BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045G24

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q03683.1|BIP3_TOBAC  RecName: Full=Luminal-binding protein 3; ...    214   3e-66   Nicotiana tabacum [American tobacco]
ref|XP_006286312.1|  hypothetical protein CARUB_v100065120mg            212   2e-65   
sp|Q03686.1|BIP8_TOBAC  RecName: Full=Luminal-binding protein 8; ...    216   2e-65   Nicotiana tabacum [American tobacco]
sp|Q03682.1|BIP2_TOBAC  RecName: Full=Luminal-binding protein 2; ...    216   2e-65   Nicotiana tabacum [American tobacco]
sp|Q03681.1|BIP1_TOBAC  RecName: Full=Luminal-binding protein 1; ...    215   4e-65   Nicotiana tabacum [American tobacco]
ref|XP_010445753.1|  PREDICTED: mediator of RNA polymerase II tra...    212   2e-64   
ref|XP_011084527.1|  PREDICTED: luminal-binding protein 5-like          221   7e-64   Sesamum indicum [beniseed]
gb|KHG19744.1|  Luminal-binding 5                                       215   7e-64   Gossypium arboreum [tree cotton]
gb|AAR23801.1|  putative luminal binding protein precursor              207   1e-63   Helianthus annuus
ref|XP_009592769.1|  PREDICTED: luminal-binding protein 5               219   4e-63   Nicotiana tomentosiformis
ref|XP_009773333.1|  PREDICTED: luminal-binding protein 5               219   5e-63   Nicotiana sylvestris
ref|XP_011075955.1|  PREDICTED: luminal-binding protein 5               219   6e-63   Sesamum indicum [beniseed]
ref|XP_006350519.1|  PREDICTED: luminal-binding protein 5-like          219   6e-63   Solanum tuberosum [potatoes]
gb|AAB57695.1|  HSP70-related protein                                   208   8e-63   Helianthus annuus
gb|AGS42239.1|  ER luminal-binding protein                              218   1e-62   Capsicum annuum
gb|KJB18917.1|  hypothetical protein B456_003G074600                    216   1e-62   Gossypium raimondii
gb|KDO76634.1|  hypothetical protein CISIN_1g0059551mg                  214   1e-62   Citrus sinensis [apfelsine]
ref|XP_008239207.1|  PREDICTED: luminal-binding protein 5               217   3e-62   Prunus mume [ume]
ref|XP_010671405.1|  PREDICTED: luminal-binding protein                 217   4e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004234985.1|  PREDICTED: luminal-binding protein 5               216   5e-62   Solanum lycopersicum
ref|XP_002303672.1|  BiP isoform A family protein                       216   5e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011022455.1|  PREDICTED: luminal-binding protein 5-like          216   9e-62   Populus euphratica
ref|XP_009593820.1|  PREDICTED: luminal-binding protein                 216   9e-62   Nicotiana tomentosiformis
gb|ACK55195.1|  ER luminal-binding protein                              215   1e-61   Nicotiana benthamiana
ref|XP_007211088.1|  hypothetical protein PRUPE_ppa002489mg             215   1e-61   Prunus persica
emb|CDP05035.1|  unnamed protein product                                215   1e-61   Coffea canephora [robusta coffee]
ref|XP_009802727.1|  PREDICTED: luminal-binding protein                 215   1e-61   Nicotiana sylvestris
gb|ACJ11746.1|  luminal binding protein                                 215   1e-61   Gossypium hirsutum [American cotton]
ref|XP_009788736.1|  PREDICTED: luminal-binding protein 4               215   1e-61   Nicotiana sylvestris
ref|XP_009588550.1|  PREDICTED: luminal-binding protein 4               215   1e-61   Nicotiana tomentosiformis
sp|Q03684.1|BIP4_TOBAC  RecName: Full=Luminal-binding protein 4; ...    215   1e-61   Nicotiana tabacum [American tobacco]
gb|KJB18907.1|  hypothetical protein B456_003G074600                    215   1e-61   Gossypium raimondii
ref|XP_002263323.1|  PREDICTED: luminal-binding protein 5               215   1e-61   Vitis vinifera
ref|XP_002299448.1|  BiP isoform A family protein                       214   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009358650.1|  PREDICTED: luminal-binding protein 5-like          214   2e-61   Pyrus x bretschneideri [bai li]
emb|CAC14168.1|  putative luminal binding protein                       214   2e-61   Corylus avellana [European hazelnut]
gb|KDP25255.1|  hypothetical protein JCGZ_20411                         214   2e-61   Jatropha curcas
gb|EYU25252.1|  hypothetical protein MIMGU_mgv1a002497mg                212   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_009102505.1|  PREDICTED: mediator of RNA polymerase II tra...    214   2e-61   
gb|KJB39580.1|  hypothetical protein B456_007G020300                    214   2e-61   Gossypium raimondii
gb|KJB39585.1|  hypothetical protein B456_007G020600                    212   2e-61   Gossypium raimondii
gb|KDO76633.1|  hypothetical protein CISIN_1g0059551mg                  213   3e-61   Citrus sinensis [apfelsine]
gb|EPS69483.1|  luminal-binding protein 5                               214   3e-61   Genlisea aurea
ref|XP_009125214.1|  PREDICTED: mediator of RNA polymerase II tra...    214   3e-61   Brassica rapa
ref|XP_009132761.1|  PREDICTED: mediator of RNA polymerase II tra...    214   3e-61   Brassica rapa
ref|XP_008437399.1|  PREDICTED: luminal-binding protein 5               214   3e-61   Cucumis melo [Oriental melon]
ref|XP_010430591.1|  PREDICTED: mediator of RNA polymerase II tra...    214   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010473721.1|  PREDICTED: mediator of RNA polymerase II tra...    214   3e-61   Camelina sativa [gold-of-pleasure]
sp|Q42434.1|BIP_SPIOL  RecName: Full=Luminal-binding protein; Sho...    214   3e-61   Spinacia oleracea
gb|AJF19166.1|  endoplasmic reticulum chaperone binding protein         214   4e-61   Lycium chinense [Chinese boxthorn]
ref|XP_002887878.1|  hypothetical protein ARALYDRAFT_892955             214   4e-61   Arabidopsis lyrata subsp. lyrata
gb|KDO76629.1|  hypothetical protein CISIN_1g0059551mg                  213   5e-61   Citrus sinensis [apfelsine]
ref|XP_009770477.1|  PREDICTED: luminal-binding protein 4-like          214   5e-61   Nicotiana sylvestris
ref|XP_010055986.1|  PREDICTED: luminal-binding protein                 214   5e-61   Eucalyptus grandis [rose gum]
ref|XP_008390320.1|  PREDICTED: luminal-binding protein 5               214   5e-61   Malus domestica [apple tree]
ref|XP_006439283.1|  hypothetical protein CICLE_v10019184mg             214   5e-61   Citrus clementina [clementine]
ref|XP_007040596.1|  Heat shock protein 70 (Hsp 70) family protein      213   5e-61   
ref|XP_010107258.1|  Luminal-binding protein 5                          213   5e-61   Morus notabilis
emb|CAB72128.1|  heat shock protein 70                                  213   5e-61   Cucumis sativus [cucumbers]
ref|XP_004143862.1|  PREDICTED: luminal-binding protein 5-like          213   6e-61   
ref|XP_006343810.1|  PREDICTED: luminal-binding protein-like            213   6e-61   Solanum tuberosum [potatoes]
ref|NP_001234636.1|  luminal-binding protein precursor                  213   7e-61   
ref|XP_006476337.1|  PREDICTED: luminal-binding protein 5-like          213   7e-61   Citrus sinensis [apfelsine]
ref|XP_010545034.1|  PREDICTED: luminal-binding protein 4               213   7e-61   Tarenaya hassleriana [spider flower]
ref|XP_009619852.1|  PREDICTED: luminal-binding protein 4-like          213   7e-61   Nicotiana tomentosiformis
gb|KCW72555.1|  hypothetical protein EUGRSUZ_E01024                     214   7e-61   Eucalyptus grandis [rose gum]
ref|XP_002317789.2|  BiP isoform A family protein                       213   8e-61   Populus trichocarpa [western balsam poplar]
gb|KFK32977.1|  hypothetical protein AALP_AA6G313600                    213   8e-61   Arabis alpina [alpine rockcress]
ref|XP_002518865.1|  heat shock protein, putative                       213   8e-61   Ricinus communis
gb|AAW55475.1|  ER-binding protein                                      213   9e-61   Malus pumila [paradise apple]
gb|KDP35832.1|  hypothetical protein JCGZ_10646                         213   9e-61   Jatropha curcas
emb|CDP12195.1|  unnamed protein product                                213   9e-61   Coffea canephora [robusta coffee]
gb|EYU19660.1|  hypothetical protein MIMGU_mgv1a002500mg                213   1e-60   Erythranthe guttata [common monkey flower]
ref|XP_010446984.1|  PREDICTED: mediator of RNA polymerase II tra...    213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010436161.1|  PREDICTED: mediator of RNA polymerase II tra...    213   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008337565.1|  PREDICTED: luminal-binding protein 5-like          213   1e-60   
emb|CDY13371.1|  BnaC06g13860D                                          213   1e-60   Brassica napus [oilseed rape]
gb|KHG03675.1|  Luminal-binding 5                                       212   1e-60   Gossypium arboreum [tree cotton]
ref|XP_006405286.1|  hypothetical protein EUTSA_v10027674mg             213   1e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006401475.1|  hypothetical protein EUTSA_v10012896mg             212   1e-60   Eutrema salsugineum [saltwater cress]
gb|AAZ95244.1|  putative luminal-binding protein                        212   1e-60   Isatis tinctoria [woad]
ref|XP_004300491.1|  PREDICTED: luminal-binding protein                 212   2e-60   Fragaria vesca subsp. vesca
gb|EYU25251.1|  hypothetical protein MIMGU_mgv1a002497mg                212   2e-60   Erythranthe guttata [common monkey flower]
gb|KHG09348.1|  Luminal-binding 5                                       212   3e-60   Gossypium arboreum [tree cotton]
ref|XP_011026831.1|  PREDICTED: luminal-binding protein 5               211   3e-60   Populus euphratica
gb|KJB39584.1|  hypothetical protein B456_007G020600                    211   3e-60   Gossypium raimondii
ref|XP_002276268.2|  PREDICTED: luminal-binding protein 5-like is...    211   3e-60   Vitis vinifera
ref|XP_002868566.1|  hypothetical protein ARALYDRAFT_493781             211   4e-60   
dbj|BAA13947.1|  luminal binding protein                                211   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198206.1|  Luminal-binding protein 1                             211   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010662895.1|  PREDICTED: luminal-binding protein 5-like is...    211   4e-60   Vitis vinifera
ref|XP_010266594.1|  PREDICTED: luminal-binding protein 5               211   5e-60   Nelumbo nucifera [Indian lotus]
ref|XP_004503579.1|  PREDICTED: luminal-binding protein-like            211   5e-60   Cicer arietinum [garbanzo]
gb|KHG04866.1|  Luminal-binding 5                                       211   6e-60   Gossypium arboreum [tree cotton]
ref|XP_010934830.1|  PREDICTED: luminal-binding protein 4               211   6e-60   Elaeis guineensis
dbj|BAA12348.1|  luminal binding protein (BiP)                          210   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851119.1|  Luminal-binding protein 2                             210   1e-59   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA13948.1|  luminal binding protein                                210   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918502.1|  PREDICTED: luminal-binding protein 4-like          209   2e-59   Elaeis guineensis
ref|XP_004503582.1|  PREDICTED: luminal-binding protein-like            209   2e-59   Cicer arietinum [garbanzo]
ref|XP_008796727.1|  PREDICTED: luminal-binding protein 5               209   3e-59   Phoenix dactylifera
gb|KHM99873.1|  Luminal-binding protein 5                               208   4e-59   Glycine soja [wild soybean]
ref|XP_003530453.1|  PREDICTED: luminal-binding protein 5               208   6e-59   Glycine max [soybeans]
gb|KFK32162.1|  hypothetical protein AALP_AA6G205800                    207   7e-59   Arabis alpina [alpine rockcress]
gb|AAA92743.1|  polypeptide chain-binding protein                       204   7e-59   Zea mays [maize]
ref|XP_009392825.1|  PREDICTED: luminal-binding protein 2               207   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN16716.1|  Luminal-binding protein 5                               207   1e-58   Glycine soja [wild soybean]
gb|ABK24469.1|  unknown                                                 201   2e-58   Picea sitchensis
gb|KJB24174.1|  hypothetical protein B456_004G131400                    206   2e-58   Gossypium raimondii
gb|KHG07305.1|  Luminal-binding 5                                       206   2e-58   Gossypium arboreum [tree cotton]
ref|NP_001105893.1|  luminal-binding protein 2 precursor                204   1e-57   
gb|AGT16206.1|  luminal-binding protein                                 204   1e-57   Saccharum hybrid cultivar R570
gb|AGT15890.1|  luminal-binding protein                                 204   1e-57   Saccharum hybrid cultivar R570
ref|NP_001105894.1|  luminal-binding protein 3 precursor                204   1e-57   Zea mays [maize]
gb|ACF86491.1|  unknown                                                 204   1e-57   Zea mays [maize]
gb|AGT16055.1|  luminal-binding protein 2 precursor                     204   1e-57   Saccharum hybrid cultivar R570
ref|XP_009418642.1|  PREDICTED: luminal-binding protein 2-like          203   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573226.1|  PREDICTED: luminal-binding protein 3               202   7e-57   Brachypodium distachyon [annual false brome]
ref|XP_004952156.1|  PREDICTED: luminal-binding protein 3-like          202   7e-57   Setaria italica
dbj|BAJ85675.1|  predicted protein                                      202   8e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGN94841.1|  ER molecular chaperone                                  202   9e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EMT16454.1|  Luminal-binding protein 4                               202   9e-57   
gb|AAB86942.1|  endoplasmic reticulum HSC70-cognate binding prote...    202   9e-57   Glycine max [soybeans]
ref|XP_009396163.1|  PREDICTED: luminal-binding protein 2-like          201   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006282977.1|  hypothetical protein CARUB_v100044650mg            188   3e-56   
ref|NP_001234941.1|  BiP isoform A                                      199   7e-56   
gb|EMS58484.1|  Luminal-binding protein 3                               199   1e-55   Triticum urartu
gb|ACH59039.1|  luminal binding protein                                 186   3e-55   Pseudotsuga menziesii
gb|ACH59061.1|  luminal binding protein                                 186   4e-55   Pseudotsuga menziesii
ref|XP_006827760.1|  hypothetical protein AMTR_s00009p00264000          197   5e-55   Amborella trichopoda
gb|ACH59062.1|  luminal binding protein                                 183   7e-54   Pseudotsuga macrocarpa
ref|XP_006838409.1|  hypothetical protein AMTR_s00002p00096860          192   3e-53   Amborella trichopoda
ref|XP_010105626.1|  Luminal-binding protein 5                          184   4e-53   
emb|CAC27138.1|  glucose regulated protein homolog 4 precursor          186   2e-52   Picea abies
gb|ACU23078.1|  unknown                                                 179   9e-52   Glycine max [soybeans]
ref|XP_010259649.1|  PREDICTED: luminal-binding protein 4-like          187   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002969949.1|  hypothetical protein SELMODRAFT_440900             187   3e-51   Selaginella moellendorffii
ref|XP_002981419.1|  hypothetical protein SELMODRAFT_444846             186   4e-51   Selaginella moellendorffii
ref|XP_010255192.1|  PREDICTED: LOW QUALITY PROTEIN: luminal-bind...    184   6e-51   Nelumbo nucifera [Indian lotus]
ref|XP_001774724.1|  predicted protein                                  185   1e-50   
gb|ABR18447.1|  unknown                                                 185   1e-50   Picea sitchensis
emb|CAA89834.2|  luminal binding protein                                185   1e-50   Pseudotsuga menziesii
ref|XP_008246412.1|  PREDICTED: luminal-binding protein 5               185   1e-50   Prunus mume [ume]
emb|CDP15491.1|  unnamed protein product                                184   2e-50   Coffea canephora [robusta coffee]
ref|XP_007206318.1|  hypothetical protein PRUPE_ppa002572mg             184   3e-50   
ref|XP_001780840.1|  predicted protein                                  184   3e-50   
ref|XP_004302398.1|  PREDICTED: luminal-binding protein 4               184   4e-50   Fragaria vesca subsp. vesca
ref|XP_008388543.1|  PREDICTED: luminal-binding protein 5-like          184   4e-50   
ref|XP_010108159.1|  Luminal-binding protein 5                          182   9e-50   
gb|KDP23486.1|  hypothetical protein JCGZ_23319                         182   9e-50   Jatropha curcas
ref|XP_007160200.1|  hypothetical protein PHAVU_002G301400g             182   2e-49   Phaseolus vulgaris [French bean]
gb|KHM99871.1|  Luminal-binding protein 4                               181   2e-49   Glycine soja [wild soybean]
gb|KJB81015.1|  hypothetical protein B456_013G125300                    181   2e-49   Gossypium raimondii
ref|XP_003525327.2|  PREDICTED: luminal-binding protein                 181   3e-49   
gb|KHN16714.1|  Luminal-binding protein 5                               181   3e-49   Glycine soja [wild soybean]
dbj|BAD95470.1|  BiP                                                    181   4e-49   Glycine max [soybeans]
gb|KEH21274.1|  heat shock 70 kDa protein                               181   4e-49   Medicago truncatula
gb|KEH21282.1|  heat shock cognate 70 kDa-like protein                  180   8e-49   Medicago truncatula
ref|XP_007030985.1|  Heat shock protein 70 (Hsp 70) family protein      179   1e-48   
ref|NP_001238736.1|  BiP isoform B precursor                            179   2e-48   
ref|XP_006648229.1|  PREDICTED: luminal-binding protein 2-like          178   5e-48   Oryza brachyantha
emb|CAC37635.1|  luminal binding protein, BiP                           177   6e-48   Scherffelia dubia
ref|XP_007509021.1|  Luminal binding heat shock protein 70              172   1e-47   Bathycoccus prasinos
ref|XP_006360204.1|  PREDICTED: LOW QUALITY PROTEIN: luminal-bind...    175   2e-47   
ref|XP_010674036.1|  PREDICTED: luminal-binding protein 5               176   2e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001290009.1|  mediator of RNA polymerase II transcription ...    176   3e-47   Vitis vinifera
ref|NP_001045675.1|  Os02g0115900                                       175   4e-47   
ref|XP_010659633.1|  PREDICTED: mediator of RNA polymerase II tra...    174   7e-47   
emb|CDY23972.1|  BnaC03g17190D                                          174   1e-46   Brassica napus [oilseed rape]
emb|CDY46766.1|  BnaA03g17100D                                          173   1e-46   Brassica napus [oilseed rape]
gb|AAB63469.1|  endosperm lumenal binding protein                       173   2e-46   Oryza sativa [red rice]
ref|XP_003074861.1|  Bip Luminal binding protein precursor, proba...    172   4e-46   
emb|CEG00952.1|  Heat shock protein 70 family                           172   4e-46   Ostreococcus tauri
emb|CDX77423.1|  BnaA07g05610D                                          172   5e-46   
emb|CDY63497.1|  BnaC07g48050D                                          172   5e-46   Brassica napus [oilseed rape]
emb|CDX79726.1|  BnaC03g20620D                                          172   6e-46   
ref|XP_009376693.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    171   8e-46   
ref|XP_005784200.1|  hypothetical protein EMIHUDRAFT_442092             170   3e-45   Emiliania huxleyi CCMP1516
gb|KDO56235.1|  hypothetical protein CISIN_1g006194mg                   169   4e-45   Citrus sinensis [apfelsine]
ref|XP_006433401.1|  hypothetical protein CICLE_v10000531mg             169   4e-45   Citrus clementina [clementine]
gb|AFC88846.1|  putative luminal binding protein 7B4                    169   6e-45   Tetragonia tetragonioides
ref|XP_010475731.1|  PREDICTED: probable mediator of RNA polymera...    169   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010475732.1|  PREDICTED: probable mediator of RNA polymera...    169   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010458176.1|  PREDICTED: probable mediator of RNA polymera...    167   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010458175.1|  PREDICTED: probable mediator of RNA polymera...    167   3e-44   
gb|KFK43207.1|  hypothetical protein AALP_AA1G094300                    166   5e-44   Arabis alpina [alpine rockcress]
gb|KFK43208.1|  hypothetical protein AALP_AA1G094300                    166   5e-44   Arabis alpina [alpine rockcress]
gb|AAB70400.1|  Similar to Arabidopsis luminal binding protein (g...    166   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172382.4|  protein BIP3                                          166   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184944.1|  protein BIP3                                       166   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005829514.1|  heat shock protein 70, ER luminal                  164   2e-43   Guillardia theta CCMP2712
ref|XP_006848066.1|  hypothetical protein AMTR_s00029p00199940          158   3e-43   
ref|XP_006480058.1|  PREDICTED: luminal-binding protein 5-like          164   3e-43   
emb|CBI23034.3|  unnamed protein product                                164   4e-43   Vitis vinifera
ref|XP_011092383.1|  PREDICTED: luminal-binding protein 5-like          164   5e-43   Sesamum indicum [beniseed]
ref|XP_006417615.1|  hypothetical protein EUTSA_v10009566mg             163   5e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006423186.1|  hypothetical protein CICLE_v10030032mg             163   6e-43   
ref|XP_002318993.2|  heat shock protein 70 cognate                      163   7e-43   
ref|XP_006306953.1|  hypothetical protein CARUB_v10008520mg             163   8e-43   Capsella rubella
ref|XP_006344666.1|  PREDICTED: mediator of RNA polymerase II tra...    162   2e-42   Solanum tuberosum [potatoes]
ref|XP_001416181.1|  Luminal binding protein precursor, probable        162   2e-42   Ostreococcus lucimarinus CCE9901
ref|XP_006480059.1|  PREDICTED: luminal-binding protein 5-like          160   4e-42   Citrus sinensis [apfelsine]
ref|XP_004230233.1|  PREDICTED: mediator of RNA polymerase II tra...    160   7e-42   Solanum lycopersicum
ref|XP_009622355.1|  PREDICTED: mediator of RNA polymerase II tra...    160   7e-42   Nicotiana tomentosiformis
gb|AAA80655.1|  BiP                                                     160   9e-42   Phaeodactylum tricornutum
ref|XP_002178567.1|  ER luminal binding protein precursor               160   1e-41   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_011023674.1|  PREDICTED: luminal-binding protein 4-like          160   1e-41   Populus euphratica
ref|XP_002892480.1|  hypothetical protein ARALYDRAFT_311954             160   1e-41   
ref|XP_010553728.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    160   1e-41   
ref|XP_006423179.1|  hypothetical protein CICLE_v10030400mg             159   1e-41   
ref|XP_009766974.1|  PREDICTED: luminal-binding protein 5-like          158   3e-41   Nicotiana sylvestris
ref|XP_005651681.1|  binding protein 1                                  158   5e-41   Coccomyxa subellipsoidea C-169
ref|XP_006645985.1|  PREDICTED: luminal-binding protein-like            157   1e-40   
ref|XP_002949576.1|  luminal binding protein Bip1                       157   1e-40   Volvox carteri f. nagariensis
ref|XP_002456746.1|  hypothetical protein SORBIDRAFT_03g041830          157   1e-40   Sorghum bicolor [broomcorn]
emb|CDX67525.1|  BnaA07g15650D                                          156   2e-40   
ref|XP_002507118.1|  heat shock binding protein 70, ER luminal          156   2e-40   Micromonas commoda
ref|XP_004971892.1|  PREDICTED: luminal-binding protein 3-like          156   2e-40   
ref|XP_006479343.1|  PREDICTED: luminal-binding protein 5-like          156   3e-40   Citrus sinensis [apfelsine]
ref|XP_006423175.1|  hypothetical protein CICLE_v10027975mg             156   3e-40   
gb|EMT08654.1|  Luminal-binding protein 5                               154   3e-40   
dbj|BAJ89190.1|  predicted protein                                      155   4e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC15519.1|  heat shock protein 70                                   155   4e-40   Toxoplasma gondii
ref|XP_003885152.1|  Heat shock protein 70 (Precursor), related         155   4e-40   Neospora caninum Liverpool
ref|XP_008885842.1|  chaperonin protein BiP                             155   5e-40   
ref|XP_002364404.1|  heat shock protein 70, putative                    155   5e-40   Toxoplasma gondii ME49
