP  566
             +    S+S L   +K +++L+ K E P  ++V  + +KL+ C  P
Sbjct  197  FKDNKASLSQLLDGMKCMKNLVKKYELPHPEEVAVLKQKLEKCHSP  242



>ref|XP_005651240.1| cyclin-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26696.1| cyclin-like protein [Coccomyxa subellipsoidea C-169]
Length=376

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (55%), Gaps = 10/108 (9%)
 Frame = -2

Query  874  DTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILAR-Q  698
            DTL +   +A    D  MLTDA LLFPPGQLAL A+R    K++V     +L R+  R Q
Sbjct  205  DTLAQARAAARAAVDALMLTDAPLLFPPGQLALAAMRSGCNKVKV-PLGSFLSRVAGRAQ  263

Query  697  QPTHSISDLSGLLKPIESLINKLES--------PSAKDVKHIDRKLKS  578
            +   +      +++ ++S   +++S          A++V+ IDR+LK+
Sbjct  264  EEARAGCSTEDIVQELKSAFGRIDSFGSEGSQQVKAEEVRKIDRRLKA  311



>ref|XP_006007316.1| PREDICTED: cyclin-H [Latimeria chalumnae]
Length=239

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---TADDFLNRVALTDACLLFTPSQIALTAILSSASRAGI-NMESYLTECLL  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             +    ++S L   ++ I++L+ K +SP  +++  I +KL+ C
Sbjct  154  LKDNREALSQLFDAMRCIKNLVKKYDSPKVEEINVIKQKLERC  196



>ref|XP_007144722.1| hypothetical protein PHAVU_007G1793001g, partial [Phaseolus vulgaris]
 gb|ESW16716.1| hypothetical protein PHAVU_007G1793001g, partial [Phaseolus vulgaris]
Length=84

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  724  YLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            YL  IL+RQ   H++++L   L  I+S + K + PS K++KHI+RKLKSC
Sbjct  1    YLGSILSRQNSMHTMAELDESLHAIDSCVKKYKIPSEKELKHINRKLKSC  50



>ref|XP_006023909.1| PREDICTED: cyclin-H, partial [Alligator sinensis]
Length=254

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  115  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSASRAGI-NMESYLSENLM  170

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  +DV  + +KL+ C
Sbjct  171  LKENRSSLSKLLDGMKCMKNLIKKYEPPKPEDVAALKQKLEKC  213



>ref|XP_006266776.1| PREDICTED: cyclin-H [Alligator mississippiensis]
Length=349

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  210  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSASRAXI-NMESYLSESLM  265

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  +DV  + +KL+ C
Sbjct  266  LKENRSSLSKLLDGMKCMKNLIKKYEPPKPEDVAALKQKLEKC  308



>ref|XP_010203998.1| PREDICTED: cyclin-H, partial [Colius striatus]
Length=227

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  154  LKENRPSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  196



>gb|KFQ07173.1| Cyclin-H, partial [Haliaeetus albicilla]
Length=242

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  102  ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  158  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  200



>ref|XP_009921041.1| PREDICTED: cyclin-H isoform X2 [Haliaeetus albicilla]
Length=233

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  154  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  196



>ref|XP_001416639.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94932.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=256

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = -2

Query  832  DRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILAR-----QQPTHSISDLS  668
            D  MLTD  L+ PPGQ+AL ALRRA  +    +   Y E + AR     + P  ++  L 
Sbjct  142  DALMLTDVPLVRPPGQIALCALRRAARQAEATDLVEYCEAVGARATGIVKAPKGAL--LK  199

Query  667  GLLKPIESLINKLESPSAKDVKHIDRKLK  581
            G+L  IE+ +     P    VK ID+KLK
Sbjct  200  GILDEIETHVEDGTEPDEAVVKKIDKKLK  228



>gb|KGL94801.1| Cyclin-H, partial [Charadrius vociferus]
Length=283

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  144  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLT  199