ref|XP_003055985.1|  luminal binding heat shock protein 70              155   5e-40   Micromonas pusilla CCMP1545
ref|XP_006423178.1|  hypothetical protein CICLE_v10029824mg             154   6e-40   
ref|XP_009118328.1|  PREDICTED: probable mediator of RNA polymera...    155   6e-40   Brassica rapa
emb|CDY22648.1|  BnaC08g42820D                                          154   1e-39   Brassica napus [oilseed rape]
ref|XP_001701685.1|  binding protein 1                                  154   1e-39   Chlamydomonas reinhardtii
gb|KCW44694.1|  hypothetical protein EUGRSUZ_L01770                     154   1e-39   Eucalyptus grandis [rose gum]
emb|CDY06347.1|  BnaA09g48560D                                          154   1e-39   
ref|XP_004971898.1|  PREDICTED: luminal-binding protein 3-like          154   2e-39   
ref|XP_010041040.1|  PREDICTED: luminal-binding protein 5-like          154   2e-39   Eucalyptus grandis [rose gum]
ref|XP_004964075.1|  PREDICTED: luminal-binding protein 3-like          154   2e-39   Setaria italica
gb|KCW61819.1|  hypothetical protein EUGRSUZ_H04513                     153   2e-39   Eucalyptus grandis [rose gum]
ref|XP_010027237.1|  PREDICTED: luminal-binding protein 5-like          153   2e-39   
ref|XP_002142079.1|  heat shock protein 70                              153   3e-39   Cryptosporidium muris RN66
gb|EEC83049.1|  hypothetical protein OsI_28153                          152   4e-39   Oryza sativa Indica Group [Indian rice]
gb|EAY91599.1|  hypothetical protein OsI_13234                          150   4e-39   Oryza sativa Indica Group [Indian rice]
gb|EWM22457.1|  luminal binding protein                                 152   5e-39   Nannochloropsis gaditana
ref|NP_001061194.1|  Os08g0197700                                       152   8e-39   
ref|XP_011088129.1|  PREDICTED: luminal-binding protein 5-like          151   9e-39   Sesamum indicum [beniseed]
gb|EMT02696.1|  Luminal-binding protein                                 151   9e-39   
gb|KDO35486.1|  luminal-binding protein 2                               151   1e-38   Saprolegnia parasitica CBS 223.65
ref|NP_001051048.1|  Os03g0710500                                       151   1e-38   
emb|CCI50234.1|  unnamed protein product                                151   2e-38   Albugo candida
gb|EEE59790.1|  hypothetical protein OsJ_12307                          151   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001701884.1|  binding protein 2                                  150   2e-38   Chlamydomonas reinhardtii
ref|XP_008873726.1|  luminal-binding protein 5                          150   3e-38   Aphanomyces invadans
emb|CDJ57867.1|  heat shock protein 70, putative                        149   5e-38   Eimeria maxima
ref|XP_002949720.1|  luminal binding protein Bip2                       151   6e-38   Volvox carteri f. nagariensis
dbj|BAD94482.1|  luminal binding protein                                140   7e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDI75449.1|  heat shock protein 70, putative                        148   7e-38   Eimeria praecox
emb|CAA47951.1|  glucose-regulated protein 78                           146   7e-38   Trypanosoma cruzi
ref|XP_006650483.1|  PREDICTED: luminal-binding protein 4-like          149   8e-38   Oryza brachyantha
prf||2114356A  75-77kD antigen                                          146   8e-38
emb|CDJ30684.1|  heat shock protein 70, putative                        148   8e-38   Eimeria mitis
gb|EEC79268.1|  hypothetical protein OsI_20053                          147   1e-37   Oryza sativa Indica Group [Indian rice]
emb|CDI83237.1|  heat shock protein 70, putative                        147   2e-37   Eimeria acervulina
emb|CDJ51855.1|  heat shock protein 70, putative                        148   3e-37   Eimeria brunetti
gb|EJK63068.1|  hypothetical protein THAOC_16293                        147   3e-37   Thalassiosira oceanica
ref|XP_006655245.1|  PREDICTED: luminal-binding protein 4-like          147   3e-37   Oryza brachyantha
gb|EYU18532.1|  hypothetical protein MIMGU_mgv1a022234mg                147   3e-37   Erythranthe guttata [common monkey flower]
gb|EEE63801.1|  hypothetical protein OsJ_18625                          147   4e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CCA24936.1|  luminalbinding protein 3 precursor putative            147   4e-37   Albugo laibachii Nc14
ref|XP_002288567.1|  heat shock protein/chaperone                       147   4e-37   Thalassiosira pseudonana CCMP1335
gb|AGC96524.1|  70kD heat shock protein                                 140   4e-37   Scylla paramamosain
ref|NP_001055613.1|  Os05g0428600                                       147   4e-37   
gb|AAA37742.1|  glucose-regulated protein 78                            139   5e-37   Mus musculus [mouse]
emb|CDJ37887.1|  heat shock protein 70, putative                        147   5e-37   Eimeria tenella
ref|XP_006846761.1|  hypothetical protein AMTR_s02709p00005830          143   5e-37   
emb|CDJ62290.1|  heat shock protein 70, putative                        147   6e-37   Eimeria necatrix
emb|CEI96781.1|  Putative Hsp70-like protein                            146   7e-37   Rhizopus microsporus
gb|ADV59560.1|  heat shock protein 70                                   146   8e-37   Paracyclopina nana
emb|CAA91253.1|  immunoglobulin heavy chain binding protein             147   8e-37   Eimeria tenella
emb|CAA53368.1|  glucose regulated protein/BiP                          145   8e-37   Phytophthora cinnamomi
gb|AAA62325.1|  HSP70                                                   145   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGE15504.1|  heat shock protein 70                                   145   1e-36   
gb|AFX84616.1|  heat shock protein 70 cognate                           145   1e-36   
gb|AAT80624.1|  heat shock protein 70                                   145   2e-36   
gb|AAT08757.1|  molecular chaperone BiP                                 137   2e-36   
gb|AFN08642.1|  glucose-regulated protein 78                            145   2e-36   
ref|XP_809817.1|  glucose-regulated protein 78                          145   2e-36   
gb|EKG01171.1|  glucose-regulated protein 78, putative                  145   2e-36   
gb|EKF29592.1|  glucose-regulated protein 78, putative                  145   2e-36   
gb|AAW63769.1|  PPAT5                                                   145   2e-36   
gb|KHJ78956.1|  DnaK family protein                                     139   2e-36   
gb|AAW63770.1|  PPAT5                                                   145   2e-36   
ref|XP_002466589.1|  hypothetical protein SORBIDRAFT_01g010460          145   2e-36   
emb|CEG66501.1|  Putative 70 kDa heat shock protein 3                   145   2e-36   
gb|ABK95666.1|  unknown                                                 135   2e-36   
gb|EPY35738.1|  heat shock protein 70                                   139   3e-36   
emb|CAA53369.1|  glucose regulated protein /BiP                         144   3e-36   
ref|XP_009529503.1|  hypothetical protein PHYSODRAFT_286376             144   3e-36   
gb|ABU41013.1|  heat shock protein 71                                   141   3e-36   
ref|XP_008901435.1|  luminal-binding protein                            144   3e-36   
emb|CBJ48460.1|  Molecular chaperones GRP78/BiP/KAR2, HSP70 super...    144   4e-36   
gb|EJY69686.1|  hypothetical protein OXYTRI_09575                       144   4e-36   
gb|ACR54099.1|  HSP70 form 4                                            135   4e-36   
dbj|BAJ98899.1|  predicted protein                                      142   5e-36   
gb|ABX89903.1|  inducible heat shock protein 70                         144   6e-36   
gb|ACS75352.1|  ER protein gp78                                         144   6e-36   
gb|AFQ62791.1|  Bip                                                     144   7e-36   
ref|XP_002909118.1|  luminal-binding protein 3 precursor                144   7e-36   
ref|XP_006644572.1|  PREDICTED: luminal-binding protein 5-like          143   9e-36   
ref|XP_004986284.1|  PREDICTED: luminal-binding protein 4-like          143   1e-35   
gb|ABM92447.1|  glucose-regulated protein 78                            143   1e-35   
ref|XP_011092073.1|  PREDICTED: luminal-binding protein 5-like          143   1e-35   
gb|AAQ24864.1|  heat shock protein 70                                   142   1e-35   
gb|ACH61066.1|  heat shock protein 70 kDa                               137   1e-35   
ref|XP_668366.1|  heat shock protein 70 precursor                       141   1e-35   
emb|CBH17746.1|  glucose-regulated protein 78, putative                 142   1e-35   
gb|EYC11428.1|  hypothetical protein Y032_0050g1907                     142   1e-35   
ref|NP_001183165.1|  uncharacterized protein LOC100501536               142   2e-35   
ref|XP_006219886.1|  PREDICTED: heat shock 70 kDa protein-like          140   2e-35   
gb|AAA82974.1|  HSP70b                                                  134   2e-35   
gb|ABG74706.1|  putative heat shock cognate 70 protein                  135   2e-35   
gb|EPY29304.1|  hypothetical protein STCU_04623                         137   2e-35   
ref|XP_004984743.1|  PREDICTED: heat shock cognate 70 kDa protein...    142   2e-35   
emb|CDJ02411.1|  Heat shock 70 kDa protein                              137   2e-35   
gb|ACU57188.1|  HSP 70                                                  137   2e-35   
ref|XP_004970526.1|  PREDICTED: probable mediator of RNA polymera...    142   2e-35   
ref|XP_008486521.1|  PREDICTED: heat shock 70 kDa protein cognate...    135   2e-35   
gb|ACH61090.1|  heat shock protein 70 kDa                               136   2e-35   
gb|EPY29430.1|  heat shock protein 70                                   137   2e-35   
emb|CCD14872.1|  unnamed protein product                                140   2e-35   
gb|AAS45710.1|  heat shock protein 70                                   142   2e-35   
gb|ABF85672.1|  70 kD heat shock protein                                142   2e-35   
gb|ADC91992.1|  heat shock protein 70                                   138   2e-35   
gb|AGM50430.1|  heat shock protein 70                                   142   3e-35   
gb|AIU40169.1|  heat shock protein 70                                   142   3e-35   
ref|XP_008674843.1|  PREDICTED: heat shock 70 kDa protein-like          142   3e-35   
gb|ACL30943.1|  70 kDa heat shock protein form 3                        142   3e-35   
gb|ABG45886.1|  heat shock cognate 70                                   142   3e-35   
gb|AAA28298.1|  heat shock protein 70                                   139   3e-35   
ref|XP_001783063.1|  predicted protein                                  135   3e-35   
gb|KFP48830.1|  78 kDa glucose-regulated protein                        140   3e-35   
gb|AIR72266.1|  Hsp70B                                                  142   3e-35   
emb|CEP13149.1|  hypothetical protein                                   142   3e-35   
gb|AAC37174.1|  BiP/GRP78                                               142   3e-35   
ref|XP_828833.1|  glucose-regulated protein 78                          141   4e-35   
gb|AFP99892.1|  glycoprotein 23 KDa                                     134   4e-35   
ref|XP_003911999.2|  PREDICTED: 78 kDa glucose-regulated protein        139   4e-35   
gb|AAA30201.1|  heat shock protein                                      141   4e-35   
gb|ACB11341.1|  heat shock protein 70                                   141   4e-35   
gb|ABG66420.1|  HSP70                                                   141   4e-35   
ref|XP_002456611.1|  hypothetical protein SORBIDRAFT_03g039360          141   4e-35   
gb|AIR72271.1|  Hsp70B                                                  141   4e-35   
emb|CDS25068.1|  Heat shock 70 kDa protein                              136   4e-35   
gb|ACB11340.1|  heat shock protein 70                                   141   4e-35   
ref|NP_001140835.1|  uncharacterized protein LOC100272911               140   5e-35   
gb|ABJ97377.1|  heat shock protein 70                                   141   5e-35   
gb|ABN12067.1|  putative heat shock cognate 70 protein                  139   5e-35   
gb|EFX81902.1|  hypothetical protein DAPPUDRAFT_302856                  141   5e-35   
gb|EAY89450.1|  hypothetical protein OsI_10982                          139   5e-35   
gb|KFV89508.1|  78 kDa glucose-regulated protein                        140   5e-35   
ref|XP_009585599.1|  PREDICTED: 78 kDa glucose-regulated protein        140   5e-35   
ref|XP_628228.1|  heat shock protein, Hsp70                             141   5e-35   
gb|ACA23466.1|  heat shock protein 70                                   133   6e-35   
gb|AHA36969.1|  heat shock protein 70b                                  141   6e-35   
ref|XP_009911291.1|  PREDICTED: 78 kDa glucose-regulated protein        140   6e-35   
ref|XP_009332629.1|  PREDICTED: 78 kDa glucose-regulated protein        140   6e-35   
ref|XP_008607422.1|  luminal-binding protein 1                          141   7e-35   
sp|P12794.1|GRP78_PLAFA  RecName: Full=78 kDa glucose-regulated p...    136   7e-35   
ref|XP_007061007.1|  PREDICTED: 78 kDa glucose-regulated protein        140   7e-35   
ref|XP_009308651.1|  putative glucose-regulated protein 78              140   7e-35   
ref|XP_004333159.1|  high molecular weight heat shock protein           140   8e-35   
gb|EMS65063.1|  Heat shock cognate 70 kDa protein                       140   8e-35   
ref|XP_002805956.1|  PREDICTED: heat shock cognate 70 kDa protein...    134   8e-35   
gb|ETN71512.1|  putative chaperone protein DnaK                         140   8e-35   
gb|KFD56098.1|  hypothetical protein M513_02876                         140   8e-35   
gb|AAA29501.1|  BiP                                                     136   8e-35   
gb|ESL08562.1|  glucose-regulated protein 78                            140   8e-35   
ref|XP_008658250.1|  PREDICTED: uncharacterized protein LOC100272...    140   9e-35   
dbj|GAN05474.1|  78 kDa glucose-regulated protein precursor             140   9e-35   
ref|XP_008473538.1|  PREDICTED: heat shock 70 kDa protein cognate...    135   9e-35   
gb|EPB86036.1|  glucose-regulated protein                               140   9e-35   
ref|XP_005024501.1|  PREDICTED: LOW QUALITY PROTEIN: 78 kDa gluco...    140   9e-35   
ref|NP_001049719.2|  Os03g0277300                                       138   1e-34   
gb|ENY63418.1|  heat shock protein 70, hsp70A2, putative                135   1e-34   
ref|XP_005851365.1|  hypothetical protein CHLNCDRAFT_18857              132   1e-34   
gb|AAA27857.1|  heat shock protein 70, hsp70A2                          137   1e-34   
gb|KFH63417.1|  heat shock protein HSS1                                 140   1e-34   
ref|XP_003558220.1|  PREDICTED: heat shock cognate 70 kDa protein...    140   1e-34   
gb|KFZ46593.1|  78 kDa glucose-regulated protein                        140   1e-34   
ref|XP_010163517.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
gb|EFX70674.1|  hypothetical protein DAPPUDRAFT_256736                  140   1e-34   
ref|XP_004307527.1|  PREDICTED: heat shock cognate 70 kDa protein 2     140   1e-34   
gb|KFQ85887.1|  78 kDa glucose-regulated protein                        139   1e-34   
gb|KFO82587.1|  78 kDa glucose-regulated protein                        140   1e-34   
gb|EIE83965.1|  heat shock 70 kDa protein                               140   1e-34   
ref|XP_009960006.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
gb|ADM94257.1|  heat shock protein 70                                   140   1e-34   
gb|KFV82722.1|  78 kDa glucose-regulated protein                        139   1e-34   
ref|XP_005513063.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
gb|EDL95234.1|  rCG57965, isoform CRA_c                                 133   1e-34   
ref|XP_006640761.1|  PREDICTED: 78 kDa glucose-regulated protein-...    140   1e-34   
ref|XP_006271368.1|  PREDICTED: 78 kDa glucose-regulated protein        140   1e-34   
ref|XP_009488320.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
ref|XP_009499023.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
gb|KFQ67680.1|  78 kDa glucose-regulated protein                        139   1e-34   
ref|XP_009707412.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
gb|KDO67650.1|  hypothetical protein CISIN_1g0212722mg                  133   1e-34   
ref|XP_009819573.1|  PREDICTED: 78 kDa glucose-regulated protein        139   1e-34   
gb|ACR77532.1|  70 kDa heat shock protein form 2                        139   1e-34   
gb|EAW87621.1|  heat shock 70kDa protein 5 (glucose-regulated pro...    138   1e-34   
gb|KFV14483.1|  78 kDa glucose-regulated protein                        139   1e-34   
gb|KFM61591.1|  glucose-regulated protein                               140   2e-34   
ref|XP_008944470.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
ref|XP_005437288.1|  PREDICTED: 78 kDa glucose-regulated protein        140   2e-34   
emb|CCD20294.1|  glucose-regulated protein 78, putative                 140   2e-34   
gb|EAY89457.1|  hypothetical protein OsI_10990                          138   2e-34   
gb|KFO99102.1|  78 kDa glucose-regulated protein                        139   2e-34   
ref|XP_001743240.1|  hypothetical protein                               140   2e-34   
ref|XP_005231480.1|  PREDICTED: 78 kDa glucose-regulated protein        140   2e-34   
gb|ENN75771.1|  hypothetical protein YQE_07729                          140   2e-34   
gb|AHF71091.1|  heat shock protein 70-A                                 140   2e-34   
gb|ERL92029.1|  hypothetical protein D910_09351                         140   2e-34   
gb|KFQ20529.1|  78 kDa glucose-regulated protein                        139   2e-34   
ref|XP_001748113.1|  hypothetical protein                               140   2e-34   
ref|XP_010122719.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
gb|AEP19214.1|  HSP70-1                                                 140   2e-34   
ref|XP_009675941.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
ref|XP_010080797.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
ref|XP_011480006.1|  PREDICTED: 78 kDa glucose-regulated protein ...    140   2e-34   
ref|NP_990822.1|  78 kDa glucose-regulated protein precursor            140   2e-34   
ref|XP_006017022.1|  PREDICTED: 78 kDa glucose-regulated protein        140   2e-34   
gb|AFW88810.1|  hypothetical protein ZEAMMB73_832667                    141   2e-34   
ref|XP_009068137.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
ref|NP_001265730.1|  78 kDa glucose-regulated protein precursor         140   2e-34   
gb|KFZ50485.1|  78 kDa glucose-regulated protein                        139   2e-34   
ref|XP_009278914.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
ref|XP_001927830.3|  PREDICTED: 78 kDa glucose-regulated protein        140   2e-34   
ref|XP_006649850.1|  PREDICTED: probable mediator of RNA polymera...    140   2e-34   
ref|XP_010569002.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
ref|XP_001424324.1|  hypothetical protein                               139   2e-34   
dbj|GAA41477.1|  heat shock 70kDa protein 1/8                           133   2e-34   
ref|XP_008489796.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
gb|KFM80380.1|  Heat shock protein cognate 4                            139   2e-34   
ref|XP_009567958.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
gb|EDL08617.1|  heat shock 70kD protein 5 (glucose-regulated prot...    138   2e-34   
emb|CDJ30335.1|  Heat shock 70 kDa protein-like, related                134   2e-34   
gb|AAL85887.1|AF479058_1  70 kDa heat shock protein                     136   2e-34   
ref|XP_009874470.1|  PREDICTED: 78 kDa glucose-regulated protein        139   2e-34   
gb|AFZ93094.1|  heat shock protein 70                                   139   2e-34   
ref|XP_003474008.1|  PREDICTED: heat shock 70 kDa protein 1-like        139   2e-34   
ref|NP_001049712.1|  Os03g0276500                                       139   2e-34   
emb|CDH60531.1|  glucose-regulated protein                              139   2e-34   
gb|AAD31042.1|AF144646_1  heat shock protein 70                         139   2e-34   
gb|EFZ12530.1|  hypothetical protein SINV_15088                         138   2e-34   
ref|XP_011493320.1|  AAEL017349-PA                                      139   2e-34   
ref|XP_006649853.1|  PREDICTED: heat shock cognate 70 kDa protein...    139   2e-34   
gb|EDL93171.1|  heat shock 70kDa protein 5 (glucose-regulated pro...    138   2e-34   
gb|EMP34580.1|  78 kDa glucose-regulated protein                        139   2e-34   
dbj|GAA52733.1|  heat shock 70kDa protein 1/8                           133   2e-34   
gb|AAN73310.1|  heat-shock protein 70                                   139   2e-34   
ref|XP_002588195.1|  hypothetical protein BRAFLDRAFT_113824             139   2e-34   
ref|XP_009475412.1|  PREDICTED: 78 kDa glucose-regulated protein        140   2e-34   
ref|XP_003558228.1|  PREDICTED: heat shock cognate 70 kDa protein...    139   2e-34   
gb|AAS57865.1|  70 kDa heat shock cognate protein                       139   3e-34   
ref|XP_011173246.1|  PREDICTED: heat shock 70 kDa protein cognate 4     139   3e-34   
ref|XP_008486283.1|  PREDICTED: heat shock 70 kDa protein cognate...    135   3e-34   
gb|AHE77386.1|  heat shock protein 70                                   139   3e-34   
ref|XP_001446455.1|  hypothetical protein                               139   3e-34   
emb|CDS07402.1|  Putative Glucose-regulated protein                     139   3e-34   
gb|AGI37646.1|  heat shock cognate 70-2 protein                         139   3e-34   
ref|XP_010150685.1|  PREDICTED: heat shock 70 kDa protein               139   3e-34   
ref|XP_001365714.1|  PREDICTED: 78 kDa glucose-regulated protein        139   3e-34   
ref|XP_010151515.1|  PREDICTED: 78 kDa glucose-regulated protein        138   3e-34   
ref|XP_004613383.1|  PREDICTED: 78 kDa glucose-regulated protein        139   3e-34   
gb|AGI36553.1|  heat shock cognate 70-2 protein                         139   3e-34   
gb|KFW06792.1|  78 kDa glucose-regulated protein                        138   3e-34   
ref|XP_008476889.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    139   3e-34   
emb|CAI39094.1|  ER-type hsp70                                          139   3e-34   
emb|CDQ79052.1|  unnamed protein product                                139   3e-34   
gb|AFN65688.1|  heat shock cognate protein 70                           139   3e-34   
gb|EMT17408.1|  Heat shock cognate 70 kDa protein                       139   3e-34   
ref|XP_009562682.1|  PREDICTED: heat shock-related 70 kDa protein 2     139   3e-34   
gb|KGL78068.1|  78 kDa glucose-regulated protein                        138   3e-34   
gb|KGL99135.1|  78 kDa glucose-regulated protein                        138   3e-34   
gb|KFQ99142.1|  78 kDa glucose-regulated protein                        138   3e-34   
ref|XP_011060484.1|  PREDICTED: heat shock 70 kDa protein cognate 4     139   3e-34   
dbj|BAE39187.1|  unnamed protein product                                139   3e-34   
emb|CCO27999.1|  Heat shock protein HSS1                                132   4e-34   
ref|NP_001156420.1|  heat shock protein cognate 3 precursor             139   4e-34   
ref|XP_010719463.1|  PREDICTED: 78 kDa glucose-regulated protein        139   4e-34   
ref|XP_011153497.1|  PREDICTED: heat shock 70 kDa protein cognate 4     139   4e-34   
ref|XP_003728714.1|  PREDICTED: LOW QUALITY PROTEIN: 78 kDa gluco...    139   4e-34   
emb|CCD11770.1|  unnamed protein product                                139   4e-34   
dbj|BAN20624.1|  heat shock protein cognate 3                           139   4e-34   
dbj|BAK63666.1|  78 kDa glucose-regulated protein precursor             137   4e-34   
gb|KFP75420.1|  78 kDa glucose-regulated protein                        138   4e-34   
ref|XP_011340138.1|  PREDICTED: heat shock 70 kDa protein cognate 4     139   4e-34   
gb|ESL05364.1|  glucose-regulated protein 78                            139   4e-34   
ref|XP_004088869.1|  PREDICTED: 78 kDa glucose-regulated protein        139   4e-34   
emb|CDJ05841.1|  Heat shock 70 kDa protein 4                            139   4e-34   
emb|CBK20665.2|  unnamed protein product                                138   4e-34   
gb|ACI90341.1|  HSP70-like protein                                      139   4e-34   



>sp|Q03683.1|BIP3_TOBAC RecName: Full=Luminal-binding protein 3; Short=BiP 3; AltName: 
Full=78 kDa glucose-regulated protein homolog 3; Short=GRP-78-3, 
partial [Nicotiana tabacum]
 emb|CAA42663.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=168

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  4    RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  63

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+A
Sbjct  64   DKKVKERIDARNGLETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSA  123

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  124  EKEDYEEKLKEVEAVCNPIITAVYQR  149



>ref|XP_006286312.1| hypothetical protein CARUB_v100065120mg, partial [Capsella rubella]
 gb|EOA19210.1| hypothetical protein CARUB_v100065120mg, partial [Capsella rubella]
Length=168

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = -2

Query  649  GTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEED  470
            GTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEED
Sbjct  1    GTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEED  60

Query  469  KKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNAE  290
            KKVKERIDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+E
Sbjct  61   KKVKERIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSE  120

Query  289  KEDYDEKLKEVEAVCNPIITAVYQR  215
            KE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  121  KEEYDEKLKEVEAVCNPIITAVYQR  145



>sp|Q03686.1|BIP8_TOBAC RecName: Full=Luminal-binding protein 8; Short=BiP 8; AltName: 
Full=78 kDa glucose-regulated protein homolog 8; Short=GRP-78-8, 
partial [Nicotiana tabacum]
 emb|CAA42664.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=293

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  128  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  187

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  188  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  247

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  248  EKEDYEEKLKEVEAVCNPIITAVYQK  273



>sp|Q03682.1|BIP2_TOBAC RecName: Full=Luminal-binding protein 2; Short=BiP 2; AltName: 
Full=78 kDa glucose-regulated protein homolog 2; Short=GRP-78-2, 
partial [Nicotiana tabacum]
 emb|CAA42661.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=292

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  125  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  184

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  185  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  244

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  245  EKEDYEEKLKEVEAVCNPIITAVYQR  270



>sp|Q03681.1|BIP1_TOBAC RecName: Full=Luminal-binding protein 1; Short=BiP 1; AltName: 
Full=78 kDa glucose-regulated protein homolog 1; Short=GRP-78-1, 
partial [Nicotiana tabacum]
 emb|CAA42662.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=290

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  125  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  184

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  185  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  244

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEA+CNPIITAVYQR
Sbjct  245  EKEDYEEKLKEVEAICNPIITAVYQR  270



>ref|XP_010445753.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
Length=261

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  93   RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  152

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  153  DKKVKERIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  212

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  213  EKEEYDEKLKEVEAVCNPIITAVYQR  238



>ref|XP_011084527.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=665

 Score =   221 bits (564),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLE++EKEKIETATKEALEW+DDNQNA
Sbjct  561  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLEADEKEKIETATKEALEWMDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>gb|KHG19744.1| Luminal-binding 5 [Gossypium arboreum]
Length=403

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  237  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  296

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQNA
Sbjct  297  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKVETAAKEALEWLDDNQNA  356

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  357  EKEDFEEKLKEVEAVCNPIITAVYQR  382



>gb|AAR23801.1| putative luminal binding protein precursor [Helianthus annuus]
Length=175

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK  G++EKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  12   RGTPQIEVTFEVDANGILNVKAEDKGXGKAEKITITNEKGRLSQEEIERMVREAEEFAEE  71

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQI+DKDKLADKLE++EK+KIE ATKEALEWLDDNQ+A
Sbjct  72   DKKVKEKIDARNALETYVYNMKNQISDKDKLADKLEADEKDKIEAATKEALEWLDDNQSA  131

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  132  EKEEYDEKLKEVEAVCNPIITAVYQR  157



>ref|XP_009592769.1| PREDICTED: luminal-binding protein 5 [Nicotiana tomentosiformis]
Length=668

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>ref|XP_009773333.1| PREDICTED: luminal-binding protein 5 [Nicotiana sylvestris]
 sp|Q03685.1|BIP5_TOBAC RecName: Full=Luminal-binding protein 5; Short=BiP 5; AltName: 
Full=78 kDa glucose-regulated protein homolog 5; Short=GRP-78-5; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42660.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=668

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>ref|XP_011075955.1| PREDICTED: luminal-binding protein 5 [Sesamum indicum]
Length=665

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLE++EKEKIETATKEALEW+DDNQNA
Sbjct  561  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLEADEKEKIETATKEALEWMDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_006350519.1| PREDICTED: luminal-binding protein 5-like [Solanum tuberosum]
Length=668

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQNA
Sbjct  561  DKKVKERVDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>gb|AAB57695.1| HSP70-related protein [Helianthus annuus]
Length=264

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  98   RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  157

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQINDKDKLADKLES+EKEKIE ATKEAL+ LDDNQ+A
Sbjct  158  DKKVKEKIDARNALETYVYNMKNQINDKDKLADKLESDEKEKIEAATKEALDRLDDNQSA  217

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPI+TAVYQR
Sbjct  218  EKEEYDEKLKEVEAVCNPIVTAVYQR  243



>gb|AGS42239.1| ER luminal-binding protein [Capsicum annuum]
Length=668

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEAL+WLDDNQ+A
Sbjct  561  DKKVKERVDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALDWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>gb|KJB18917.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=548

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  383  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  442

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+A
Sbjct  443  DKKVKERIDARNSLETYIYNMKNQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSA  502

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  503  EKEDYEEKLKEVEAVCNPIITAVYQR  528



>gb|KDO76634.1| hypothetical protein CISIN_1g0059551mg [Citrus sinensis]
Length=487

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  321  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  380

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+A
Sbjct  381  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSA  440

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  441  EKEDYEEKLKEVEAVCNPIITAVYQR  466



>ref|XP_008239207.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=667

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>ref|XP_010671405.1| PREDICTED: luminal-binding protein [Beta vulgaris subsp. vulgaris]
Length=665

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVQEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLADKLES+EK+KIE A KEALEWLDDNQ+A
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQVNDKDKLADKLESDEKDKIEGAVKEALEWLDDNQSA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_004234985.1| PREDICTED: luminal-binding protein 5 [Solanum lycopersicum]
Length=668

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKERVDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNP+ITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPVITAVYQR  646



>ref|XP_002303672.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE78651.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITND+GRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDRGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATK+ALEWLDDNQNA
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKDALEWLDDNQNA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_011022455.1| PREDICTED: luminal-binding protein 5-like [Populus euphratica]
Length=666

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQNA
Sbjct  560  DKKVKERIDARNGLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQNA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_009593820.1| PREDICTED: luminal-binding protein [Nicotiana tomentosiformis]
Length=668

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 140/146 (96%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>gb|ACK55195.1| ER luminal-binding protein [Nicotiana benthamiana]
Length=667

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  562  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  622  EKEDYEEKLKEVEAVCNPIITAVYQK  647



>ref|XP_007211088.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
 gb|EMJ12287.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
Length=667

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFA+E
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFADE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>emb|CDP05035.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KVKE+IDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEAL+WLDDNQNA
Sbjct  561  DRKVKEKIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALDWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI+TAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIVTAVYQR  646



>ref|XP_009802727.1| PREDICTED: luminal-binding protein [Nicotiana sylvestris]
Length=666

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEA+CNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAICNPIITAVYQR  646



>gb|ACJ11746.1| luminal binding protein [Gossypium hirsutum]
Length=666

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYIYNMKNQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_009788736.1| PREDICTED: luminal-binding protein 4 [Nicotiana sylvestris]
Length=667

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  562  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  622  EKEDYEEKLKEVEAVCNPIITAVYQK  647



>ref|XP_009588550.1| PREDICTED: luminal-binding protein 4 [Nicotiana tomentosiformis]
Length=667

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  562  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  622  EKEDYEEKLKEVEAVCNPIITAVYQK  647



>sp|Q03684.1|BIP4_TOBAC RecName: Full=Luminal-binding protein 4; Short=BiP 4; AltName: 
Full=78 kDa glucose-regulated protein homolog 4; Short=GRP-78-4; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42659.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=667

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  562  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  622  EKEDYEEKLKEVEAVCNPIITAVYQK  647



>gb|KJB18907.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=666

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYIYNMKNQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_002263323.1| PREDICTED: luminal-binding protein 5 [Vitis vinifera]
Length=667

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>ref|XP_002299448.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE84253.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK VKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKE LEWLDDNQNA
Sbjct  560  DKMVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKETLEWLDDNQNA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_009358650.1| PREDICTED: luminal-binding protein 5-like [Pyrus x bretschneideri]
Length=667

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV+AEDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVRAEDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQR  646



>emb|CAC14168.1| putative luminal binding protein [Corylus avellana]
Length=668

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVQEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQ+NDKDKLADKLES+EK+KIE+A K+ALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNTLETYVYNMKNQVNDKDKLADKLESDEKDKIESAVKDALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>gb|KDP25255.1| hypothetical protein JCGZ_20411 [Jatropha curcas]
Length=665

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ A
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQTA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>gb|EYU25252.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=547

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEE
Sbjct  383  RGIPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEE  442

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLE++EKEKIETATKEALEWLD+NQ+A
Sbjct  443  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLETDEKEKIETATKEALEWLDENQSA  502

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  503  EKEDYEEKLKEVEAVCNPIITAVYQR  528



>ref|XP_009102505.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Brassica rapa]
Length=666

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>gb|KJB39580.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=667

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQNA
Sbjct  561  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDFEEKLKEVEAVCNPIITAVYQR  646



>gb|KJB39585.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=549

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  383  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  442

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLETYVYNMKNQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNA
Sbjct  443  DKKLKEKIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNA  502

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  503  EKEDFEEKLKEVEAVCNPIITAVYQR  528



>gb|KDO76633.1| hypothetical protein CISIN_1g0059551mg [Citrus sinensis]
Length=599

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  433  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  492

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+A
Sbjct  493  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSA  552

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  553  EKEDYEEKLKEVEAVCNPIITAVYQR  578



>gb|EPS69483.1| luminal-binding protein 5, partial [Genlisea aurea]
Length=661

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 139/146 (95%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  499  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQI+DKDKLADKL+S+EKEKIETATKEALEWLDDNQ A
Sbjct  559  DKKVKERIDARNSLETYVYNMRNQISDKDKLADKLDSDEKEKIETATKEALEWLDDNQAA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  619  EKEDYEEKLKEVEAVCNPIITAVYQR  644



>ref|XP_009125214.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=665

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  499  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLADKLE++EKEKIE ATKEALEWLD+NQN+
Sbjct  559  DKKVKERIDARNSLETYVYNMKNQVNDKDKLADKLEADEKEKIEAATKEALEWLDENQNS  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  619  EKEEYDEKLKEVEAVCNPIITAVYQR  644



>ref|XP_009132761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=669

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|XP_008437399.1| PREDICTED: luminal-binding protein 5 [Cucumis melo]
Length=665

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQINDKDKLADKLES+EKEKIETA K+ALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYIYNMKNQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_010430591.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFA+E
Sbjct  495  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFADE  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLADKLE+++KEKIE ATKEALEWLD+NQNA
Sbjct  555  DKKVKERIDARNSLETYVYNMKNQVNDKDKLADKLEADDKEKIEAATKEALEWLDENQNA  614

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQ+
Sbjct  615  EKEDYDEKLKEVEAVCNPIITAVYQK  640



>ref|XP_010473721.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFA+E
Sbjct  495  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFADE  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLADKLE+++KEKIE ATKEALEWLD+NQNA
Sbjct  555  DKKVKERIDARNSLETYVYNMKNQVNDKDKLADKLEADDKEKIEAATKEALEWLDENQNA  614

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQ+
Sbjct  615  EKEDYDEKLKEVEAVCNPIITAVYQK  640



>sp|Q42434.1|BIP_SPIOL RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Spinacia oleracea]
 gb|AAA21808.1| ER-lumenal protein [Spinacia oleracea]
 gb|AAA21806.1| ER-lumenal protein [Spinacia oleracea]
Length=668

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETY+YNMKNQI+D DKLADKLES+EKEKIE A KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYIYNMKNQISDADKLADKLESDEKEKIEGAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>gb|AJF19166.1| endoplasmic reticulum chaperone binding protein [Lycium chinense]
Length=664

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 146/146 (100%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKASGKAEKITITNDKGRLSQEEIERMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLES+EKEKIETATKEALEW+DDNQ+A
Sbjct  558  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLESDEKEKIETATKEALEWMDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  618  EKEDYEEKLKEVEAVCNPIITAVYQK  643



>ref|XP_002887878.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64137.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFA+E
Sbjct  495  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFADE  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLADKLE+++KEKIE ATK+ALEWLD+NQNA
Sbjct  555  DKKVKERIDARNSLETYVYNMKNQVNDKDKLADKLEADDKEKIEAATKDALEWLDENQNA  614

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQ+
Sbjct  615  EKEDYDEKLKEVEAVCNPIITAVYQK  640



>gb|KDO76629.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=647

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  481  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  540

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+A
Sbjct  541  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSA  600

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  601  EKEDYEEKLKEVEAVCNPIITAVYQR  626



>ref|XP_009770477.1| PREDICTED: luminal-binding protein 4-like [Nicotiana sylvestris]
Length=666

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+A
Sbjct  562  DKKVKERIDARNGLETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  622  EKEDYEEKLKEVEAVCNPIITAVYQR  647



>ref|XP_010055986.1| PREDICTED: luminal-binding protein [Eucalyptus grandis]
Length=667

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLE +EK+KIETATKEALEWLDDNQ A
Sbjct  561  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLEEDEKDKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQR  646



>ref|XP_008390320.1| PREDICTED: luminal-binding protein 5 [Malus domestica]
 ref|XP_009344042.1| PREDICTED: luminal-binding protein 5 [Pyrus x bretschneideri]
Length=667

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV+AEDK +G++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVRAEDKGTGKAEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQR  646



>ref|XP_006439283.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
 gb|ESR52523.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
Length=667

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_007040596.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY25097.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=665

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_010107258.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC14452.1| Luminal-binding protein 5 [Morus notabilis]
Length=667

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMK+QINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYVYNMKSQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>emb|CAB72128.1| heat shock protein 70 [Cucumis sativus]
Length=665

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY YNMKNQINDKDKLADKLES+EKEKIETA K+ALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYTYNMKNQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_004143862.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 ref|XP_004169474.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 gb|KGN50013.1| hypothetical protein Csa_5G149330 [Cucumis sativus]
Length=665

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY YNMKNQINDKDKLADKLES+EKEKIETA K+ALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYTYNMKNQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_006343810.1| PREDICTED: luminal-binding protein-like [Solanum tuberosum]
Length=667

 Score =   213 bits (543),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G++EKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKAEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNALETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>ref|NP_001234636.1| luminal-binding protein precursor [Solanum lycopersicum]
 sp|P49118.1|BIP_SOLLC RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34139.1| glucose-regulated protein 78 [Solanum lycopersicum]
Length=666