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+++L   +K ++SLI K E P  ++V  + +KL+ C
Sbjct  200  LKEKRTSLTNLLDGMKCMKSLIKKYELPRPEEVAALKQKLEKC  242



>ref|XP_009885181.1| PREDICTED: cyclin-H [Charadrius vociferus]
Length=333

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  194  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLT  249

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+++L   +K ++SLI K E P  ++V  + +KL+ C
Sbjct  250  LKEKRTSLTNLLDGMKCMKSLIKKYELPRPEEVAALKQKLEKC  292



>ref|XP_009921040.1| PREDICTED: cyclin-H isoform X1 [Haliaeetus albicilla]
Length=240

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  154  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  196



>ref|XP_004335911.1| cyclin, Nterminal domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13898.1| cyclin, Nterminal domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=386

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 8/107 (7%)
 Frame = -2

Query  880  PPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERY--LERIL  707
            PP + +KL   A    +  ++TDA  L+PP QLAL ALR+A+E+      E Y   E + 
Sbjct  191  PPASPEKLQGRARRHINDLLITDAPFLYPPAQLALAALRKASEE------EGYPLAEYMH  244

Query  706  ARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDP  566
            +R         L   ++ I+  I +        VK IDRKLK CL+P
Sbjct  245  SRFHTNAGYDQLRLNVEAIQKYIMEGGQMDVSRVKKIDRKLKKCLNP  291



>ref|XP_009478986.1| PREDICTED: cyclin-H, partial [Pelecanus crispus]
Length=254

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  108  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  163

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+++L   +K +++LI K E P  ++V  I +KL+ C
Sbjct  164  LKEDRTSLANLLDGMKCMKNLIKKYELPRPEEVAAIKQKLEKC  206



>ref|XP_010576352.1| PREDICTED: cyclin-H isoform X4 [Haliaeetus leucocephalus]
Length=317

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  280



>ref|XP_008490370.1| PREDICTED: cyclin-H [Calypte anna]
Length=281

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 5/108 (5%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  141  ENPELLRK---AADDFLSRVALTDAYLLFTPSQIALTAIFSSGSRAGI-NMESYLSESLM  196

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++ T S+  L  ++K + +LI K E P  ++V  + +KL+ C  P L
Sbjct  197  TEEKT-SVDKLLDMMKCMRNLIKKYELPRPEEVTALKQKLEKCHSPEL  243



>ref|XP_010576350.1| PREDICTED: cyclin-H isoform X3 [Haliaeetus leucocephalus]
Length=323

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  280



>ref|NP_001159785.1| cyclin-H [Sus scrofa]
 ref|XP_005661601.1| PREDICTED: cyclin-H isoform X2 [Sus scrofa]
 dbj|BAI44108.1| cyclin H [Sus scrofa]
Length=323

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C  P L
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPEL  285



>ref|XP_010576348.1| PREDICTED: cyclin-H isoform X1 [Haliaeetus leucocephalus]
Length=348

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  280



>gb|KFQ50591.1| Cyclin-H, partial [Pelecanus crispus]
Length=273

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  144  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  199

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+++L   +K +++LI K E P  ++V  I +KL+ C
Sbjct  200  LKEDRTSLANLLDGMKCMKNLIKKYELPRPEEVAAIKQKLEKC  242



>ref|XP_010576349.1| PREDICTED: cyclin-H isoform X2 [Haliaeetus leucocephalus]
Length=324

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLFPP Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRK---AADDFLNRVALTDAYLLFPPSQIALTAILSSGSRAGI-NMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRISLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  280



>ref|XP_005288208.1| PREDICTED: cyclin-H isoform X3 [Chrysemys picta bellii]
Length=323

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   LA
Sbjct  182  ENPEVLRK---TADDFLSRIALTDAYLLFTPSQIALTAILSSASRAGI-NMESYLSECLA  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDGMKCMKNLIKKYEPPRPEEVAVLKQKLEKC  280