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G++EKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKAEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNALETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIITAVYQR  646



>ref|XP_006476337.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=667

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EK+KIETA KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKDKIETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_010545034.1| PREDICTED: luminal-binding protein 4 [Tarenaya hassleriana]
Length=665

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  499  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARNSLETYVYNMKNQ+NDKDKLA+KLE +EKEKIETA KEALEWLDDNQ+A
Sbjct  559  DKKVKERVDARNSLETYVYNMKNQVNDKDKLAEKLEEDEKEKIETAVKEALEWLDDNQSA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVE+VCNPIITAVYQR
Sbjct  619  EKEDYEEKLKEVESVCNPIITAVYQR  644



>ref|XP_009619852.1| PREDICTED: luminal-binding protein 4-like [Nicotiana tomentosiformis]
Length=666

 Score =   213 bits (543),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK SG+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKGSGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ+A
Sbjct  562  DKKVKERIDARNGLETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQ+
Sbjct  622  EKEDYEEKLKEVEAVCNPIITAVYQK  647



>gb|KCW72555.1| hypothetical protein EUGRSUZ_E01024 [Eucalyptus grandis]
Length=719

 Score =   214 bits (544),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  553  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  612

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQINDKDKLADKLE +EK+KIETATKEALEWLDDNQ A
Sbjct  613  DKKVKEKIDARNSLETYVYNMKNQINDKDKLADKLEEDEKDKIETATKEALEWLDDNQTA  672

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  673  EKEDYDEKLKEVEAVCNPIISAVYQR  698



>ref|XP_002317789.2| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE96009.2| BiP isoform A family protein [Populus trichocarpa]
Length=668

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAE+
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAED  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETYVYNMKNQ+NDKDKLADKLE++EKEKIETA KEALEWLDDNQ+A
Sbjct  562  DKKVKEKIDARNSLETYVYNMKNQVNDKDKLADKLEADEKEKIETAVKEALEWLDDNQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIIT+VYQR
Sbjct  622  EKEDYEEKLKEVEAVCNPIITSVYQR  647



>gb|KFK32977.1| hypothetical protein AALP_AA6G313600 [Arabis alpina]
Length=662

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEE
Sbjct  497  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  557  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  617  EKEDYEEKLKEVEAVCNPIITAVYQR  642



>ref|XP_002518865.1| heat shock protein, putative [Ricinus communis]
 gb|EEF43398.1| heat shock protein, putative [Ricinus communis]
Length=664

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQI+DKDKLADKLES+EKEKIETA KEALEWLDDNQ+A
Sbjct  560  DKKVKERIDARNSLETYIYNMKNQISDKDKLADKLESDEKEKIETAVKEALEWLDDNQSA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>gb|AAW55475.1| ER-binding protein [Malus pumila]
Length=667

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANG+LNV+AEDK +G++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGVLNVRAEDKGTGKAEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQR  646



>gb|KDP35832.1| hypothetical protein JCGZ_10646 [Jatropha curcas]
Length=666

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV+AEDKASG+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVRAEDKASGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQINDKDKLA+KLES+EKEKIETA KEALEWLD+NQ+A
Sbjct  561  DKKVKERIDARNSLETYIYNMKNQINDKDKLAEKLESDEKEKIETAVKEALEWLDENQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>emb|CDP12195.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KERIDARN LETYVYNMKNQINDKDKLADKLES+EKEKIE A KEALEWLDDNQ+A
Sbjct  561  DKKMKERIDARNGLETYVYNMKNQINDKDKLADKLESDEKEKIEAAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>gb|EYU19660.1| hypothetical protein MIMGU_mgv1a002500mg [Erythranthe guttata]
Length=666

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLE++EKEKIETATKEALEW+DDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLEADEKEKIETATKEALEWMDDNQAA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEA CNPIITAVYQR
Sbjct  621  EKEDFEEKLKEVEAACNPIITAVYQR  646



>ref|XP_010446984.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010447007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010436160.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X1 [Camelina sativa]
Length=668

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|XP_010436161.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X2 [Camelina sativa]
Length=668

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|XP_008337565.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=667

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV+AEDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVRAEDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ A
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+ VYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISXVYQR  646



>emb|CDY13371.1| BnaC06g13860D [Brassica napus]
Length=673

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  507  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  566

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE+EEKEKIE ATKEALEWLD+NQN+
Sbjct  567  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEAEEKEKIEAATKEALEWLDENQNS  626

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  627  EKEEYDEKLKEVEAVCNPIITAVYQR  652



>gb|KHG03675.1| Luminal-binding 5 [Gossypium arboreum]
 gb|KHG17377.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY+YNMKNQINDKDKLADKLES+EKEK+ETA KEALEWLDDNQ+A
Sbjct  561  DKKVKERIDARNSLETYIYNMKNQINDKDKLADKLESDEKEKVETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKL EVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLNEVEAVCNPIITAVYQR  646



>ref|XP_006405286.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
 dbj|BAJ34315.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46739.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
Length=669

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE++EK+KIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEADEKDKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_006401475.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
 gb|ESQ42928.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
Length=668

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE++EK+KIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEADEKDKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>gb|AAZ95244.1| putative luminal-binding protein [Isatis tinctoria]
Length=668

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE++EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEADEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_004300491.1| PREDICTED: luminal-binding protein [Fragaria vesca subsp. vesca]
Length=667

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETY YNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQ A
Sbjct  561  DKKVKEKIDARNSLETYTYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQTA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>gb|EYU25251.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=667

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIERMV+EAEEFAEE
Sbjct  503  RGIPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIERMVKEAEEFAEE  562

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNM+NQINDKDKLADKLE++EKEKIETATKEALEWLD+NQ+A
Sbjct  563  DKKVKERIDARNSLETYVYNMRNQINDKDKLADKLETDEKEKIETATKEALEWLDENQSA  622

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  623  EKEDYEEKLKEVEAVCNPIITAVYQR  648



>gb|KHG09348.1| Luminal-binding 5 [Gossypium arboreum]
Length=667

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLETYVYNMKNQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNA
Sbjct  561  DKKLKEKIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDFEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_011026831.1| PREDICTED: luminal-binding protein 5 [Populus euphratica]
Length=666

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 138/146 (95%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK VKE+IDARNSLETYVYNMKNQINDKDKLADKLES+EKEKIETATKEALEWLDDNQ+A
Sbjct  560  DKMVKEKIDARNSLETYVYNMKNQINDKDKLADKLESDEKEKIETATKEALEWLDDNQSA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>gb|KJB39584.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=667

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLETYVYNMKNQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNA
Sbjct  561  DKKLKEKIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDFEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_002276268.2| PREDICTED: luminal-binding protein 5-like isoform X2 [Vitis vinifera]
Length=667

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLE+YVYNMK QINDKDKLADKLESEEKEKIETA KEALEWLDDNQNA
Sbjct  561  DKKIKEKIDARNSLESYVYNMKTQINDKDKLADKLESEEKEKIETAVKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            E EDY EKLKEVEAVCNPIITAVYQR
Sbjct  621  ETEDYQEKLKEVEAVCNPIITAVYQR  646



>ref|XP_002868566.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44825.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKERIDARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>dbj|BAA13947.1| luminal binding protein [Arabidopsis thaliana]
Length=669

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKEKIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|NP_198206.1| Luminal-binding protein 1 [Arabidopsis thaliana]
 sp|Q9LKR3.1|MD37A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37a; AltName: Full=Heat shock 70 kDa protein 11; AltName: 
Full=Heat shock protein 70-11; Short=AtHsp70-11; AltName: 
Full=Luminal-binding protein 1; Short=AtBP1; Short=BiP1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF88019.1| Hypothetical protein T26D3.10 [Arabidopsis thaliana]
 gb|AAN17430.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN65099.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93812.1| Luminal-binding protein 1 [Arabidopsis thaliana]
Length=669

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKEKIDARNALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|XP_010662895.1| PREDICTED: luminal-binding protein 5-like isoform X1 [Vitis vinifera]
Length=697

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 137/146 (94%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  531  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE  590

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLE+YVYNMK QINDKDKLADKLESEEKEKIETA KEALEWLDDNQNA
Sbjct  591  DKKIKEKIDARNSLESYVYNMKTQINDKDKLADKLESEEKEKIETAVKEALEWLDDNQNA  650

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            E EDY EKLKEVEAVCNPIITAVYQR
Sbjct  651  ETEDYQEKLKEVEAVCNPIITAVYQR  676



>ref|XP_010266594.1| PREDICTED: luminal-binding protein 5 [Nelumbo nucifera]
Length=666

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 136/146 (93%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +GRSEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGRSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARNSLETY+YN+KNQI+DKDKLADKLESEEK+KIETA KEALEWLDDNQ+A
Sbjct  561  DKKVKEKIDARNSLETYIYNLKNQISDKDKLADKLESEEKDKIETAVKEALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIIAAVYQR  646



>ref|XP_004503579.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQINDKDKLADKLES+EKEKIETA KEALEWLDDNQN 
Sbjct  560  DKKVKERIDARNALETYVYNMKNQINDKDKLADKLESDEKEKIETAVKEALEWLDDNQNV  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDFEEKLKEVEAVCNPIITAVYQR  645



>gb|KHG04866.1| Luminal-binding 5 [Gossypium arboreum]
Length=733

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  567  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  626

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLETYVYNMKNQI+DKDKLADKLES+EKEK+ETA KEALEWLDDNQNA
Sbjct  627  DKKLKEKIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKVETAVKEALEWLDDNQNA  686

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPIITAVYQR
Sbjct  687  EKEDFEEKLKEVEAVCNPIITAVYQR  712



>ref|XP_010934830.1| PREDICTED: luminal-binding protein 4 [Elaeis guineensis]
Length=661

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  497  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN LETYVYNMKN INDKDKLADKLESEEKEK+E A K+ALEWLDDNQNA
Sbjct  557  DKKVKEKIDARNQLETYVYNMKNTINDKDKLADKLESEEKEKVEEALKDALEWLDDNQNA  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  617  EKEDYDEKLKEVEAVCNPIISAVYQR  642



>dbj|BAA12348.1| luminal binding protein (BiP) [Arabidopsis thaliana]
Length=668

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKEKIDARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|NP_851119.1| Luminal-binding protein 2 [Arabidopsis thaliana]
 sp|Q39043.2|MD37F_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37f; AltName: Full=Heat shock 70 kDa protein 12; AltName: 
Full=Heat shock protein 70-12; Short=AtHsp70-12; AltName: 
Full=Luminal-binding protein 2; Short=AtBP2; Short=BiP2; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB08435.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAO00752.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAP37765.1| At5g42020 [Arabidopsis thaliana]
 gb|AED94755.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=668

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKEKIDARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>dbj|BAA13948.1| luminal binding protein [Arabidopsis thaliana]
Length=668

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 144/146 (99%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKNQ++DKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  560  DKKVKEKIDARNALETYVYNMKNQVSDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEEYDEKLKEVEAVCNPIITAVYQR  645



>ref|XP_010918502.1| PREDICTED: luminal-binding protein 4-like [Elaeis guineensis]
Length=664

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARN LETYVYNMKN IN+KDKLADKLESEEKEKI+ A K+ALEWLDDNQNA
Sbjct  561  DKKIKEKIDARNQLETYVYNMKNTINEKDKLADKLESEEKEKIDAALKDALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQR  646



>ref|XP_004503582.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKNQ+NDKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  560  DKKVKERIDARNGLETYVYNMKNQVNDKDKLADKLESDEKEKIETAVKEALEWLDDNQSV  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIITAVYQR  645



>ref|XP_008796727.1| PREDICTED: luminal-binding protein 5 [Phoenix dactylifera]
Length=664

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARN LETYVYNMKN IN+KDKLADKLESEEK+KI+ A K+ALEWLDDNQNA
Sbjct  561  DKKIKEKIDARNQLETYVYNMKNTINEKDKLADKLESEEKDKIDAALKDALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQR  646



>gb|KHM99873.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 135/146 (92%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQI+DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKIETAVKEALEWLDDNQSM  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPII+AVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIISAVYQR  645



>ref|XP_003530453.1| PREDICTED: luminal-binding protein 5 [Glycine max]
Length=667

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSV  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPII+AVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIISAVYQR  645



>gb|KFK32162.1| hypothetical protein AALP_AA6G205800 [Arabis alpina]
Length=663

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITN+KGRLSQEEIE+MVREAEEFAEE
Sbjct  495  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITNEKGRLSQEEIEKMVREAEEFAEE  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE+++KEKIE ATKEALEWLD+NQNA
Sbjct  555  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEADDKEKIEAATKEALEWLDENQNA  614

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK +YDEKLKEVEAVCNPIIT VYQ+
Sbjct  615  EKTEYDEKLKEVEAVCNPIITKVYQK  640



>gb|AAA92743.1| polypeptide chain-binding protein, partial [Zea mays]
Length=486

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  302  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  361

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+A
Sbjct  362  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSA  421

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  422  EKEDYEEKLKEVEAVCNPIVSAVYQR  447



>ref|XP_009392825.1| PREDICTED: luminal-binding protein 2 [Musa acuminata subsp. malaccensis]
Length=668

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV+AEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVRAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN LETYVYNMKN INDKDKLADK+ESEEKEKIE A K+ALEWLDDNQNA
Sbjct  561  DKKVKEKIDARNQLETYVYNMKNTINDKDKLADKIESEEKEKIEAALKDALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNPII+AVYQ+
Sbjct  621  EKEDYDEKLKEVEAVCNPIISAVYQK  646



>gb|KHN16716.1| Luminal-binding protein 5 [Glycine soja]
Length=726

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  559  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  618

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  619  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSV  678

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPII+AVYQR
Sbjct  679  EKEDYEEKLKEVEAVCNPIISAVYQR  704



>gb|ABK24469.1| unknown [Picea sitchensis]
Length=396

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  232  RGVPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIERMVREAEEFAEE  291

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN INDKDKLADK+ES++KEKI+ A KEALEWLD+NQ+A
Sbjct  292  DKKVKERIDARNGLETYVYNMKNTINDKDKLADKIESDDKEKIDAALKEALEWLDENQSA  351

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVE+VCNPI+T VYQ+
Sbjct  352  EKEDYEEKLKEVESVCNPIVTKVYQQ  377



>gb|KJB24174.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=666

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK + ++EKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTHKTEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNS+ETYVYN+K+QI+DKDKLADKLES+EKEKIE A KEALEWLDDNQNA
Sbjct  561  DKKVKERIDARNSIETYVYNLKSQISDKDKLADKLESDEKEKIEAAVKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>gb|KHG07305.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK + ++EKITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTHKTEKITITNDKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNS+ETYVYN+K+QI+DKDKLADKLES+EKEKIE A KEALEWLDDNQNA
Sbjct  561  DKKVKERIDARNSIETYVYNLKSQISDKDKLADKLESDEKEKIEAAVKEALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEDYEEKLKEVEAVCNPIITAVYQR  646



>ref|NP_001105893.1| luminal-binding protein 2 precursor [Zea mays]
 ref|NP_001278725.1| NHP2-like protein 1 precursor [Zea mays]
 sp|P24067.3|BIP2_MAIZE RecName: Full=Luminal-binding protein 2; Short=BiP2; AltName: 
Full=B-70; Short=B70; AltName: Full=Heat shock protein 70 homolog 
2; Flags: Precursor [Zea mays]
 gb|AAC49899.1| lumenal binding protein cBiPe2 [Zea mays]
 gb|ACF86383.1| unknown [Zea mays]
 gb|AEW66883.1| ER luminal binding protein [Zea mays]
 gb|AFW69798.1| binding protein-like protein [Zea mays]
Length=663

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|AGT16206.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|AGT15890.1| luminal-binding protein [Saccharum hybrid cultivar R570]
 gb|AGT16047.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEK+K+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKKKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>ref|NP_001105894.1| luminal-binding protein 3 precursor [Zea mays]
 sp|O24581.1|BIP3_MAIZE RecName: Full=Luminal-binding protein 3; Short=BiP3; Flags: Precursor 
[Zea mays]
 gb|AAC49900.1| lumenal binding protein cBiPe3 [Zea mays]
Length=663

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|ACF86491.1| unknown [Zea mays]
 gb|AFW66784.1| luminal-binding protein 3 Precursor [Zea mays]
Length=663

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|AGT16055.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
 gb|AGT16312.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
Length=664

 Score =   204 bits (519),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLE+EEKEK+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>ref|XP_009418642.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRL+QEEIERMV+EAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLTQEEIERMVQEAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN LETYVYNMKN IN+KDKLADK+E+EEKEKIE A K+ALEWLDDNQ+A
Sbjct  560  DKKVKEKIDARNQLETYVYNMKNTINEKDKLADKIETEEKEKIEAALKDALEWLDDNQSA  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNP+I+AVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPVISAVYQR  645



>ref|XP_003573226.1| PREDICTED: luminal-binding protein 3 [Brachypodium distachyon]
Length=665

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ+A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>ref|XP_004952156.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=665

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN LETYVYNMKN I DKDKLADKLESEEKEK+E A KEALEWLDDNQ+A
Sbjct  558  DKKVKEKIDARNQLETYVYNMKNTIGDKDKLADKLESEEKEKVEEALKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPII+AVYQ+
Sbjct  618  EKEDYEEKLKEVEAVCNPIISAVYQK  643



>dbj|BAJ85675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|AGN94841.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   202 bits (514),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|EMT16454.1| Luminal-binding protein 4 [Aegilops tauschii]
 gb|AGN94840.1| ER molecular chaperone [Triticum aestivum]
 gb|AGN94842.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++AVYQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAVYQR  643



>gb|AAB86942.1| endoplasmic reticulum HSC70-cognate binding protein precursor 
[Glycine max]
Length=668

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGT QIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVRE ++FAEE
Sbjct  500  RGTAQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREEKDFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            +KKVKERIDARNSLETYVYNMKNQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  560  EKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSM  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPII+AVYQR
Sbjct  620  EKEDYEEKLKEVEAVCNPIISAVYQR  645



>ref|XP_009396163.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KVKE+IDARN LETYVYNMKN +N+KDKLADK+E+EEKEKIE A K+ALEWLDDNQ+A
Sbjct  561  DRKVKEKIDARNQLETYVYNMKNTVNEKDKLADKIENEEKEKIEAALKDALEWLDDNQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVC+PII+AVYQR
Sbjct  621  EKEDYEEKLKEVEAVCSPIISAVYQR  646



>ref|XP_006282977.1| hypothetical protein CARUB_v100044650mg, partial [Capsella rubella]
 gb|EOA15875.1| hypothetical protein CARUB_v100044650mg, partial [Capsella rubella]
Length=157

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = -2

Query  616  DANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEEDKKVKERIDARN  437
            DANGILNVKAEDKASG+SEKITITN+KGRLSQEEI+RMV+EAEEFAEEDKKVKERIDARN
Sbjct  1    DANGILNVKAEDKASGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEEDKKVKERIDARN  60

Query  436  SLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNAEKEDYDEKLKEV  257
            +LETYVYNMKNQ+NDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+EKE+YDEKLKEV
Sbjct  61   ALETYVYNMKNQVNDKDKLADKLEGDEKEKIEAATKEALEWLDENQNSEKEEYDEKLKEV  120

Query  256  EAVCNPIITAVYQR  215
            EAVCNPIITAVYQR
Sbjct  121  EAVCNPIITAVYQR  134



>ref|NP_001234941.1| BiP isoform A [Glycine max]
 gb|AAA81956.1| BiP isoform A [Glycine max]
Length=664

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 141/146 (97%), Gaps = 1/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLES+EKEK+ETA KEALEWLDDNQ+ 
Sbjct  558  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLESDEKEKVETAVKEALEWLDDNQSV  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK  Y+EKLKEVEAVCNPII+AVYQR
Sbjct  618  EKR-YEEKLKEVEAVCNPIISAVYQR  642



>gb|EMS58484.1| Luminal-binding protein 3 [Triticum urartu]
Length=709

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMV+EAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EKLKEVEAVCNPI++A YQR
Sbjct  618  EKEDYEEKLKEVEAVCNPIVSAGYQR  643



>gb|ACH59039.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59040.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59041.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59042.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59043.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59044.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59045.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59046.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59047.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59048.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59049.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59050.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59051.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59052.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59053.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59054.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59055.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59056.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59057.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59058.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59059.1| luminal binding protein, partial [Pseudotsuga menziesii]
 gb|ACH59060.1| luminal binding protein, partial [Pseudotsuga menziesii]
Length=188

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AEDK + ++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  24   RGVPQIEVTFEVDANGILNVRAEDKGTKKTEKITITNDKGRLSQEEIERMVKEAEEFAEE  83

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++SE+KEKIETA KEALEWLDDNQ+A
Sbjct  84   DKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDSEDKEKIETAIKEALEWLDDNQSA  143

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVC+PII  VY++
Sbjct  144  EKEDFEEKLKEVEAVCSPIIKQVYEK  169



>gb|ACH59061.1| luminal binding protein, partial [Pseudotsuga menziesii]
Length=188

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AEDK + ++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  24   RGVPQIEVTFEVDANGILNVRAEDKGTKKTEKITITNDKGRLSQEEIERMVKEAEEFAEE  83