>ref|XP_005661600.1| PREDICTED: cyclin-H isoform X1 [Sus scrofa]
Length=328

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C  P L
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPEL  285



>ref|XP_008165695.1| PREDICTED: cyclin-H isoform X1 [Chrysemys picta bellii]
Length=337

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   LA
Sbjct  182  ENPEVLRK---TADDFLSRIALTDAYLLFTPSQIALTAILSSASRAGI-NMESYLSECLA  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDGMKCMKNLIKKYEPPRPEEVAVLKQKLEKC  280



>ref|XP_004703558.1| PREDICTED: cyclin-H-like [Echinops telfairi]
Length=323

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAYLLYTPSQIALTAILSSASRAGI-TLESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             +    S+S L  ++K + +L+ K E P +++V  + +KL+ C  P L
Sbjct  238  LKDNRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLERCHSPEL  285



>gb|AAD46521.1|AF154914_1 cyclin H [Rattus norvegicus]
Length=323

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L+
Sbjct  182  ENPEILRK---TADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLS  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
            R++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  RKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLERC  280



>ref|XP_005288207.1| PREDICTED: cyclin-H isoform X2 [Chrysemys picta bellii]
 ref|XP_008165696.1| PREDICTED: cyclin-H isoform X2 [Chrysemys picta bellii]
Length=328

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   LA
Sbjct  182  ENPEVLRK---TADDFLSRIALTDAYLLFTPSQIALTAILSSASRAGI-NMESYLSECLA  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDGMKCMKNLIKKYEPPRPEEVAVLKQKLEKC  280



>gb|EMP41150.1| Cyclin-H [Chelonia mydas]
Length=244

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  108  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSASRAGI-NMESYLSECLL  163

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  164  LKENRTSLSQLLDGMKCMKNLIKKYEPPRPEEVAALKQKLEKC  206



>ref|XP_009506738.1| PREDICTED: cyclin-H [Phalacrocorax carbo]
Length=250

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  108  ENPEVLRK---AADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NLESYLSESLM  163

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L  ++K +++LI K E P  ++V  + +KL+ C
Sbjct  164  LKEDKISLAKLLEIMKSMKNLIKKYELPRPEEVAVLKQKLEKC  206



>ref|XP_006132433.1| PREDICTED: cyclin-H [Pelodiscus sinensis]
Length=363

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  222  ENPEVLRK---AADDFLNRVALTDAYLLFTPSQIALTAIVSSASRAGI-NMESYLSECLT  277

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  278  LKENRTSLSQLLDGMKCMKNLIKKYEPPRPEEVTVLKQKLEKC  320



>ref|XP_006197703.1| PREDICTED: cyclin-H [Vicugna pacos]
Length=291

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  V   E YL   L 
Sbjct  182  ENPEVLRK---TADDFLNRVALTDAPLLYTPSQIALTAILSSASRAGV-SMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  280



>ref|XP_009909870.1| PREDICTED: cyclin-H [Picoides pubescens]
Length=249

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   SA     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  108  ENPEVLRK---SADDFLTRVALTDAYLLFAPSQIALTAILSSASRAGI-NMESYLSETLM  163

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  164  MKEEKASLASLLENMKCMKNLIKKYELPRPEEVAALKQKLEKC  206



>gb|KFW93046.1| Cyclin-H, partial [Phalacrocorax carbo]
Length=284

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  144  ENPEVLRK---AADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NLESYLSESLM  199

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L  ++K +++LI K E P  ++V  + +KL+ C
Sbjct  200  LKEDKISLAKLLEIMKSMKNLIKKYELPRPEEVAVLKQKLEKC  242



>ref|XP_005430313.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-H [Geospiza fortis]
Length=322

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  K  +   E YL   L 
Sbjct  179  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSKAGI-NMESYLSESLM  234

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   ++S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  235  LKEDRSTLSRLLDEMKCMKNLIKKYELPRPEEVAALKQKLEKC  277