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++SE+KEKIETA KEALEWLDDNQ+A
Sbjct  84   DKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDSEDKEKIETAIKEALEWLDDNQSA  143

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVC+PII  VY++
Sbjct  144  EKEDFEEKLKEVEAVCSPIIKQVYEK  169



>ref|XP_006827760.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
 gb|ERM95176.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
Length=665

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNVKAEDK +G+SEKITITNDKGRL+Q EI+ M+REAE++AEE
Sbjct  501  RGVPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLTQAEIDEMIREAEKYAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN+LETYVYNMKN I DKDKL +K+E+ EKE+IE A KEALEW+D+NQ+A
Sbjct  561  DKKVKEKIDARNALETYVYNMKNTIGDKDKLGEKIEASEKEQIEAALKEALEWMDENQSA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNP+I++VYQR
Sbjct  621  EKEDYDEKLKEVEAVCNPVISSVYQR  646



>gb|ACH59062.1| luminal binding protein, partial [Pseudotsuga macrocarpa]
Length=188

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AE K + ++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  24   RGVPQIEVTFEVDANGILNVRAEGKGTKKTEKITITNDKGRLSQEEIERMVKEAEEFAEE  83

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++SE+KEKIETA KEALEWLDDNQ+A
Sbjct  84   DKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDSEDKEKIETAIKEALEWLDDNQSA  143

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVC+P+I  VY++
Sbjct  144  EKEDFEEKLKEVEAVCSPLIKQVYEK  169



>ref|XP_006838409.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
 gb|ERN00978.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
Length=671

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AEDK + ++EKITITNDKGRLSQEEIERMVREAEEFAEE
Sbjct  507  RGVPQIEVTFEVDANGILNVRAEDKGTKKAEKITITNDKGRLSQEEIERMVREAEEFAEE  566

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVY+MK+ INDKDKLADK+ES++KEK+ETA KEALEWLDDNQ A
Sbjct  567  DKKVKERIDARNSLETYVYSMKSTINDKDKLADKIESDDKEKVETALKEALEWLDDNQTA  626

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVCNPII  VY++
Sbjct  627  EKEDFEEKLKEVEAVCNPIIKQVYEK  652



>ref|XP_010105626.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC51262.1| Luminal-binding protein 5 [Morus notabilis]
Length=278

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDA+GIL+V AEDKA+ +S+ ITITN+KGRLSQEEIE+MV+EAEEFAEE
Sbjct  79   RGIPQIEVTFEVDADGILHVTAEDKAAKKSQSITITNEKGRLSQEEIEKMVKEAEEFAEE  138

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK++E+ID+RN LETY+YNMKN +NDKDKL DK++S +KEKIE A KEALEWLDDNQNA
Sbjct  139  DKKLREKIDSRNKLETYIYNMKNMVNDKDKLTDKMKSSDKEKIERALKEALEWLDDNQNA  198

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEA+CNP+I  VY +
Sbjct  199  EKEDYDEKLKEVEAICNPVIKQVYDK  224



>emb|CAC27138.1| glucose regulated protein homolog 4 precursor [Picea abies]
Length=432

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AEDK + +SEKITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  266  RGVPQIEVTFEVDANGILNVRAEDKGTKKSEKITITNDKGRLSQEEIDRMVKEAEEFAEE  325

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMK+ IN+KDKLADK++SE+KEKIE A KEAL+WLD+NQ+A
Sbjct  326  DKKVKERIDARNNLETYVYNMKSTINEKDKLADKIDSEDKEKIEDALKEALDWLDENQSA  385

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D++EKLKEVEAVC+PII  VY++
Sbjct  386  EKDDFEEKLKEVEAVCSPIIKKVYEK  411



>gb|ACU23078.1| unknown [Glycine max]
Length=226

 Score =   179 bits (453),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFA E
Sbjct  60   RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAGE  119

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQI DKDKLADKLE +EKEKIETA KEALEWLDDNQ+ 
Sbjct  120  DKKVKERIDARNSLETYVYNMKNQIGDKDKLADKLEFDEKEKIETAVKEALEWLDDNQSV  179

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  180  EKEEYEEKLKEVEAVCNPIISAVYQR  205



>ref|XP_010259649.1| PREDICTED: luminal-binding protein 4-like [Nelumbo nucifera]
Length=661

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V+AEDKA+ +SE ITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  498  RGVPQIEVTFEVDANGILHVRAEDKAAKKSESITITNDKGRLSQEEIERMVKEAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KVKE+IDARN LETYVYNMK+ INDKDKL+DK++S++KEKIE+  KEALEWLDDNQ+A
Sbjct  558  DRKVKEKIDARNKLETYVYNMKSTINDKDKLSDKIDSDDKEKIESTLKEALEWLDDNQSA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+DY+EKLKEVEAVCNPII  VY++
Sbjct  618  EKDDYEEKLKEVEAVCNPIIKQVYEK  643



>ref|XP_002969949.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
 gb|EFJ29073.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
Length=660

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV+AEDK +G+SEKITITNDKGRL+QEEI+RMVREA+E AEE
Sbjct  493  RGVPQIEVTFEIDANGILNVRAEDKGTGKSEKITITNDKGRLTQEEIDRMVREADEMAEE  552

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK KER+D+RN LETY+YNM+N INDKDKLADK+E E+KEKIE   KEALEWLDDN  A
Sbjct  553  DKKQKERVDSRNGLETYLYNMRNTINDKDKLADKIEKEDKEKIEETLKEALEWLDDNNTA  612

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED+D+KLKEVEAVCNPIIT +YQ+
Sbjct  613  EKEDFDDKLKEVEAVCNPIITQIYQK  638



>ref|XP_002981419.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
 gb|EFJ17607.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
Length=660

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV+AEDK +G+SEKITITNDKGRL+QEEI+RMVREA+E AEE
Sbjct  493  RGVPQIEVTFEIDANGILNVRAEDKGTGKSEKITITNDKGRLTQEEIDRMVREADEMAEE  552

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK KER+D+RN LETY+YNM+N INDKDKLADK+E E+KEKIE   KEALEWLDDN  A
Sbjct  553  DKKQKERVDSRNGLETYLYNMRNTINDKDKLADKIEKEDKEKIEETLKEALEWLDDNNTA  612

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED+D+KLKEVEAVCNPIIT +YQ+
Sbjct  613  EKEDFDDKLKEVEAVCNPIITQIYQK  638



>ref|XP_010255192.1| PREDICTED: LOW QUALITY PROTEIN: luminal-binding protein 8-like 
[Nelumbo nucifera]
Length=554

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQ+EVTFEVD NGIL+V+AEDKA+ +SE ITITNDKGRLSQEEI RMV+EAEEFAEE
Sbjct  391  RGVPQLEVTFEVDTNGILHVRAEDKAAKKSESITITNDKGRLSQEEIARMVKEAEEFAEE  450

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KVKE+IDARN LETYVYNMK+ INDKDKL+DK++S++KEKIE+  KEALEWLDDNQ+A
Sbjct  451  DRKVKEKIDARNKLETYVYNMKSTINDKDKLSDKIDSDDKEKIESTLKEALEWLDDNQSA  510

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EK+DY+EKLKEVEAVCNPII  VY+
Sbjct  511  EKDDYEEKLKEVEAVCNPIIKQVYE  535



>ref|XP_001774724.1| predicted protein [Physcomitrella patens]
 gb|EDQ60395.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 2/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNVKAEDK +G+SEKI ITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  496  RGVPQIEVTFEIDANGILNVKAEDKGTGKSEKIVITNDKGRLSQEEIDRMVQEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+   DKL +K+ +E+KE IETA KEALEWLD+NQ+A
Sbjct  556  DKKVKERIDARNSLETYVYNMKNQLG--DKLGEKISAEDKETIETAMKEALEWLDENQSA  613

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EKED+ EKLKEVE +CNPI+T +YQ
Sbjct  614  EKEDFQEKLKEVEGICNPIVTKLYQ  638



>gb|ABR18447.1| unknown [Picea sitchensis]
Length=687

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AEDK + +SEKITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  521  RGVPQIEVTFEVDANGILNVRAEDKGTKKSEKITITNDKGRLSQEEIDRMVKEAEEFAEE  580

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMK+ IN+KDKLADK++SE+KEKIE A KEAL+WLD+NQ+A
Sbjct  581  DKKVKERIDARNNLETYVYNMKSTINEKDKLADKIDSEDKEKIEDALKEALDWLDENQSA  640

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D++EKLKEVEAVC+PII  VY++
Sbjct  641  EKDDFEEKLKEVEAVCSPIIKKVYEK  666



>emb|CAA89834.2| luminal binding protein [Pseudotsuga menziesii]
Length=675

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AEDK + ++EKITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  511  RGVPQIEVTFEVDANGILNVRAEDKGTKKTEKITITNDKGRLSQEEIERMVKEAEEFAEE  570

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVK++IDARN+LETYVYNMK+ IN+KDKLADK++SE+KEKIETA KEALEWLDDNQ+A
Sbjct  571  DKKVKDKIDARNNLETYVYNMKSTINEKDKLADKIDSEDKEKIETAIKEALEWLDDNQSA  630

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED++EKLKEVEAVC+PII  VY++
Sbjct  631  EKEDFEEKLKEVEAVCSPIIKQVYEK  656



>ref|XP_008246412.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=664

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL V+AEDKA+ RS+ ITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  499  RGVPQIEVTFEVDANGILQVRAEDKAAKRSQSITITNDKGRLSQEEIERMVKEAEEFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D KV+E+IDARN LETY+Y+MK+ INDKDKLADK++S++KE+IE+  KEALEWLDDNQNA
Sbjct  559  DNKVREKIDARNKLETYIYSMKSTINDKDKLADKIDSDDKERIESTLKEALEWLDDNQNA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +K+D+DEKLKEVEAVCNP+I  VY+R
Sbjct  619  DKDDFDEKLKEVEAVCNPVIKQVYER  644



>emb|CDP15491.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV+AEDKA+ +++ ITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  501  RGVPQIEVTFELDANGILNVRAEDKAAKKAQSITITNDKGRLSQEEIERMVKEAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV ERIDARN LETY+YNMK+ INDKDKLADK++S++K KIE+A K+ALEWLDDNQNA
Sbjct  561  DKKVSERIDARNKLETYIYNMKSTINDKDKLADKIDSDDKTKIESALKDALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
            +K+DYDEK+KEVEAVCNP+I   Y
Sbjct  621  DKDDYDEKMKEVEAVCNPVIKMAY  644



>ref|XP_007206318.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
 gb|EMJ07517.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
Length=657

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL V+AEDKA+ RS+ ITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  493  RGVPQIEVTFEVDANGILQVRAEDKAAKRSQSITITNDKGRLSQEEIERMVKEAEEFAEE  552

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D KV+E+IDARN LETY+Y+MK+ INDKDKLADK++S++KEKIE+  KEALEWLDDNQNA
Sbjct  553  DNKVREKIDARNKLETYIYSMKSTINDKDKLADKIDSDDKEKIESTLKEALEWLDDNQNA  612

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +K+D+DEKLKEVEAVCNP+I  VY++
Sbjct  613  DKDDFDEKLKEVEAVCNPVIKQVYEK  638



>ref|XP_001780840.1| predicted protein [Physcomitrella patens]
 gb|EDQ54319.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 132/145 (91%), Gaps = 2/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNVKAEDK +G+SEKI ITNDKGRLSQE+I+RMV+EAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILNVKAEDKGTGKSEKIVITNDKGRLSQEDIDRMVKEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KERIDARNSLETYVYNMKNQ+   DKL +K+  E+KE IETATKEALEWLD+NQ+A
Sbjct  556  DKKMKERIDARNSLETYVYNMKNQVG--DKLGEKMSVEDKETIETATKEALEWLDENQSA  613

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EKED+ EKLKEVE +CNPI++ VYQ
Sbjct  614  EKEDFAEKLKEVEGICNPIVSKVYQ  638



>ref|XP_004302398.1| PREDICTED: luminal-binding protein 4 [Fragaria vesca subsp. vesca]
Length=662

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  497  RGVPQIEVTFEVDANGILQVKAEDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK++E+IDARN LETY+YNM++ I DKDKLADK++S++KE IE+  KEAL WLDDNQNA
Sbjct  557  DKKLREKIDARNKLETYIYNMRSTIGDKDKLADKIDSDDKENIESTLKEALGWLDDNQNA  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D+DEKLKEVEAVCNP+I  VY++
Sbjct  617  EKDDFDEKLKEVEAVCNPVIKQVYEK  642



>ref|XP_008388543.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=662

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V+AEDKA+ +S+ ITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  499  RGVPQIEVTFEVDANGILHVRAEDKAAKKSQSITITNDKGRLSQEEIERMVKEAEEFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D KV+E+IDARN LETY+Y+MK+ +NDKDKLADK++S++KEKIE+  KEALEWLDDNQNA
Sbjct  559  DNKVREKIDARNKLETYIYSMKSTVNDKDKLADKIDSDDKEKIESTLKEALEWLDDNQNA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D+DEKLKEVEAVCNP+I  VY++
Sbjct  619  EKDDFDEKLKEVEAVCNPVIKQVYEK  644



>ref|XP_010108159.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC17991.1| Luminal-binding protein 5 [Morus notabilis]
Length=657

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDA+GIL+V AEDKA+ +S+ ITITN+KGRLSQEEIE+MV+EAEEFAEE
Sbjct  495  RGIPQIEVTFEVDADGILHVTAEDKAAKKSQSITITNEKGRLSQEEIEKMVKEAEEFAEE  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK++E+ID+RN LETY+YNMKN +NDKDKL DK++S +KEKIE A KEALEWLDDNQNA
Sbjct  555  DKKLREKIDSRNKLETYIYNMKNMVNDKDKLTDKMKSSDKEKIERALKEALEWLDDNQNA  614

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEA+CNP+I  VY +
Sbjct  615  EKEDYDEKLKEVEAICNPVIKQVYDK  640



>gb|KDP23486.1| hypothetical protein JCGZ_23319 [Jatropha curcas]
Length=662

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+VKAEDKA+ +S+ ITITNDKGRLSQEEI+RM++EAEE AEE
Sbjct  497  RGVPQIEVTFEVDANGILHVKAEDKAAKKSQSITITNDKGRLSQEEIDRMIKEAEEMAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE+IDARN LETY+YNM++ IND DKLA+K++S++KEKIE A KEALEWLDDNQN 
Sbjct  557  DKKVKEKIDARNKLETYIYNMRSTINDNDKLAEKIDSDDKEKIENALKEALEWLDDNQNV  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVEAVCNP+I  VY++
Sbjct  617  EKEDYDEKLKEVEAVCNPVIKQVYEK  642



>ref|XP_007160200.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
 gb|ESW32194.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
Length=666

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  559

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQI+DKDKLADKLES+EKEKIE+A KEALEWLDDNQ+ 
Sbjct  560  DKKVKERIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKIESAVKEALEWLDDNQSV  619

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  620  EKEEYEEKLKEVEAVCNPIISAVYQR  645



>gb|KHM99871.1| Luminal-binding protein 4 [Glycine soja]
Length=668

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  502  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQI DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  562  DKKVKERIDARNSLETYVYNMKNQIGDKDKLADKLESDEKEKIETAVKEALEWLDDNQSV  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  622  EKEEYEEKLKEVEAVCNPIISAVYQR  647



>gb|KJB81015.1| hypothetical protein B456_013G125300 [Gossypium raimondii]
Length=656

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V AEDKA+ +++ ITITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILHVTAEDKAAKKAQSITITNDKGRLSQEEIERMVKEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV+E+ID+RN LETY+YNM++ I+DKDKLADK++S+EKEKIE   +EALEWLDDNQN 
Sbjct  556  DKKVREKIDSRNKLETYIYNMRSSIDDKDKLADKIDSDEKEKIENTLREALEWLDDNQNG  615

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKED+DEKLKEVEAVCNPII  VY +
Sbjct  616  EKEDFDEKLKEVEAVCNPIIKQVYGK  641



>ref|XP_003525327.2| PREDICTED: luminal-binding protein [Glycine max]
Length=701

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 134/146 (92%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  535  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  594

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQI DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  595  DKKVKERIDARNSLETYVYNMKNQIGDKDKLADKLESDEKEKIETAVKEALEWLDDNQSV  654

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  655  EKEEYEEKLKEVEAVCNPIISAVYQR  680



>gb|KHN16714.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLES+EKEK+ETA KEALEWLDDNQ+ 
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLESDEKEKVETAVKEALEWLDDNQSV  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEEYEEKLKEVEAVCNPIISAVYQR  646



>dbj|BAD95470.1| BiP [Glycine max]
Length=668

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLES+EKEK+ETA KEALEWLDDNQ+ 
Sbjct  561  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLESDEKEKVETAVKEALEWLDDNQSV  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  621  EKEEYEEKLKEVEAVCNPIISAVYQR  646



>gb|KEH21274.1| heat shock 70 kDa protein [Medicago truncatula]
Length=668

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 143/146 (98%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEIERMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIERMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQ++DKDKLADKLES+EKEKIETA KEALEWLDDNQ+ 
Sbjct  561  DKKVKERIDARNALETYVYNMKNQVSDKDKLADKLESDEKEKIETAVKEALEWLDDNQSV  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEEYEEKLKEVEAVCNPIITAVYQR  646



>gb|KEH21282.1| heat shock cognate 70 kDa-like protein [Medicago truncatula]
Length=669

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV+AEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  501  RGTPQIEVTFEVDANGILNVRAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN+LETYVYNMKNQI+DKDKLADKLES+EKEKIE A KEALEWLDDNQ  
Sbjct  561  DKKVKERIDARNALETYVYNMKNQISDKDKLADKLESDEKEKIEAAVKEALEWLDDNQTV  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+++EKLKEVEAVCNPIITAVYQR
Sbjct  621  EKEEFEEKLKEVEAVCNPIITAVYQR  646



>ref|XP_007030985.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY11487.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=659

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V AEDKA+ +S+ ITITNDKGRLSQEEIE+MV+EAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILHVTAEDKAAKKSQSITITNDKGRLSQEEIEKMVKEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KV+E+ID+RN LETY+YNM++ I+DKDKLADKL S++KE+IE+  KEALEWLDDNQN 
Sbjct  556  DRKVREKIDSRNKLETYIYNMRSTIDDKDKLADKLGSDDKERIESTLKEALEWLDDNQNG  615

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
             KED+DEKLKEVEAVCNPII  VY
Sbjct  616  GKEDFDEKLKEVEAVCNPIIKQVY  639



>ref|NP_001238736.1| BiP isoform B precursor [Glycine max]
 gb|AAA81954.1| BiP isoform B [Glycine max]
Length=666

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 137/148 (93%), Gaps = 3/148 (2%)
 Frame = -2

Query  652  RGTPQIEVTFEVDA-NGILNVKAE-DKASGRSEKITITNDKGRLSQeeiermvreaeEFA  479
            RGTPQIEVTFEVDA  GILNVKA   K +G+SE+  I+N+KGRLSQEEIERMVREAEEFA
Sbjct  497  RGTPQIEVTFEVDAERGILNVKARRAKGTGKSERSPISNEKGRLSQEEIERMVREAEEFA  556

Query  478  EEDKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQ  299
            EEDKKVKERIDARNSLETYVYNMKNQI+DKDKLADKLES+EKEKIETA KEALEWLDDNQ
Sbjct  557  EEDKKVKERIDARNSLETYVYNMKNQISDKDKLADKLESDEKEKIETAVKEALEWLDDNQ  616

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            + EKEDY+EKLKE EAVCNPII+AVYQR
Sbjct  617  SMEKEDYEEKLKE-EAVCNPIISAVYQR  643



>ref|XP_006648229.1| PREDICTED: luminal-binding protein 2-like [Oryza brachyantha]
Length=665

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN I DKDKLADKLESEEKEK+E A KEALEWLDDNQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTIGDKDKLADKLESEEKEKVEEALKEALEWLDDNQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  618  EKEEYEEKLKEVEAVCNPIISAVYQR  643



>emb|CAC37635.1| luminal binding protein, BiP, partial [Scherffelia dubia]
Length=665

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV AEDK +G+ EKI ITNDKGRLSQEEIERMV+EAEEFA+E
Sbjct  502  RGVPQIEVTFEVDANGILNVAAEDKGTGKKEKIVITNDKGRLSQEEIERMVQEAEEFADE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETY YNMKN + D DKLADKL  E+KEK++ A +EAL+W+D+NQ A
Sbjct  562  DKKVKERIDARNSLETYCYNMKNTVEDSDKLADKLAEEDKEKVKEAVQEALDWMDENQTA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            E ++Y EKLKE+E VCNPI++A YQ
Sbjct  622  EADEYKEKLKELEDVCNPIVSAAYQ  646



>ref|XP_007509021.1| Luminal binding heat shock protein 70 [Bathycoccus prasinos]
 emb|CCO19478.1| Luminal binding heat shock protein 70 [Bathycoccus prasinos]
Length=393

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  232  RGVPQIEVTFEIDANGILNVGAEDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEE  291

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KERID+RNSLETY YNMKN ++D DKL DKLE  +K  I+ A KE LEWLD+NQ A
Sbjct  292  DKKIKERIDSRNSLETYAYNMKNTVSDSDKLGDKLEESDKSTIQDAVKEVLEWLDENQEA  351

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            + E+Y+EKLKE+E +CNPI++  YQ+
Sbjct  352  DTEEYEEKLKEIEGICNPIVSQAYQQ  377



>ref|XP_006360204.1| PREDICTED: LOW QUALITY PROTEIN: luminal-binding protein 4-like 
[Solanum tuberosum]
Length=557

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 130/146 (89%), Gaps = 9/146 (6%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTF VDANGIL VK EDKASG+S+KITITNDKGRLS+EEIE MV+E    AEE
Sbjct  401  RGTPQIEVTFAVDANGILTVKDEDKASGKSDKITITNDKGRLSREEIEHMVKE----AEE  456

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERID+RNSLETYVYNM+NQIND+DKLADKLES+EKEKIETATKEAL      Q+ 
Sbjct  457  DKKVKERIDSRNSLETYVYNMRNQINDQDKLADKLESDEKEKIETATKEAL-----XQSV  511

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEV AVCNPIITAVYQR
Sbjct  512  EKEDYDEKLKEVVAVCNPIITAVYQR  537



>ref|XP_010674036.1| PREDICTED: luminal-binding protein 5 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V AEDKA+   + ITITNDKGRLSQ+EI+RMVREAEEFAEE
Sbjct  501  RGVPQIEVTFEVDANGILHVTAEDKAAKNKQTITITNDKGRLSQDEIDRMVREAEEFAEE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK++E++DARN LETYVY+M++ I+DKDKLADK++S++KEKIE A K+ALEWLDDNQNA
Sbjct  561  DKKMREKVDARNKLETYVYSMRSTIDDKDKLADKIDSDDKEKIEAALKDALEWLDDNQNA  620

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDY+EK+KEVEAVCNP+I   Y++
Sbjct  621  EKEDYEEKMKEVEAVCNPVIKQAYEK  646



>ref|NP_001290009.1| mediator of RNA polymerase II transcription subunit 37a precursor 
[Vitis vinifera]
 gb|AFJ20202.1| putative luminal-binding protein [Vitis vinifera]
Length=660

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V+AEDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  497  RGVPQIEVTFEVDANGILHVRAEDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D++VKERIDARN LETY+Y+M+  IND+DKLADK++SE+KEKIE A KEAL+WLDDNQNA
Sbjct  557  DRQVKERIDARNKLETYLYSMRATINDRDKLADKIDSEDKEKIEAALKEALDWLDDNQNA  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +K++Y+EKL+ VEAVCNP+I  VY++
Sbjct  617  DKDEYNEKLRGVEAVCNPVIKQVYEK  642



>ref|NP_001045675.1| Os02g0115900 [Oryza sativa Japonica Group]
 dbj|BAD07938.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAD07713.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAF07589.1| Os02g0115900 [Oryza sativa Japonica Group]
 gb|EAY84196.1| hypothetical protein OsI_05577 [Oryza sativa Indica Group]
 gb|EAZ21491.1| hypothetical protein OsJ_05115 [Oryza sativa Japonica Group]
 gb|ACA50500.1| dnak-type molecular chaperone Bip [Oryza sativa Japonica Group]
Length=665

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKEVEAVCNPII+AVYQR
Sbjct  618  EKEEYEEKLKEVEAVCNPIISAVYQR  643



>ref|XP_010659633.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Vitis vinifera]
Length=649

 Score =   174 bits (442),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V+AEDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  497  RGVPQIEVTFEVDANGILHVRAEDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D++VKERIDARN LETY+Y+M+  IND+DKLADK++SE+KEKIE A KEAL+WLDDNQNA
Sbjct  557  DRQVKERIDARNKLETYLYSMRATINDRDKLADKIDSEDKEKIEAALKEALDWLDDNQNA  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            +K++Y+EKL+ VEAVCNP+I  VY+
Sbjct  617  DKDEYNEKLRGVEAVCNPVIKQVYE  641



>emb|CDY23972.1| BnaC03g17190D [Brassica napus]
 emb|CDX84809.1| BnaA03g14210D [Brassica napus]
Length=642

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 117/146 (80%), Gaps = 27/146 (18%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKAS                           EEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKAS---------------------------EEFAEE  532

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLE +EKEKIE ATKEALEWLD+NQN+
Sbjct  533  DKKVKERIDARNSLETYVYNMKNQINDKDKLADKLEGDEKEKIEAATKEALEWLDENQNS  592

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  593  EKEEYDEKLKEVEAVCNPIITAVYQR  618



>emb|CDY46766.1| BnaA03g17100D [Brassica napus]
Length=642

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 118/146 (81%), Gaps = 27/146 (18%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKAS                           EEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKAS---------------------------EEFAEE  532

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLADKLE++EKEKIE ATKEALEWLD+NQN+
Sbjct  533  DKKVKERIDARNSLETYVYNMKNQVNDKDKLADKLEADEKEKIEAATKEALEWLDENQNS  592

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  593  EKEEYDEKLKEVEAVCNPIITAVYQR  618



>gb|AAB63469.1| endosperm lumenal binding protein [Oryza sativa]
Length=663

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDK +G+SEKITITN+KGRLSQEEI+RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMKN + DKDKLADKLESEEKEK+E A KEALEWLD+NQ A
Sbjct  558  DKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EKE+Y+EKLKEVEAVCNPII+AVYQ
Sbjct  618  EKEEYEEKLKEVEAVCNPIISAVYQ  642



>ref|XP_003074861.1| Bip Luminal binding protein precursor, probable (IC) [Ostreococcus 
tauri]
Length=663

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  503  RGVPQIEVTFEIDANGILNVGAEDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEE  562

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+K KERID+RNSLET+ YNMKN ++D DKLADKLE ++K  IE A KEAL+WLDDNQ+A
Sbjct  563  DRKTKERIDSRNSLETFAYNMKNTVSDSDKLADKLEEDDKSTIEEAVKEALDWLDDNQSA  622

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EK+DYDE+LK++E VCNPI+   YQ
Sbjct  623  EKDDYDEQLKKLEEVCNPIVAKAYQ  647



>emb|CEG00952.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=656

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  496  RGVPQIEVTFEIDANGILNVGAEDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+K KERID+RNSLET+ YNMKN ++D DKLADKLE ++K  IE A KEAL+WLDDNQ+A
Sbjct  556  DRKTKERIDSRNSLETFAYNMKNTVSDSDKLADKLEEDDKSTIEEAVKEALDWLDDNQSA  615

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EK+DYDE+LK++E VCNPI+   YQ
Sbjct  616  EKDDYDEQLKKLEEVCNPIVAKAYQ  640



>emb|CDX77423.1| BnaA07g05610D [Brassica napus]
Length=642

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 118/146 (81%), Gaps = 27/146 (18%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKAS                           EEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKAS---------------------------EEFAEE  532

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE++EKEKIE ATKEALEWLD+NQN+
Sbjct  533  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEADEKEKIEAATKEALEWLDENQNS  592

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  593  EKEEYDEKLKEVEAVCNPIITAVYQR  618



>emb|CDY63497.1| BnaC07g48050D [Brassica napus]
Length=642

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 118/146 (81%), Gaps = 27/146 (18%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKAS                           EEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKAS---------------------------EEFAEE  532

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ++DKDKLADKLE++EKEKIE ATKEALEWLD+NQN+
Sbjct  533  DKKVKERIDARNSLETYVYNMKNQVSDKDKLADKLEADEKEKIEAATKEALEWLDENQNS  592

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  593  EKEEYDEKLKEVEAVCNPIITAVYQR  618



>emb|CDX79726.1| BnaC03g20620D [Brassica napus]
Length=642

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 118/146 (81%), Gaps = 27/146 (18%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKAS                           EEFAEE
Sbjct  500  RGTPQIEVTFEVDANGILNVKAEDKAS---------------------------EEFAEE  532

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ+NDKDKLA+KLE++EKEKIE ATKEALEWLD+NQN+
Sbjct  533  DKKVKERIDARNSLETYVYNMKNQVNDKDKLAEKLEADEKEKIEAATKEALEWLDENQNS  592

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  593  EKEEYDEKLKEVEAVCNPIITAVYQR  618



>ref|XP_009376693.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II 
transcription subunit 37f [Pyrus x bretschneideri]
Length=660

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V+ EDKA+ +S+ +TITNDKGRLSQEEIERMV+EAEEFAEE
Sbjct  497  RGVPQIEVTFEVDANGILHVRVEDKAAKKSQSVTITNDKGRLSQEEIERMVKEAEEFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D KV+E++DARN LETY+Y++K+ +N+KDK ADK++S++KEKIE+  KEALEWLDDNQNA
Sbjct  557  DNKVREKVDARNKLETYIYSLKSTVNEKDKPADKIDSDDKEKIESTLKEALEWLDDNQNA  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EK+D+D KLKEVEAVCNP+I  VY+
Sbjct  617  EKDDFDGKLKEVEAVCNPVIKQVYE  641



>ref|XP_005784200.1| hypothetical protein EMIHUDRAFT_442092 [Emiliania huxleyi CCMP1516]
 gb|EOD31771.1| hypothetical protein EMIHUDRAFT_442092 [Emiliania huxleyi CCMP1516]
Length=657

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEV+FE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  488  RGVPQIEVSFEIDANGILNVGAEDKGTGQSEKITITNDKGRLSQEEIERMVSEAEEFAEE  547

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDK-LADkleseekekietatkealEWLDDNQN  296
            DKKV+E+I+ARN+LE YVY+MKN ++D +K +ADK+  E+KE +E A +EA EWLDDNQ+
Sbjct  548  DKKVREKIEARNALENYVYSMKNTLSDGEKGVADKIGDEDKEAVEKAIEEANEWLDDNQD  607

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQ  218
            AEKED++EKLKEV+ VC+PII+ VY+
Sbjct  608  AEKEDFEEKLKEVQDVCSPIISKVYR  633



>gb|KDO56235.1| hypothetical protein CISIN_1g006194mg [Citrus sinensis]
Length=657

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V AEDK +   + ITI NDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILHVTAEDKGAKNKQSITIINDKGRLSQEEIDRMVKEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV+ER+D+RN LETY+YNM++ IN  DKLADK++S++KE+IE+  KEALEWLDDNQNA
Sbjct  556  DKKVRERVDSRNKLETYIYNMRSTIN--DKLADKIDSDDKERIESTLKEALEWLDDNQNA  613

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D+DEK+KEVEAVCNP+I  VY++
Sbjct  614  EKDDFDEKMKEVEAVCNPVIKQVYEK  639



>ref|XP_006433401.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
 ref|XP_006472078.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
 gb|ESR46641.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
Length=657

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V AEDK +   + ITI NDKGRLSQEEI+RMV+EAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILHVTAEDKGAKNKQSITIINDKGRLSQEEIDRMVKEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV+ER+D+RN LETY+YNM++ IN  DKLADK++S++KE+IE+  KEALEWLDDNQNA
Sbjct  556  DKKVRERVDSRNKLETYIYNMRSTIN--DKLADKIDSDDKERIESTLKEALEWLDDNQNA  613

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D+DEK+KEVEAVCNP+I  VY++
Sbjct  614  EKDDFDEKMKEVEAVCNPVIKQVYEK  639



>gb|AFC88846.1| putative luminal binding protein 7B4, partial [Tetragonia tetragonioides]
Length=699

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V AEDKA+   + ITITNDKGRLSQEEI++MVREAEEFAEE
Sbjct  537  RGVPQIEVTFEVDANGILHVTAEDKAAKNKQTITITNDKGRLSQEEIDQMVREAEEFAEE  596

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV+E++D+RN LE+Y+YNM++ I +KDKLADK++S++KEKI+ A KEALEWLDDNQNA
Sbjct  597  DKKVREKVDSRNKLESYIYNMRSTIEEKDKLADKIDSDDKEKIKGALKEALEWLDDNQNA  656

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +K+D++EK+KEVEAVCNP+I   Y++
Sbjct  657  DKDDFEEKMKEVEAVCNPVIKQAYEK  682



>ref|XP_010475731.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=666

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEE
Sbjct  504  RGVPQIEVTFEVDANGILQVKAEDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ V+E+IDARN LETYVYNMK+ + DK+KLA+K+  E+KEK+E   KE LEWLD+N NA
Sbjct  564  DRIVREKIDARNKLETYVYNMKSTVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNA  623

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEK+KEVE+VCNP+I + Y++
Sbjct  624  EKEDYDEKMKEVESVCNPVIKSAYEK  649



>ref|XP_010475732.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=665

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEE
Sbjct  503  RGVPQIEVTFEVDANGILQVKAEDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEE  562

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ V+E+IDARN LETYVYNMK+ + DK+KLA+K+  E+KEK+E   KE LEWLD+N NA
Sbjct  563  DRIVREKIDARNKLETYVYNMKSTVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNA  622

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEK+KEVE+VCNP+I + Y++
Sbjct  623  EKEDYDEKMKEVESVCNPVIKSAYEK  648



>ref|XP_010458176.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=664

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEE
Sbjct  503  RGVPQIEVTFEVDANGILQVKAEDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEE  562

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ V+E+IDARN LETYVYNMK+ + DK+KLA+K+  E+KEK+E   KE LEWLD+N NA
Sbjct  563  DRIVREKIDARNKLETYVYNMKSTVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNA  622

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +KEDYDEK+KEVE+VCNP+I + Y++
Sbjct  623  KKEDYDEKMKEVESVCNPVIKSAYEK  648



>ref|XP_010458175.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=665

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE+MVREAEEFAEE
Sbjct  504  RGVPQIEVTFEVDANGILQVKAEDKVAKASQSITITNDKGRLTEEEIEKMVREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ V+E+IDARN LETYVYNMK+ + DK+KLA+K+  E+KEK+E   KE LEWLD+N NA
Sbjct  564  DRIVREKIDARNKLETYVYNMKSTVEDKEKLAEKISDEDKEKMEEVLKETLEWLDENVNA  623

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +KEDYDEK+KEVE+VCNP+I + Y++
Sbjct  624  KKEDYDEKMKEVESVCNPVIKSAYEK  649



>gb|KFK43207.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=660

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+KITITNDKGRLSQEEI+ M+REAEEFAEE
Sbjct  499  RGVPQIEVTFEVDANGILQVKAEDKVAKTSQKITITNDKGRLSQEEIDEMIREAEEFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDA+N+LETYVYNMK+ + DK+KLA+K+  E+KEKIE A KEALEWLD+N NA
Sbjct  559  DRIVKEKIDAKNNLETYVYNMKSAVADKEKLAEKISEEDKEKIEEALKEALEWLDENVNA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D++EKLK+VE+VC P+I +VY++
Sbjct  619  EKDDFEEKLKDVESVCKPVIKSVYEK  644



>gb|KFK43208.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=659

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+KITITNDKGRLSQEEI+ M+REAEEFAEE
Sbjct  498  RGVPQIEVTFEVDANGILQVKAEDKVAKTSQKITITNDKGRLSQEEIDEMIREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDA+N+LETYVYNMK+ + DK+KLA+K+  E+KEKIE A KEALEWLD+N NA
Sbjct  558  DRIVKEKIDAKNNLETYVYNMKSAVADKEKLAEKISEEDKEKIEEALKEALEWLDENVNA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D++EKLK+VE+VC P+I +VY++
Sbjct  618  EKDDFEEKLKDVESVCKPVIKSVYEK  643



>gb|AAB70400.1| Similar to Arabidopsis luminal binding protein (gb|D89342) [Arabidopsis 
thaliana]
Length=655

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEE
Sbjct  491  RGVPQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEE  550

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK +KE+IDARN LETYVYNMK+ + DK+KLA K+  E+KEK+E   KEALEWL++N NA
Sbjct  551  DKIMKEKIDARNKLETYVYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNA  610

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVE VC+P+I +VY++
Sbjct  611  EKEDYDEKLKEVELVCDPVIKSVYEK  636



>ref|NP_172382.4| protein BIP3 [Arabidopsis thaliana]
 sp|Q8H1B3.1|MD37B_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37b; AltName: Full=BiP chaperone BIP-L; AltName: 
Full=Heat shock 70 kDa protein 13; AltName: Full=Heat shock 
protein 70-13; Short=AtHsp70-13; AltName: Full=Hsp70 protein 
BiP chaperone BIP-L; AltName: Full=Luminal-binding protein 
3; Short=AtBP3; Short=BiP3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAN60163.1| BiP chaperone BIP-L [Arabidopsis thaliana]
 gb|AEE28392.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=675

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEE
Sbjct  514  RGVPQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEE  573

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK +KE+IDARN LETYVYNMK+ + DK+KLA K+  E+KEK+E   KEALEWL++N NA
Sbjct  574  DKIMKEKIDARNKLETYVYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNA  633

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVE VC+P+I +VY++
Sbjct  634  EKEDYDEKLKEVELVCDPVIKSVYEK  659



>ref|NP_001184944.1| protein BIP3 [Arabidopsis thaliana]
 gb|AEE28393.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=665

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEE
Sbjct  504  RGVPQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTEEEIEEMIREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK +KE+IDARN LETYVYNMK+ + DK+KLA K+  E+KEK+E   KEALEWL++N NA
Sbjct  564  DKIMKEKIDARNKLETYVYNMKSTVADKEKLAKKISDEDKEKMEGVLKEALEWLEENVNA  623

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKLKEVE VC+P+I +VY++
Sbjct  624  EKEDYDEKLKEVELVCDPVIKSVYEK  649



>ref|XP_005829514.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
 gb|EKX42534.1| heat shock protein 70, ER luminal [Guillardia theta CCMP2712]
Length=662

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGIL V AEDK +G+SEKITITNDKGRLSQEEI+RMV+EA+E+ EE
Sbjct  494  RGVPQIEVTFEIDANGILQVSAEDKGTGKSEKITITNDKGRLSQEEIDRMVQEAKEYEEE  553

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDA+NS+E+Y+YN+KN IND+DK+  KL  E+KE +E   K   EW+D+N +A
Sbjct  554  DKKVKERIDAKNSIESYIYNIKNTINDEDKIKGKLSDEDKETLEEIVKTTTEWIDENSSA  613

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
            EKED+DEK KEVE V NPI++ +Y
Sbjct  614  EKEDFDEKQKEVEKVVNPIMSKLY  637



>ref|XP_006848066.1| hypothetical protein AMTR_s00029p00199940 [Amborella trichopoda]
 gb|ERN09647.1| hypothetical protein AMTR_s00029p00199940 [Amborella trichopoda]
Length=281

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGILNV+AED+ + R+EKITITND  R S EE++  +REAEEFA+E
Sbjct  117  RGVPQIEVTFEVDANGILNVRAEDEGTKRAEKITITNDNRRFSDEELKEKIREAEEFAQE  176

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKE ID RN LETYVYNMK+ INDKDKLADK+ES+++E+IET  KEALEWLDDNQNA
Sbjct  177  DKKVKETIDPRNGLETYVYNMKSTINDKDKLADKIESDDQERIETGLKEALEWLDDNQNA  236

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EKED++EK+KEVE VCNPII  VY+
Sbjct  237  EKEDFEEKVKEVEEVCNPIIKHVYE  261



>ref|XP_006480058.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AEE
Sbjct  494  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEE  553

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IN+KD  KLADK++S++KEKIE+  KEALEWLDDNQ
Sbjct  554  DKNARERIDSRNKLESYIYNMRSTINEKDNNKLADKIDSDDKEKIESTLKEALEWLDDNQ  613

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            NAEK+D+DEKLKEVEAVCNP+I  VY++
Sbjct  614  NAEKDDFDEKLKEVEAVCNPVIKEVYEK  641



>emb|CBI23034.3| unnamed protein product [Vitis vinifera]
Length=648

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 122/146 (84%), Gaps = 19/146 (13%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKASG+SEKITITND                    EE
Sbjct  501  RGTPQIEVTFEVDANGILNVKAEDKASGKSEKITITND-------------------KEE  541

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+KE+IDARNSLE+YVYNMK QINDKDKLADKLESEEKEKIETA KEALEWLDDNQNA
Sbjct  542  DKKIKEKIDARNSLESYVYNMKTQINDKDKLADKLESEEKEKIETAVKEALEWLDDNQNA  601

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            E EDY EKLKEVEAVCNPIITAVYQR
Sbjct  602  ETEDYQEKLKEVEAVCNPIITAVYQR  627



>ref|XP_011092383.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=658

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVD NGIL+V AEDKA+ +S+ ITITNDKGRLS+EEI+  VREAEEFAEE
Sbjct  496  RGVPQIEVTFEVDVNGILHVTAEDKAAKKSKSITITNDKGRLSEEEIQEKVREAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D++V+ERI+ARN LETY++NMK+ INDKDK ADK+E+++KEKIETA  +A+EWLDDNQNA
Sbjct  556  DRRVRERIEARNKLETYIFNMKSTINDKDKFADKIEADDKEKIETALTDAMEWLDDNQNA  615

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            ++++  EK+KE+E VCNP++  VY++
Sbjct  616  DRDELVEKMKELEDVCNPVVKKVYEQ  641



>ref|XP_006417615.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
 gb|ESQ35968.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
Length=657