>ref|XP_003899955.1| PREDICTED: cyclin-H isoform X2 [Papio anubis]
 ref|XP_009206996.1| PREDICTED: cyclin-H isoform X2 [Papio anubis]
Length=323

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C  P L
Sbjct  238  LRENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPEL  285



>ref|XP_006167867.1| PREDICTED: cyclin-H-like isoform X2 [Tupaia chinensis]
Length=270

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P ++DV  + +KL+ C
Sbjct  185  LRENRTCLSQLLDIMKSMRNLVKKYEPPRSEDVTILKQKLERC  227



>ref|XP_007054155.1| PREDICTED: cyclin-H [Chelonia mydas]
Length=513

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  370  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSASRAGI-NMESYLSECLL  425

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  426  LKENRTSLSQLLDGMKCMKNLIKKYEPPRPEEVAALKQKLEKC  468



>ref|XP_009206995.1| PREDICTED: cyclin-H isoform X1 [Papio anubis]
Length=329

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C  P L
Sbjct  238  LRENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPEL  285



>ref|XP_005533098.1| PREDICTED: cyclin-H [Pseudopodoces humilis]
Length=325

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  V   E YL   L 
Sbjct  182  ENPEVLRK---AADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGV-NMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  238  LKENRSSLSRLLDDMKSMKNLIKKYELPRPEEVAALKQKLERC  280



>ref|XP_004375070.1| PREDICTED: cyclin-H [Trichechus manatus latirostris]
Length=144

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  3    ENPEILRK---TADDFLNRVALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  58

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  59   LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  101



>gb|KFQ22791.1| Cyclin-H, partial [Mesitornis unicolor]
Length=311

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+AL A+  +  ++ V   E YL   L 
Sbjct  182  ENPEGLRK---AADDFLNRVALTDAYLLFTPSQIALAAVLSSGSRVGV-NMESYLSESLT  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+++L   +K +++LI K E P  +++  + +KL+ C
Sbjct  238  LKEEGASLAELLECMKSMKNLIKKYELPKPEEIAALKQKLEKC  280



>gb|KFV19419.1| Cyclin-H, partial [Tauraco erythrolophus]
Length=231

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  102  ENPEVLRK---TADDFLNRVALTDAYLLFAPSQIALTAILSSGSRAGI-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  158  LKENRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  200



>gb|KFV63722.1| Cyclin-H, partial [Picoides pubescens]
Length=273

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   SA     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  144  ENPEVLRK---SADDFLTRVALTDAYLLFAPSQIALTAILSSASRAGI-NMESYLSETLM  199

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  200  MKEEKASLASLLENMKCMKNLIKKYELPRPEEVAALKQKLEKC  242



>ref|XP_010182595.1| PREDICTED: cyclin-H-like [Mesitornis unicolor]
Length=317

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+AL A+  +  ++ V   E YL   L 
Sbjct  182  ENPEGLRK---AADDFLNRVALTDAYLLFTPSQIALAAVLSSGSRVGV-NMESYLSESLT  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+++L   +K +++LI K E P  +++  + +KL+ C
Sbjct  238  LKEEGASLAELLECMKSMKNLIKKYELPKPEEIAALKQKLEKC  280



>ref|XP_006167866.1| PREDICTED: cyclin-H-like isoform X1 [Tupaia chinensis]
Length=323

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P ++DV  + +KL+ C
Sbjct  238  LRENRTCLSQLLDIMKSMRNLVKKYEPPRSEDVTILKQKLERC  280



>gb|KFV39824.1| Cyclin-H, partial [Gavia stellata]
Length=231

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  102  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  158  LKEDRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  200



>ref|XP_001510964.2| PREDICTED: cyclin-H [Ornithorhynchus anatinus]
Length=566

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  425  ENPEILRK---AADDFLNRVALTDAYLLFTPSQIALTAILSSASRAGI-TMESYLSESLM  480

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K +++L+ K ESP  ++V  + +KL+ C
Sbjct  481  LKENRTCMSQLLDVVKCMKNLVKKYESPKPEEVAVLKQKLERC  523



>gb|KFU89734.1| Cyclin-H, partial [Chaetura pelagica]
Length=262

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  122  ENPEVLRK---TADEFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMENYLAENLM  177

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  178  LKENRTSLTKLLDGMKCMKNLIKKYELPRPEEVTALKQKLEKC  220



>ref|XP_006188022.1| PREDICTED: cyclin-H isoform X2 [Camelus ferus]
Length=270

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K  +      +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEVLRKTTDDFL---NRVALTDAPLLYTPSQIALTAILSSASRAGI-SMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  185  LKENRISLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  227



>ref|XP_009639419.1| PREDICTED: cyclin-H, partial [Egretta garzetta]
Length=253

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  112  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  167

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  168  LKENRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  210



>ref|XP_010960711.1| PREDICTED: cyclin-H isoform X2 [Camelus bactrianus]
 ref|XP_010990792.1| PREDICTED: cyclin-H isoform X2 [Camelus dromedarius]
Length=323

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K  +      +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRKTTDDFL---NRVALTDAPLLYTPSQIALTAILSSASRAGI-SMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  LKENRISLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  280



>gb|KFP17934.1| Cyclin-H, partial [Egretta garzetta]
Length=245

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  116  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  171

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  172  LKENRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  214



>ref|XP_009986914.1| PREDICTED: cyclin-H [Tauraco erythrolophus]
Length=240

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---TADDFLNRVALTDAYLLFAPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  154  LKENRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  196



>ref|XP_010172276.1| PREDICTED: cyclin-H [Caprimulgus carolinensis]
Length=217

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 6/104 (6%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYL-ERIL  707
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL E ++
Sbjct  108  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSENLM  163

Query  706  ARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++  T  +  L G +K +++LI K E P  ++V  + +KL+ C
Sbjct  164  LKENRTSLVKLLDG-MKCMKNLIKKYELPRPEEVTALKQKLEKC  206



>ref|XP_010960710.1| PREDICTED: cyclin-H isoform X1 [Camelus bactrianus]
 ref|XP_010990791.1| PREDICTED: cyclin-H isoform X1 [Camelus dromedarius]
Length=328

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K  +      +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRKTTDDFL---NRVALTDAPLLYTPSQIALTAILSSASRAGI-SMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  LKENRISLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  280



>ref|XP_010960712.1| PREDICTED: cyclin-H isoform X3 [Camelus bactrianus]
 ref|XP_010990794.1| PREDICTED: cyclin-H isoform X3 [Camelus dromedarius]
Length=317

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K  +      +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEVLRKTTDDFL---NRVALTDAPLLYTPSQIALTAILSSASRAGI-SMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  LKENRISLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  280



>ref|XP_009996142.1| PREDICTED: cyclin-H [Chaetura pelagica]
Length=375

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  234  ENPEVLRK---TADEFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMENYLAENLM  289

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  290  LKENRTSLTKLLDGMKCMKNLIKKYELPRPEEVTALKQKLEKC  332



>ref|XP_009810013.1| PREDICTED: cyclin-H [Gavia stellata]
Length=240

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  154  LKEDRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  196



>ref|XP_006188021.1| PREDICTED: cyclin-H isoform X1 [Camelus ferus]
Length=288

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K  +      +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEVLRKTTDDFL---NRVALTDAPLLYTPSQIALTAILSSASRAGI-SMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  185  LKENRISLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  227



>ref|XP_010830200.1| PREDICTED: cyclin-H isoform X9 [Bison bison bison]
Length=268

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  108  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  163

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  164  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  206



>ref|XP_006080286.1| PREDICTED: cyclin-H isoform X3 [Bubalus bubalis]
Length=323

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>gb|KFP86075.1| Cyclin-H, partial [Acanthisitta chloris]
Length=241