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQ+EVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE M+REAEEFAEE
Sbjct  496  RGVPQVEVTFEVDANGILQVKAEDKVAKTSQTITITNDKGRLTEEEIEEMIREAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDARN LETYVYNMK+ +NDK+KLA+K+  E+KEK+E   KEALEWL++N NA
Sbjct  556  DRIVKEKIDARNKLETYVYNMKSTLNDKEKLAEKISEEDKEKMEEVLKEALEWLEENVNA  615

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +K+DY++KLKE E+VCNP+I +VY++
Sbjct  616  DKDDYEQKLKETESVCNPVIKSVYEK  641



>ref|XP_006423186.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
 gb|ESR36426.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
Length=639

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AEE
Sbjct  490  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEE  549

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IN+KD  KLADK++S++KEKIE+  KEALEWLDDNQ
Sbjct  550  DKNARERIDSRNKLESYIYNMRSTINEKDNNKLADKIDSDDKEKIESTLKEALEWLDDNQ  609

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQ  218
            NAEK+D+DEKLKEVEAVCNP+I  VY+
Sbjct  610  NAEKDDFDEKLKEVEAVCNPVIKEVYE  636



>ref|XP_002318993.2| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE94916.2| heat shock protein 70 cognate [Populus trichocarpa]
Length=660

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+VKAEDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEE AEE
Sbjct  499  RGVPQIEVTFEVDANGILHVKAEDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEMAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV+E+IDARN LETY+YNM++ INDKDKLADK++S++KE+IETA KEALEWLDDNQNA
Sbjct  559  DKKVREKIDARNKLETYIYNMRSTINDKDKLADKIDSDDKERIETALKEALEWLDDNQNA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+DY+EKLKEVE VC+P+I  VY++
Sbjct  619  EKDDYEEKLKEVEEVCDPVIKQVYEK  644



>ref|XP_006306953.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
 gb|EOA39851.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
Length=665

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI VTF VDANGIL VKAEDK +  S+ ITITNDKGRL++EEIE+M+REAEEFAEE
Sbjct  504  RGVPQIMVTFVVDANGILQVKAEDKVAKTSQSITITNDKGRLTEEEIEKMIREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDARN LETYVYNMK+ + DK+KLA+K+  E+KEK+E   KE L+WL++N NA
Sbjct  564  DRIVKEKIDARNKLETYVYNMKSTMADKEKLAEKISDEDKEKMEEVLKEVLDWLEENVNA  623

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEK+KEVE+VCNP+I +VY++
Sbjct  624  EKEDYDEKMKEVESVCNPVIKSVYEK  649



>ref|XP_006344666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Solanum tuberosum]
Length=669

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTF+VD NGIL+V A+DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEE
Sbjct  507  RGVPQIEVTFQVDENGILHVTAQDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEE  566

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KVKE++DA+N LETY+YNMKN IN  DKLA+K++S++K+KIE A KEA EWLDDNQNA
Sbjct  567  DRKVKEKVDAQNKLETYIYNMKNTIN--DKLAEKIDSDDKKKIENALKEATEWLDDNQNA  624

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEK+K++E VCNP+I  VY++
Sbjct  625  EKEDYDEKMKDLEDVCNPVIKKVYEK  650



>ref|XP_001416181.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94474.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
Length=662

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  502  RGVPQIEVTFEIDANGILNVGAEDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEE  561

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+K KERID+RNSLET+ YNMKN I+D DKLADKL+ ++K  IE A KE L+WLD+NQ+A
Sbjct  562  DRKTKERIDSRNSLETFAYNMKNTISDSDKLADKLDDDDKNTIEEAVKETLDWLDENQSA  621

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            EKEDYDE+LK++E VCNPI+   YQ
Sbjct  622  EKEDYDEQLKQLEEVCNPIVAKAYQ  646



>ref|XP_006480059.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=501

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+
Sbjct  334  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEK  393

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IND D  KLADK++S++KEKIE+  KEALEWLDDNQ
Sbjct  394  DKNARERIDSRNKLESYIYNMRSTINDNDNNKLADKIDSDDKEKIESTLKEALEWLDDNQ  453

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            NA K+D+DEKLKEVEAVCNP+I  VY++
Sbjct  454  NAGKDDFDEKLKEVEAVCNPVIKEVYEK  481



>ref|XP_004230233.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Solanum lycopersicum]
Length=669

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 131/146 (90%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTF+VD NGIL+V A+DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEE
Sbjct  507  RGVPQIEVTFQVDENGILHVTAQDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEE  566

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KV+E++DA+N LETY+YNMKN IN  DKLA+K++S+++EKIE+A KEA EWLDDNQNA
Sbjct  567  DRKVREKVDAQNKLETYIYNMKNTIN--DKLAEKIDSDDREKIESALKEATEWLDDNQNA  624

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+DYDEK+K++E VCNP+I  VY++
Sbjct  625  EKQDYDEKMKDLEDVCNPVIKKVYEK  650



>ref|XP_009622355.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Nicotiana tomentosiformis]
Length=668

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEV+FE+D NGIL V A+DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEE
Sbjct  506  RGVPQIEVSFEIDENGILQVTAQDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEE  565

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KV+E++D+RN LETYVYNMKN IN  DKLA+K++S++KEKIE+A KEA+EW+DDNQNA
Sbjct  566  DRKVREKVDSRNKLETYVYNMKNTIN--DKLAEKIDSDDKEKIESALKEAMEWMDDNQNA  623

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEK+KE+E VCNP+I   Y++
Sbjct  624  EKEDYDEKMKELEDVCNPVIRQAYEK  649



>gb|AAA80655.1| BiP [Phaeodactylum tricornutum]
Length=659

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL V AEDK +G++EKITIT +KGRLS+EEIERMVREAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIERMVREAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDK-LADkleseekekietatkealEWLDDNQN  296
            DKKVKERIDARN LE+Y+YN+KN ++D +K LAD L +E+K++++    E L+W+D N  
Sbjct  556  DKKVKERIDARNGLESYLYNLKNTLDDDEKGLADNLSAEDKKELQDMIDETLDWMDGNPE  615

Query  295  AEKEDYDEKLKEVEAVCNPIITAVY  221
            A+KEDYDEKLKEVE V NPI+  VY
Sbjct  616  ADKEDYDEKLKEVEQVANPIMRNVY  640



>ref|XP_002178567.1| ER luminal binding protein precursor [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC50232.1| ER luminal binding protein precursor [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=659

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL V AEDK +G++EKITIT +KGRLS+EEIERMVREAEEFAEE
Sbjct  496  RGVPQIEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIERMVREAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDK-LADkleseekekietatkealEWLDDNQN  296
            DKKVKERIDARN LE+Y+YN+KN ++D +K LAD L +E+K++++    E L+W+D N  
Sbjct  556  DKKVKERIDARNGLESYLYNLKNTLDDDEKGLADNLSAEDKKELQDMIDETLDWMDGNPE  615

Query  295  AEKEDYDEKLKEVEAVCNPIITAVY  221
            A+KEDYDEKLKEVE V NPI+  VY
Sbjct  616  ADKEDYDEKLKEVEQVANPIMRNVY  640



>ref|XP_011023674.1| PREDICTED: luminal-binding protein 4-like [Populus euphratica]
Length=660

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+VKAEDKA+ +S+ ITITNDKGRLSQEEI+RMV+EAEE AEE
Sbjct  499  RGVPQIEVTFEVDANGILHVKAEDKAAKKSQSITITNDKGRLSQEEIDRMVKEAEEMAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKV+E+IDARN LETY+YNM++ INDKDKLADK++S +K++IETA KEALEWLD NQNA
Sbjct  559  DKKVREKIDARNKLETYIYNMRSTINDKDKLADKIDSGDKDRIETALKEALEWLDGNQNA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+D++EKLKEVE VC+P+I  VY++
Sbjct  619  EKDDFEEKLKEVEEVCDPVIKQVYEK  644



>ref|XP_002892480.1| hypothetical protein ARALYDRAFT_311954 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68739.1| hypothetical protein ARALYDRAFT_311954 [Arabidopsis lyrata subsp. 
lyrata]
Length=646

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 125/146 (86%), Gaps = 4/146 (3%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL VKAEDK    S+ ITITNDKGRL++EEIE M+REAEEFAEE
Sbjct  489  RGVPQIEVTFEVDANGILQVKAEDKVVKTSQSITITNDKGRLTEEEIEEMIREAEEFAEE  548

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ +KE+IDARN LETYVYNMK+ + DK+K++D    E+KEK+E   KEALEWL++N NA
Sbjct  549  DRIMKEKIDARNKLETYVYNMKSTMADKEKISD----EDKEKMEEVLKEALEWLEENVNA  604

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYD+K+KEVE+VCNP+I +VY++
Sbjct  605  EKEDYDDKMKEVESVCNPVIKSVYEK  630



>ref|XP_010553728.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37b [Tarenaya hassleriana]
Length=658

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 122/146 (84%), Gaps = 7/146 (5%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGIL+V AEDKA+ +S+KITI+N++G LSQEEI RMVREAEEFAEE
Sbjct  498  RGTPQIEVTFEVDANGILHVTAEDKAAKKSQKITISNERGSLSQEEIYRMVREAEEFAEE  557

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARN LETYVYNMK  I DK+KL DK+E E+KE+IE   KE LEWLD+NQNA
Sbjct  558  DKKVKERIDARNKLETYVYNMKGTIGDKEKLGDKIEKEDKERIEGVLKETLEWLDENQNA  617

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
                    LKEVE VCNP+I +VY++
Sbjct  618  -------XLKEVETVCNPVIKSVYEK  636



>ref|XP_006423179.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
 gb|ESR36419.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
Length=655

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+
Sbjct  488  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEK  547

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IND D  KLADK++S++KEKIE+  KEALEWLDDNQ
Sbjct  548  DKNARERIDSRNKLESYIYNMRSTINDNDNNKLADKIDSDDKEKIESTLKEALEWLDDNQ  607

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            NA K+D+DEKLKEVEAVCNP+I  VY++
Sbjct  608  NAGKDDFDEKLKEVEAVCNPVIKEVYEK  635



>ref|XP_009766974.1| PREDICTED: luminal-binding protein 5-like [Nicotiana sylvestris]
Length=667

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 130/146 (89%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEV+FE+D NGIL V A+DKA+ +S+ ITIT+DK RLSQEEI+RM++EAEEFAEE
Sbjct  506  RGVPQIEVSFEIDENGILQVTAQDKAAKKSKSITITSDKSRLSQEEIDRMLKEAEEFAEE  565

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KV+E++D+RN LETYVYNMKN I+  DKLA+K++S++KEKIE+A KEA++W+DDNQNA
Sbjct  566  DRKVREKVDSRNKLETYVYNMKNTIS--DKLAEKIDSDDKEKIESALKEAMDWMDDNQNA  623

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEK+KE+E VCNP+I   Y++
Sbjct  624  EKEDYDEKMKELEDVCNPVIRQAYEK  649



>ref|XP_005651681.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE27137.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
Length=639

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+ EKITITNDKGRLSQE+IERMV+EAEEFAE+
Sbjct  476  RGVPQIEVTFEIDANGILNVGAEDKGTGKREKITITNDKGRLSQEDIERMVQEAEEFAEQ  535

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK VK ++DARN+LETY YNMK  I  +DKL DKLE ++KEK++ A  EALEW+DDNQ+A
Sbjct  536  DKAVKAKVDARNALETYCYNMKQTI--EDKLGDKLEEDDKEKVKAAVDEALEWMDDNQDA  593

Query  292  EKEDYDEKLKEVEAVCNPIIT  230
            E+E+Y +KLKEVE VCNP+++
Sbjct  594  EEEEYKDKLKEVEDVCNPVVS  614



>ref|XP_006645985.1| PREDICTED: luminal-binding protein-like [Oryza brachyantha]
Length=728

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 128/146 (88%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQI+VTFEVDANGIL+V+A DKA+G+SE+ITI+ D  +LSQEEI+RMV EAEEFAEE
Sbjct  568  RGTPQIDVTFEVDANGILSVRAADKATGKSEQITISGDDRKLSQEEIDRMVSEAEEFAEE  627

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D++ +ER+DARNSLE YVYN+KN +  + K+AD +E+EEKEK+E A +EA EW+D NQ+A
Sbjct  628  DRRHRERVDARNSLEEYVYNVKNAV--EGKMADAMEAEEKEKVEEAVREAYEWMDSNQDA  685

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
             K+DYDEKL+E+E VCNP+++AVYQR
Sbjct  686  GKDDYDEKLRELEDVCNPVMSAVYQR  711



>ref|XP_002949576.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
 gb|EFJ49128.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
Length=653

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 124/145 (86%), Gaps = 2/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV AEDK +G+ EKITIT +KGRLSQ++IERMVREAEEFAE+
Sbjct  492  RGTPQIEVTFEVDANGILNVAAEDKGTGKKEKITITAEKGRLSQDDIERMVREAEEFAEQ  551

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK VK +IDARN LETY YNMK+ +  +DKL DK++ ++KEK+ +A KEALEWLD+N +A
Sbjct  552  DKAVKAKIDARNQLETYCYNMKSTV--EDKLKDKIDEDDKEKVLSAVKEALEWLDENSDA  609

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            + EDY EKLKEVE VCNPII  +Y+
Sbjct  610  DPEDYKEKLKEVEDVCNPIIAQIYK  634



>ref|XP_002456746.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
 gb|EES01866.1| hypothetical protein SORBIDRAFT_03g041830 [Sorghum bicolor]
Length=667

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            +GTPQIEVTFEVD NGIL+VKA DK +GRSEK+TIT+D  R+SQEE++RMV EAEEFAEE
Sbjct  503  KGTPQIEVTFEVDVNGILHVKAADKGTGRSEKVTITSDARRVSQEEMDRMVHEAEEFAEE  562

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+K +ER+DARN LETYVY +K+ + D   +ADK+ ++EKEK+E A +EA EW++ N +A
Sbjct  563  DRKARERVDARNKLETYVYQVKSAVVDDSNMADKMNADEKEKVEEAVREANEWIEVNSDA  622

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +KEDY+EKLKE+E VC+P+I+AVYQR
Sbjct  623  DKEDYEEKLKELEDVCSPVISAVYQR  648



>emb|CDX67525.1| BnaA07g15650D [Brassica napus]
Length=577

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 104/146 (71%), Gaps = 39/146 (27%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNVKAEDKAS                           EEF+EE
Sbjct  450  RGTPQIEVTFEVDANGILNVKAEDKAS---------------------------EEFSEE  482

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKERIDARNSLETYVYNMKNQ  +K+K+            E ATKEALEWLD+NQN+
Sbjct  483  DKKVKERIDARNSLETYVYNMKNQAEEKEKI------------EAATKEALEWLDENQNS  530

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+YDEKLKEVEAVCNPIITAVYQR
Sbjct  531  EKEEYDEKLKEVEAVCNPIITAVYQR  556



>ref|XP_002507118.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
 gb|ACO68376.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
Length=660

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  496  RGVPQIEVTFEIDANGILNVGAEDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+K+KER+D RNSLETY YNMKN + D DKLA KL  ++K +IE A KE L+WLDDNQNA
Sbjct  556  DRKIKERVDTRNSLETYAYNMKNTVTDDDKLASKLADDDKRQIEEAVKETLDWLDDNQNA  615

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLK++E+VCNPI++ VYQ+
Sbjct  616  EKEEYEEKLKDIESVCNPIVSRVYQQ  641



>ref|XP_004971892.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGIL+V+A DK +G+SEKITIT+D  RLSQEEI+RMVREAEEFAEE
Sbjct  504  RGTPQIEVTFEVDANGILHVQAADKGTGKSEKITITSDDRRLSQEEIDRMVREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQ-N  296
            DKKV+ER+DARN LETY+Y +K+ ++D  K+ DK++ E+KEK+E A +EA EWL+ N  +
Sbjct  564  DKKVRERVDARNKLETYIYQVKSAVDDT-KMTDKMDVEDKEKMEEAVREANEWLEGNSLD  622

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            A+KEDY+EKLKE+E VCNPII+AVYQ+
Sbjct  623  ADKEDYEEKLKELEDVCNPIISAVYQK  649



>ref|XP_006479343.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+
Sbjct  494  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEK  553

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IND D  KLA+K++S++KEKIE+  KEALEWLDDNQ
Sbjct  554  DKNARERIDSRNKLESYIYNMRSTINDNDNNKLANKIDSDDKEKIESTLKEALEWLDDNQ  613

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            NA K+D+DEKLKEVEAVCNP+I   Y++
Sbjct  614  NAGKDDFDEKLKEVEAVCNPVIKEFYEK  641



>ref|XP_006423175.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
 gb|ESR36415.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
Length=655

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+
Sbjct  488  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEK  547

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IND D  KLA+K++S++KEKIE+  KEALEWLDDNQ
Sbjct  548  DKNARERIDSRNKLESYIYNMRSTINDNDNNKLANKIDSDDKEKIESTLKEALEWLDDNQ  607

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            NA K+D+DEKLKEVEAVCNP+I   Y++
Sbjct  608  NAGKDDFDEKLKEVEAVCNPVIKEFYEK  635



>gb|EMT08654.1| Luminal-binding protein 5 [Aegilops tauschii]
Length=490

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 117/146 (80%), Gaps = 13/146 (9%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVD NGIL+VKA DK +G+SEKITITN+ GR SQEEI+RMVREAEEF EE
Sbjct  340  RGAPQIEVTFEVDVNGILHVKAADKGTGKSEKITITNEGGRHSQEEIDRMVREAEEFMEE  399

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+KVKER+DARN LE YVY++KN ++   K+AD +E ++KEK           LDDN  A
Sbjct  400  DRKVKERVDARNKLEAYVYDIKNTLD--GKMADAMEGDDKEK-----------LDDNPEA  446

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKEDYDEKL+E+E VCNP+I+A+YQR
Sbjct  447  EKEDYDEKLRELEDVCNPVISALYQR  472



>dbj|BAJ89190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVD NGIL+VKA DK +G+SEKITITN+  R SQE+I+RMVREAEEFAE 
Sbjct  504  RGTPQIEVTFEVDVNGILHVKAADKGTGKSEKITITNEGRRHSQEDIDRMVREAEEFAEA  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDN-QN  296
            D KVKER+DARN LE+YVY +K+ ++   K+AD ++ +EK K+E A +E  EWLDDN + 
Sbjct  564  DLKVKERVDARNKLESYVYGIKDTVD--GKMADAMDKDEKNKVEDAMREVNEWLDDNAEA  621

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            A+KEDYDEKL+E+E VCNPIITAVYQR
Sbjct  622  ADKEDYDEKLRELEDVCNPIITAVYQR  648



>gb|AAC15519.1| heat shock protein 70 [Toxoplasma gondii]
Length=642

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTF+VD NGIL+V A DK +G+SEKITITNDKGRL+ EEIERM+ EAE+FAEE
Sbjct  473  RGVPQIEVTFDVDRNGILSVSAVDKGTGKSEKITITNDKGRLTPEEIERMISEAEKFAEE  532

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARN+LE Y+++MK  + DKDKLADK+E ++K+ I     EA EWL+ N +A
Sbjct  533  DKKVKERVDARNALEGYLHSMKTTVEDKDKLADKIEEDDKKTILDKVTEAQEWLNTNPDA  592

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
            + E+  +KLK+VEAVCNPII+ VY
Sbjct  593  DAEETRDKLKDVEAVCNPIISKVY  616



>ref|XP_003885152.1| Heat shock protein 70 (Precursor), related [Neospora caninum 
Liverpool]
 emb|CBZ55124.1| Heat shock protein 70 (Precursor), related [Neospora caninum 
Liverpool]
Length=666

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTF+VD NGIL+V A DK +G+SEKITITNDKGRL+ EEIERM+ EAE+FAEE
Sbjct  497  RGVPQIEVTFDVDRNGILSVSAVDKGTGKSEKITITNDKGRLTPEEIERMISEAEKFAEE  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARN+LE Y+++MK  + DKDKLADK+E ++K+ I     EA EWL+ N +A
Sbjct  557  DKKVKERVDARNALEGYLHSMKTTVEDKDKLADKIEEDDKKTILDKVTEAQEWLNTNPDA  616

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
            + E+  +KLK+VEAVCNPII+ VY
Sbjct  617  DAEETRDKLKDVEAVCNPIISKVY  640



>ref|XP_008885842.1| chaperonin protein BiP [Hammondia hammondi]
 gb|KEP63548.1| chaperonin protein BiP [Hammondia hammondi]
Length=668

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTF+VD NGIL+V A DK +G+SEKITITNDKGRL+ EEIERM+ EAE+FAEE
Sbjct  499  RGVPQIEVTFDVDRNGILSVSAVDKGTGKSEKITITNDKGRLTPEEIERMISEAEKFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARN+LE Y+++MK  + DKDKLADK+E ++K+ I     EA EWL+ N +A
Sbjct  559  DKKVKERVDARNALEGYLHSMKTTVEDKDKLADKIEEDDKKTILDKVTEAQEWLNTNPDA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
            + E+  +KLK+VEAVCNPII+ VY
Sbjct  619  DAEETRDKLKDVEAVCNPIISKVY  642