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  V   E YL   L 
Sbjct  102  ENPEVLRK---TADDFLNRVGLTDAYLLFSPSQIALTAILSSGSRAGV-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   ++S L   +K +++LI K E P  ++   + +KL+ C
Sbjct  158  LKEKASTLSKLLDDMKCMKNLIKKYELPRPEEAAALKQKLEKC  200



>gb|KFQ90021.1| Cyclin-H, partial [Phoenicopterus ruber ruber]
Length=284

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  144  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  199

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  200  LKENRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  242



>ref|XP_009078568.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-H, partial [Acanthisitta 
chloris]
Length=242

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  V   E YL   L 
Sbjct  103  ENPEVLRK---TADDFLNRVGLTDAYLLFSPSQIALTAILSSGSRAGV-NMESYLSESLM  158

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   ++S L   +K +++LI K E P  ++   + +KL+ C
Sbjct  159  LKEKASTLSKLLDDMKCMKNLIKKYELPRPEEAAALKQKLEKC  201



>ref|XP_004009122.1| PREDICTED: cyclin-H isoform 1 [Ovis aries]
 ref|XP_005209794.1| PREDICTED: cyclin-H isoform X3 [Bos taurus]
 ref|XP_005683470.1| PREDICTED: cyclin-H isoform X3 [Capra hircus]
 ref|XP_005905880.1| PREDICTED: cyclin-H isoform X1 [Bos mutus]
 ref|XP_005974525.1| PREDICTED: cyclin-H isoform X2 [Pantholops hodgsonii]
 ref|XP_010830197.1| PREDICTED: cyclin-H isoform X6 [Bison bison bison]
Length=323

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_006080288.1| PREDICTED: cyclin-H isoform X5 [Bubalus bubalis]
Length=315

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_010150658.1| PREDICTED: cyclin-H [Eurypyga helias]
Length=241

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++L+ K E P  ++V  + +KL+ C
Sbjct  154  LKEKGTSLAKLLDGMKCMKNLLKKYELPRPEEVAALKQKLEKC  196



>ref|XP_005209795.1| PREDICTED: cyclin-H isoform X4 [Bos taurus]
 ref|XP_005683472.1| PREDICTED: cyclin-H isoform X5 [Capra hircus]
 ref|XP_010830199.1| PREDICTED: cyclin-H isoform X8 [Bison bison bison]
Length=315

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_006080287.1| PREDICTED: cyclin-H isoform X4 [Bubalus bubalis]
Length=320

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_005905881.1| PREDICTED: cyclin-H isoform X2 [Bos mutus]
 ref|XP_010830198.1| PREDICTED: cyclin-H isoform X7 [Bison bison bison]
 tpg|DAA27166.1| TPA: cyclin-H [Bos taurus]
Length=320

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|NP_001073256.1| cyclin-H [Bos taurus]
 sp|Q3ZBL9.1|CCNH_BOVIN RecName: Full=Cyclin-H [Bos taurus]
 gb|AAI03225.1| Cyclin H [Bos taurus]
Length=320

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_004009123.1| PREDICTED: cyclin-H isoform 2 [Ovis aries]
 ref|XP_005683471.1| PREDICTED: cyclin-H isoform X4 [Capra hircus]
 ref|XP_005974526.1| PREDICTED: cyclin-H isoform X3 [Pantholops hodgsonii]
Length=320

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_005683469.1| PREDICTED: cyclin-H isoform X2 [Capra hircus]
Length=328

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_001762420.1| predicted protein [Physcomitrella patens]
 gb|EDQ72887.1| predicted protein [Physcomitrella patens]
Length=245

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -2

Query  913  DIEEF-RGAEGEPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVF  737
            D+E F +G        L++L  +A    +  MLTDA LL+PPGQLAL ALR AN+     
Sbjct  177  DLETFVQGMGSTGLKALQELRVAAGSVVNNMMLTDAPLLYPPGQLALAALRIANQNQSKV  236

Query  736  EFERYL  719
            +F+ Y+
Sbjct  237  DFDWYI  242



>ref|XP_006080285.1| PREDICTED: cyclin-H isoform X2 [Bubalus bubalis]
Length=328

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_005209793.1| PREDICTED: cyclin-H isoform X2 [Bos taurus]
 ref|XP_010830196.1| PREDICTED: cyclin-H isoform X5 [Bison bison bison]
Length=328

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_009286535.1| PREDICTED: cyclin-H [Aptenodytes forsteri]
Length=239

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---TADDFLSRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  154  LKEDRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  196



>ref|XP_004640998.1| PREDICTED: cyclin-H [Octodon degus]
Length=323

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 60/104 (58%), Gaps = 6/104 (6%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYL-ERIL  707
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL E ++
Sbjct  182  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  706  ARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             R+  T  +S L  ++K + +L+ K E P A+++  + +KL+ C
Sbjct  238  VRENRT-CLSQLLDIMKSMRNLVKKYEPPRAEEIAVLKQKLERC  280



>gb|ELR49021.1| Cyclin-H, partial [Bos mutus]
Length=316

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_003216333.1| PREDICTED: cyclin-H [Anolis carolinensis]
Length=323

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (53%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+TL+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  184  ENPETLRK---AADDFLNRAALTDACLLYTPSQIALTAILSSASRAGI-NMESYLSESLM  239

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   S + L   +K ++ L+ K E P  + +  + +KL+ C  P L
Sbjct  240  LKENKASFTQLLDGMKCMKHLVKKYELPHPEKIPALKQKLEKCHSPEL  287



>gb|KFM13561.1| Cyclin-H, partial [Aptenodytes forsteri]
Length=242

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A     R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  102  ENPEVLRK---TADDFLSRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  158  LKEDRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  200



>ref|XP_010830193.1| PREDICTED: cyclin-H isoform X2 [Bison bison bison]
Length=340

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_010830194.1| PREDICTED: cyclin-H isoform X3 [Bison bison bison]
Length=337

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_007350373.1| cyclin-like protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD41505.1| cyclin-like protein [Auricularia delicata TFB-10046 SS5]
Length=358

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEAD---RTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLER  713
            +PP +   L ++  +  D   R+ LTD  LL+ P Q+AL  LRRA+ +L     +++L  
Sbjct  188  DPPPSQDALHDAHKVALDAIRRSRLTDVELLYTPSQIALACLRRADAQLA----QQWLMS  243

Query  712  ILARQQPTHSISDLSGLLKPIESLINK-LESPSAKDVKHIDRKLKSCLDP  566
              AR  P  S SDL+ +L  I   I+    SP  + V+ IDR+LK C +P
Sbjct  244  KAAR-DPAIS-SDLTSVLDSISFTIDADGASPPVEVVREIDRRLKLCKNP  291



>ref|XP_005618200.1| PREDICTED: cyclin-H isoform X2 [Canis lupus familiaris]
Length=275

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEMLRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  185  LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERC  227



>ref|NP_001186118.1| cyclin-H isoform 2 [Homo sapiens]
 ref|XP_004042299.1| PREDICTED: cyclin-H isoform 2 [Gorilla gorilla gorilla]
 ref|XP_008974617.1| PREDICTED: cyclin-H isoform X5 [Pan paniscus]
 gb|EAW95934.1| cyclin H, isoform CRA_a [Homo sapiens]
Length=270

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  185  LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  227



>gb|KFR11498.1| Cyclin-H, partial [Opisthocomus hoazin]
Length=231

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  102  ENPEVLRK---AADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   +++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  158  LKENRTTLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  200



>ref|XP_006080284.1| PREDICTED: cyclin-H isoform X1 [Bubalus bubalis]
Length=329

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_005683468.1| PREDICTED: cyclin-H isoform X1 [Capra hircus]
 ref|XP_005974524.1| PREDICTED: cyclin-H isoform X1 [Pantholops hodgsonii]
Length=329