>ref|XP_002364404.1| heat shock protein 70, putative [Toxoplasma gondii ME49]
 gb|AAF23321.1|AF110397_1 heat shock protein 70 precursor [Toxoplasma gondii]
 gb|EPR61088.1| chaperonin protein BiP [Toxoplasma gondii GT1]
 gb|EPT26071.1| chaperonin protein BiP [Toxoplasma gondii ME49]
 gb|ESS34998.1| chaperonin protein BiP [Toxoplasma gondii VEG]
 gb|KFG28660.1| chaperonin protein BiP [Toxoplasma gondii p89]
 gb|KFG44302.1| chaperonin protein BiP [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG55940.1| chaperonin protein BiP [Toxoplasma gondii FOU]
 gb|KFG65942.1| chaperonin protein BiP [Toxoplasma gondii RUB]
 gb|KFH09524.1| chaperonin protein BiP [Toxoplasma gondii VAND]
 gb|KFH17961.1| chaperonin protein BiP [Toxoplasma gondii MAS]
Length=668

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTF+VD NGIL+V A DK +G+SEKITITNDKGRL+ EEIERM+ EAE+FAEE
Sbjct  499  RGVPQIEVTFDVDRNGILSVSAVDKGTGKSEKITITNDKGRLTPEEIERMISEAEKFAEE  558

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKKVKER+DARN+LE Y+++MK  + DKDKLADK+E ++K+ I     EA EWL+ N +A
Sbjct  559  DKKVKERVDARNALEGYLHSMKTTVEDKDKLADKIEEDDKKTILDKVTEAQEWLNTNPDA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVY  221
            + E+  +KLK+VEAVCNPII+ VY
Sbjct  619  DAEETRDKLKDVEAVCNPIISKVY  642



>ref|XP_003055985.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH59361.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=659

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGILNV AEDK +G+SEKITITNDKGRLSQEEIERMV EAEEFAEE
Sbjct  494  RGVPQIEVTFEIDANGILNVGAEDKGTGKSEKITITNDKGRLSQEEIERMVEEAEEFAEE  553

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+K+KER+DARNSLETY YNMKN I D DKLADKL+ ++K  IE A +E L+WLDDNQN 
Sbjct  554  DRKIKERVDARNSLETYAYNMKNTIADTDKLADKLDQDDKVTIEEAVRETLDWLDDNQNG  613

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EKE+Y+EKLKE+E +CNPI++ VYQ+
Sbjct  614  EKEEYEEKLKEIEGICNPIVSKVYQQ  639



>ref|XP_006423178.1| hypothetical protein CICLE_v10029824mg [Citrus clementina]
 gb|ESR36418.1| hypothetical protein CICLE_v10029824mg [Citrus clementina]
Length=561

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQI+VTF+VDANGIL+V AEDKA+   + ITITNDKGR S+EEI+RMV+EAEE+AE+
Sbjct  394  RGVPQIQVTFDVDANGILHVTAEDKAAKNKQSITITNDKGRFSEEEIQRMVKEAEEYAEK  453

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKD--KLADkleseekekietatkealEWLDDNQ  299
            DK  +ERID+RN LE+Y+YNM++ IND D  KLA+K++S++KEKIE+  KEALEWLDDNQ
Sbjct  454  DKNARERIDSRNKLESYIYNMRSTINDNDNNKLANKIDSDDKEKIESTLKEALEWLDDNQ  513

Query  298  NAEKEDYDEKLKEVEAVCNPIITAVYQR  215
            NA K+D+D+KLKEVEAVCNP+I   Y++
Sbjct  514  NAGKDDFDKKLKEVEAVCNPVIKEFYEK  541



>ref|XP_009118328.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b [Brassica rapa]
Length=653

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 124/146 (85%), Gaps = 3/146 (2%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG  QIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL+QEEI+ M+REAEEFAEE
Sbjct  495  RGVAQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTQEEIDEMIREAEEFAEE  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDA+N LETYVYNMK+ +   +KLA+K+  E+K K+E   KEALEWL++N NA
Sbjct  555  DRIVKEKIDAKNKLETYVYNMKSSL---EKLAEKISYEDKAKMEVVLKEALEWLEENVNA  611

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+DY+EKLKEVE+VCNP+I +VY++
Sbjct  612  EKDDYEEKLKEVESVCNPVIKSVYEK  637



>emb|CDY22648.1| BnaC08g42820D [Brassica napus]
Length=605

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 126/146 (86%), Gaps = 3/146 (2%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG  QIEVTFEVDANGIL+VKAEDK +  S+ ITITNDKGRL+QEEI+ M+REAEEFAEE
Sbjct  447  RGVAQIEVTFEVDANGILHVKAEDKVAKTSQTITITNDKGRLTQEEIDEMIREAEEFAEE  506

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDA+N LETYVYNMK+ +   +KLA+K+  EEKEK+E   KEALEWL++N NA
Sbjct  507  DRIVKEKIDAKNKLETYVYNMKSSL---EKLAEKISEEEKEKMEEVLKEALEWLEENVNA  563

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+DY+EKLKEVE+VCNP+I +VY++
Sbjct  564  EKDDYEEKLKEVESVCNPVIKSVYEK  589



>ref|XP_001701685.1| binding protein 1 [Chlamydomonas reinhardtii]
 gb|EDP06660.1| binding protein 1 [Chlamydomonas reinhardtii]
Length=656

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGILNV AEDK +G+ EKITIT +KGRLSQ++IERMV+EAEEFAE+
Sbjct  494  RGTPQIEVTFEVDANGILNVAAEDKGTGKKEKITITAEKGRLSQDDIERMVKEAEEFAEQ  553

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK VK +IDARN LETY YNMK+ +  +DK+ DK+E E+KEKI  A KEALEWLD+N +A
Sbjct  554  DKAVKAKIDARNQLETYCYNMKSTV--EDKMKDKIEEEDKEKITAAVKEALEWLDENPDA  611

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            E ++Y +KLKEVE VCNPII  VY++
Sbjct  612  EPDEYKDKLKEVEDVCNPIIAEVYKK  637



>gb|KCW44694.1| hypothetical protein EUGRSUZ_L01770 [Eucalyptus grandis]
Length=572

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGI+NVKAEDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EE
Sbjct  408  RGVPQIEVTFEVDANGIVNVKAEDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREE  467

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQN-  296
            D+KVKE++DARN LE+YVY+M+  I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ 
Sbjct  468  DQKVKEKVDARNKLESYVYSMRATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDT  527

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            AEKED+DEKLKEVEAVC P+I  VY++
Sbjct  528  AEKEDFDEKLKEVEAVCTPVIKQVYEK  554



>emb|CDY06347.1| BnaA09g48560D [Brassica napus]
Length=642

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 124/146 (85%), Gaps = 3/146 (2%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG  QIEVTFEVDANGIL VKAEDK +  S+ ITITNDKGRL+QEEI+ M+REAEEFAEE
Sbjct  484  RGVAQIEVTFEVDANGILQVKAEDKVAKTSQSITITNDKGRLTQEEIDEMIREAEEFAEE  543

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ VKE+IDA+N LETYVYNMK+ +   +KLA+K+  E+K K+E   KEALEWL++N NA
Sbjct  544  DRIVKEKIDAKNKLETYVYNMKSSL---EKLAEKISYEDKAKMEEVLKEALEWLEENVNA  600

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            EK+DY+EKLKEVE+VCNP+I +VY++
Sbjct  601  EKDDYEEKLKEVESVCNPVIKSVYEK  626



>ref|XP_004971898.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGIL+V+A DK +G+SEKITIT+D  RLSQEEI+RMVREAEEFAEE
Sbjct  504  RGTPQIEVTFEVDANGILHVQAADKGTGKSEKITITSDDRRLSQEEIDRMVREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQ-N  296
            DKKV+ER+DARN LETY+Y +K+ ++D  K+ +K++ E+KEK+E A +EA EWL+ N  +
Sbjct  564  DKKVRERVDARNKLETYIYQVKSAVDDT-KMTEKMDVEDKEKMEEAVREANEWLEGNSLD  622

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            A+KEDY+EKLKE+E VCNP+ +AVYQR
Sbjct  623  ADKEDYEEKLKELEDVCNPVFSAVYQR  649



>ref|XP_010041040.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=665

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGI+NVKAEDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EE
Sbjct  501  RGVPQIEVTFEVDANGIVNVKAEDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQN-  296
            D+KVKE++DARN LE+YVY+M+  I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ 
Sbjct  561  DQKVKEKVDARNKLESYVYSMRATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDT  620

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            AEKED+DEKLKEVEAVC P+I  VY++
Sbjct  621  AEKEDFDEKLKEVEAVCTPVIKQVYEK  647



>ref|XP_004964075.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=667

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGIL+V A DK +G+SEKITIT+D  RLSQEE++RMVREAEEFAEE
Sbjct  504  RGTPQIEVTFEVDANGILHVTAADKGTGKSEKITITSDDRRLSQEEVDRMVREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQ-N  296
            D+KV+ER+DARN LETYVY +K+ ++D  K+ADK++ E+KE++E A +EA EWL+ N  +
Sbjct  564  DRKVRERVDARNKLETYVYQVKSTMDDT-KMADKMDVEDKERMEEAVREANEWLEGNSLD  622

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            A+KEDY++KLK++E VCNPII+AVYQ+
Sbjct  623  ADKEDYEDKLKQLEDVCNPIISAVYQK  649



>gb|KCW61819.1| hypothetical protein EUGRSUZ_H04513 [Eucalyptus grandis]
Length=618

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGI+NVKAEDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EE
Sbjct  454  RGVPQIEVTFEVDANGIVNVKAEDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREE  513

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQN-  296
            D+KVKE++DARN LE+YVY+M+  I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ 
Sbjct  514  DQKVKEKVDARNKLESYVYSMRATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDT  573

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            AEKED+DEKLKEVEAVC P+I  VY++
Sbjct  574  AEKEDFDEKLKEVEAVCTPVIKQVYEK  600



>ref|XP_010027237.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=667

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGI+NVKAEDKA+ ++E ITITNDKGRLSQEEIERMV EAE F EE
Sbjct  503  RGVPQIEVTFEVDANGIVNVKAEDKAAKKAESITITNDKGRLSQEEIERMVEEAERFREE  562

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQN-  296
            D+KVKE++DARN LE+YVY+M+  I DKDKLADK+++++KEKI++A +EALEWLD+NQ+ 
Sbjct  563  DQKVKEKVDARNKLESYVYSMRATIGDKDKLADKIDADDKEKIDSALREALEWLDENQDT  622

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQR  215
            AEKED+DEKLKEVEAVC P+I  VY++
Sbjct  623  AEKEDFDEKLKEVEAVCTPVIKQVYEK  649



>ref|XP_002142079.1| heat shock protein 70 [Cryptosporidium muris RN66]
 gb|EEA07730.1| heat shock protein 70, putative [Cryptosporidium muris RN66]
Length=654

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 123/146 (84%), Gaps = 0/146 (0%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+D +GIL V AEDK +G+SEKITITNDKGRLSQE+IERM++EAE+FAEE
Sbjct  492  RGVPQIEVTFEIDTDGILQVSAEDKGTGKSEKITITNDKGRLSQEDIERMIKEAEQFAEE  551

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+ ++ER+DA+N+LE Y+++M+  I+DKDKLA KLE ++KEKI+ A K+A E+L+ N  A
Sbjct  552  DRLIRERVDAKNALEGYIHSMRTSIDDKDKLAQKLEEDDKEKIKEALKDAEEFLNSNPEA  611

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            + +DY +KLKEVE +CNPII  VY +
Sbjct  612  DAQDYKDKLKEVEGICNPIIATVYGK  637



>gb|EEC83049.1| hypothetical protein OsI_28153 [Oryza sativa Indica Group]
Length=529

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V A DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFAEE
Sbjct  363  RGAPQIEVTFEVDANGILSVLAADKATGRSEKITISGDDRKISQEEIDRMVREAEEFAEE  422

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D++ +E++DARNSLE YVYN+KN +    K+AD +E EEK+K+E A +EA EWLD N +A
Sbjct  423  DRRHREQVDARNSLEAYVYNIKNTLG--GKMADAMEGEEKDKVEEAVREAYEWLDGNPDA  480

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
             KE+Y+EKL+E+E VCNP+++AVYQR
Sbjct  481  GKEEYEEKLRELEDVCNPVMSAVYQR  506



>gb|EAY91599.1| hypothetical protein OsI_13234 [Oryza sativa Indica Group]
Length=426

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVD NGIL+V A DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  261  RGVPQIEVTFEVDENGILHVTASDKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEE  320

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDN---  302
            D++V+ER+DARN LE YVY M++ + D   +A K+  +++E++E+A  EALEWL+DN   
Sbjct  321  DRRVRERVDARNRLENYVYRMRSAVRD-GGMAGKIGDDDRERMESALTEALEWLEDNDGG  379

Query  301  -QNAEKEDYDEKLKEVEAVCNPIITAVYQR  215
             + AEKEDY+EKLKEVE VC PII  VY++
Sbjct  380  ARTAEKEDYEEKLKEVEQVCGPIIKQVYKK  409



>gb|EWM22457.1| luminal binding protein [Nannochloropsis gaditana]
Length=664

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 123/146 (84%), Gaps = 1/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFE+DANGIL V AED+ +G+SEKITIT +KGRLSQ+EIERMVREAEEFA+E
Sbjct  501  RGVPQIEVTFEIDANGILQVSAEDRGTGKSEKITITAEKGRLSQDEIERMVREAEEFADE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDK-LADkleseekekietatkealEWLDDNQN  296
            DKKVKE+IDARN LE+Y+YN+KN + D++K LADKL + +K+++E    EA+EWL+DN +
Sbjct  561  DKKVKEKIDARNGLESYLYNLKNTLEDEEKGLADKLSASDKKEVEATINEAMEWLEDNAD  620

Query  295  AEKEDYDEKLKEVEAVCNPIITAVYQ  218
            A+ E+Y +K KEVE + NPI+  VYQ
Sbjct  621  ADTEEYTKKQKEVETIVNPILKEVYQ  646



>ref|NP_001061194.1| Os08g0197700 [Oryza sativa Japonica Group]
 dbj|BAD03698.1| putative Luminal binding protein 5 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF23108.1| Os08g0197700 [Oryza sativa Japonica Group]
Length=676

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL+V A DKA+GRSEKITI+ D  ++SQEEI+RMVREAEEFAEE
Sbjct  510  RGAPQIEVTFEVDANGILSVLAADKATGRSEKITISGDDRKISQEEIDRMVREAEEFAEE  569

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D++ +E++DARNSLE YVYN+KN +    K+AD +E EEK+K+E A +EA EWLD N +A
Sbjct  570  DRRHREQVDARNSLEAYVYNIKNTLG--GKMADAMEGEEKDKVEEAVREAYEWLDGNPDA  627

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
             KE+Y+EKL+E+E VCNP+++AVYQR
Sbjct  628  GKEEYEEKLRELEDVCNPVMSAVYQR  653



>ref|XP_011088129.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=656

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 127/146 (87%), Gaps = 3/146 (2%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEV FEVD NGIL+V+AEDKA+ +SE ITITN+KGRLS+EEIE  VREAEEFAEE
Sbjct  496  RGVPQIEVAFEVDVNGILHVQAEDKAAKKSESITITNEKGRLSEEEIEEKVREAEEFAEE  555

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D+  +ERI+ARN LETY++NMK+ IN   KLA+++ SE+KE+IE+A K+A+EWLD+NQ+A
Sbjct  556  DRMTRERIEARNRLETYIFNMKSTIN---KLAEQISSEDKEEIESALKDAMEWLDENQHA  612

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +K++ DE+ +E+EA+CNPIIT VY++
Sbjct  613  DKDELDERTRELEALCNPIITKVYEK  638



>gb|EMT02696.1| Luminal-binding protein [Aegilops tauschii]
Length=643

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQ+EVTF+VD NGIL+VKA DK +G+SEKITITN+  R SQE+I+RMVREAEEFAE 
Sbjct  495  RGTPQLEVTFDVDVNGILHVKAADKGTGKSEKITITNEDRRHSQEDIDRMVREAEEFAEA  554

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            D K+KER+DARN LETYVY++KN ++   K+AD +E +EKEK++ A +E  EWLDDN  A
Sbjct  555  DHKLKERVDARNKLETYVYSIKNTVD--TKMADAMERDEKEKVQDALREVNEWLDDNTEA  612

Query  292  EKEDYDEKLKEVEAVCNPIITA  227
            EKEDYDEKL+E+E VCNPIIT+
Sbjct  613  EKEDYDEKLREMEDVCNPIITS  634



>gb|KDO35486.1| luminal-binding protein 2 [Saprolegnia parasitica CBS 223.65]
Length=615

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL V AEDK +G++EKITIT +KGRLSQEEI+RMV+EAEE AEE
Sbjct  453  RGVPQIEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEE  512

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DKK+K+RID RNSLE Y+YN+KN +  +DKLADK++ E+K+ +  A +EA++WLD+NQ A
Sbjct  513  DKKIKDRIDGRNSLEGYLYNLKNNV--EDKLADKIDDEDKDTVLKAVQEAMDWLDENQEA  570

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            +KED+D + K VE V NPI++ VYQ
Sbjct  571  DKEDFDAQQKAVEKVVNPIMSKVYQ  595



>ref|NP_001051048.1| Os03g0710500 [Oryza sativa Japonica Group]
 gb|AAX95660.1| dnaK protein [Oryza sativa Japonica Group]
 gb|ABF98501.1| Luminal binding protein 5 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12962.1| Os03g0710500 [Oryza sativa Japonica Group]
Length=669

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVD NGIL+V A DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  504  RGVPQIEVTFEVDENGILHVTASDKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEE  563

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDN---  302
            D++V+ER+DARN LE YVY M++ + D   +A K+  +++E++E+A  EALEWL+DN   
Sbjct  564  DRRVRERVDARNRLENYVYRMRSAVRD-GGMAGKIGDDDRERMESALTEALEWLEDNDGG  622

Query  301  -QNAEKEDYDEKLKEVEAVCNPIITAVYQR  215
             + AEKEDY+EKLKEVE VC PII  VY++
Sbjct  623  ARTAEKEDYEEKLKEVEQVCGPIIKQVYKK  652



>emb|CCI50234.1| unnamed protein product [Albugo candida]
Length=665

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVDANGIL V AEDK +G++EKITIT +KGRLS+EEI+RMV+EAEEFA+E
Sbjct  501  RGVPQIEVTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSEEEIQRMVQEAEEFADE  560

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK++KERID RN+LE Y+YN+K+Q++  DKLADK+E ++KE +  A ++AL+WL+DNQ A
Sbjct  561  DKRIKERIDGRNALEGYLYNLKSQVD--DKLADKIEEDDKETVSNAVQDALDWLEDNQEA  618

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQ  218
            +K D++ K KEVE + NPI+  +YQ
Sbjct  619  DKPDFEAKQKEVEKIVNPIMAKLYQ  643



>gb|EEE59790.1| hypothetical protein OsJ_12307 [Oryza sativa Japonica Group]
Length=726

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 5/150 (3%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RG PQIEVTFEVD NGIL+V A DKA+GRS+ ITITNDKGRLSQEEI+RMVREAEEFAEE
Sbjct  561  RGVPQIEVTFEVDENGILHVTASDKAAGRSKSITITNDKGRLSQEEIDRMVREAEEFAEE  620

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDN---  302
            D++V+ER+DARN LE YVY M++ + D   +A K+  +++E++E+A  EALEWL+DN   
Sbjct  621  DRRVRERVDARNRLENYVYRMRSAVRD-GGMAGKIGDDDRERMESALTEALEWLEDNDGG  679

Query  301  -QNAEKEDYDEKLKEVEAVCNPIITAVYQR  215
             + AEKEDY+EKLKEVE VC PII  VY++
Sbjct  680  ARTAEKEDYEEKLKEVEQVCGPIIKQVYKK  709



>ref|XP_001701884.1| binding protein 2 [Chlamydomonas reinhardtii]
 gb|EDP06859.1| binding protein 2 [Chlamydomonas reinhardtii]
Length=662

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -2

Query  652  RGTPQIEVTFEVDANGILNVKAEDKASGRSEKITITNDKGRLSQeeiermvreaeEFAEE  473
            RGTPQIEVTFEVDANGIL V A+DK +G+ EKITIT +KGRLSQ++IERMV+EAEEFAE+
Sbjct  497  RGTPQIEVTFEVDANGILTVSAQDKGTGKKEKITITAEKGRLSQDDIERMVKEAEEFAEQ  556

Query  472  DKKVKERIDARNSLETYVYNMKNQINDKDKLADkleseekekietatkealEWLDDNQNA  293
            DK VK +IDARN LETY YNMKN +  +DK+ DK+E E+KEKI  A KEALEWLD+N +A
Sbjct  557  DKAVKAKIDARNQLETYCYNMKNTV--EDKMKDKIEEEDKEKITAAVKEALEWLDENPDA  614

Query  292  EKEDYDEKLKEVEAVCNPIITAVYQR  215
            +  +Y ++LKEVE VCNPII  VY++
Sbjct  615  DTSEYKDRLKEVEDVCNPIIAEVYKK  640



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340