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_005495402.1| PREDICTED: cyclin-H isoform X2 [Zonotrichia albicollis]
Length=332

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  189  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  244

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   ++S L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  245  LKEDRSTLSRLLDEMKCMKNLIKKYELPRPEEVAALKQKLEKC  287



>ref|XP_010830192.1| PREDICTED: cyclin-H isoform X1 [Bison bison bison]
Length=342

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_010116176.1| PREDICTED: cyclin-H [Chlamydotis macqueenii]
Length=240

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  98   ENPEVLRK---AADDFLNRVALTDAYLLFTPSQIALTAILSSGSRAGI-NMESYLSESLM  153

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S++ L   +K ++ LI K E P  ++V  + +KL+ C
Sbjct  154  LKEDRTSLAKLLDGMKCMKHLIKKYELPRPEEVAALKQKLEKC  196



>ref|XP_005209792.1| PREDICTED: cyclin-H isoform X1 [Bos taurus]
 ref|XP_010805903.1| PREDICTED: cyclin-H isoform X1 [Bos taurus]
 ref|XP_010805904.1| PREDICTED: cyclin-H isoform X1 [Bos taurus]
Length=329

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_005618199.1| PREDICTED: cyclin-H isoform X1 [Canis lupus familiaris]
Length=328

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEMLRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERC  280



>ref|XP_010830195.1| PREDICTED: cyclin-H isoform X4 [Bison bison bison]
Length=336

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAHLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++   S+S L  ++K + +L+ K E P  ++V  + +KL+ C
Sbjct  238  LKENRTSLSQLLDIMKSMRNLVKKYEPPRPEEVAALKQKLERC  280



>ref|XP_007941582.1| PREDICTED: cyclin-H [Orycteropus afer afer]
Length=323

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  182  ENPEILRK---TADDFLNRVALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  237

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  238  LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  280



>ref|XP_011376101.1| PREDICTED: cyclin-H isoform X2 [Pteropus vampyrus]
 ref|XP_011376109.1| PREDICTED: cyclin-H isoform X2 [Pteropus vampyrus]
Length=271

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  185  LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  227



>ref|XP_010081158.1| PREDICTED: cyclin-H, partial [Pterocles gutturalis]
Length=276

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +  +   E YL   L 
Sbjct  135  ENPEVLRK---TADDFLNRVALTDACLLFTPSQIALTAILTSGSRAGI-NMESYLSESLI  190

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             +    S++ L   +K +++LI K E P  ++V  + +KL+ C
Sbjct  191  LKDDRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKC  233



>gb|KFP78906.1| Cyclin-H, partial [Apaloderma vittatum]
Length=241

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (54%), Gaps = 4/108 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LLF P Q+AL A+  +  +  +   E YL   L 
Sbjct  102  ENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALAAILSSCSRAGI-NMESYLSESLM  157

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSCLDPGL  560
             ++   S++ L   +K +++LI K E P  ++V  + +KL+ C  P L
Sbjct  158  LKENRTSLAKLLDGMKCMKNLIKKYELPRPEEVAALKQKLEKCHRPEL  205



>ref|XP_009239158.1| PREDICTED: cyclin-H isoform X5 [Pongo abelii]
Length=270

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  129  ENPEILRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  184

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  185  LRENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  227



>ref|XP_011231158.1| PREDICTED: cyclin-H isoform X3 [Ailuropoda melanoleuca]
Length=287

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = -2

Query  883  EPPDTLKKLXESAXIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILA  704
            E P+ L+K   +A    +R  LTDA LL+ P Q+ALTA+  +  +  +   E YL   L 
Sbjct  141  ENPEMLRK---TADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGI-TMESYLSESLM  196

Query  703  RQQPTHSISDLSGLLKPIESLINKLESPSAKDVKHIDRKLKSC  575
             ++    +S L  ++K + +L+ K E P +++V  + +KL+ C
Sbjct  197  LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC  239



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2051875768020