BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045G10

Length=819
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338736.1|  PREDICTED: RING finger protein 10-like             200   3e-55   Solanum tuberosum [potatoes]
ref|XP_009800276.1|  PREDICTED: RING finger protein 10                  199   5e-55   Nicotiana sylvestris
ref|XP_010315901.1|  PREDICTED: RING finger protein 10                  196   6e-54   Solanum lycopersicum
ref|XP_009599649.1|  PREDICTED: RING finger protein 10                  191   5e-52   Nicotiana tomentosiformis
gb|KDO43573.1|  hypothetical protein CISIN_1g003879mg                   190   8e-52   Citrus sinensis [apfelsine]
ref|XP_006468890.1|  PREDICTED: RING finger protein 10-like             190   1e-51   Citrus sinensis [apfelsine]
gb|KDO43572.1|  hypothetical protein CISIN_1g003879mg                   190   1e-51   Citrus sinensis [apfelsine]
ref|XP_006446937.1|  hypothetical protein CICLE_v10014332mg             190   1e-51   Citrus clementina [clementine]
ref|XP_010249226.1|  PREDICTED: RING finger protein 10 isoform X2       187   9e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010249224.1|  PREDICTED: RING finger protein 10 isoform X1       187   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_011097256.1|  PREDICTED: RING finger protein 10                  183   3e-49   Sesamum indicum [beniseed]
ref|XP_007032022.1|  RING/U-box superfamily protein, putative iso...    180   4e-48   Theobroma cacao [chocolate]
ref|XP_002512841.1|  conserved hypothetical protein                     177   4e-47   Ricinus communis
emb|CBI21277.3|  unnamed protein product                                176   8e-47   Vitis vinifera
ref|XP_002275712.2|  PREDICTED: RING finger protein 10 isoform X1       176   1e-46   Vitis vinifera
ref|XP_011006127.1|  PREDICTED: RING finger protein 10                  176   1e-46   Populus euphratica
emb|CDP16737.1|  unnamed protein product                                175   2e-46   Coffea canephora [robusta coffee]
ref|XP_010682974.1|  PREDICTED: RING finger protein 10 isoform X2       174   4e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB70712.1|  hypothetical protein B456_011G088400                    172   4e-45   Gossypium raimondii
gb|KJB70711.1|  hypothetical protein B456_011G088400                    171   4e-45   Gossypium raimondii
ref|XP_010682973.1|  PREDICTED: RING finger protein 10 isoform X1       171   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008347985.1|  PREDICTED: RING finger protein 10-like isofo...    171   7e-45   
ref|XP_008231028.1|  PREDICTED: RING finger protein 10 isoform X3       171   9e-45   Prunus mume [ume]
ref|XP_008231029.1|  PREDICTED: RING finger protein 10 isoform X4       171   1e-44   Prunus mume [ume]
ref|XP_007214972.1|  hypothetical protein PRUPE_ppa001768mg             171   1e-44   Prunus persica
ref|XP_008231025.1|  PREDICTED: RING finger protein 10 isoform X1       170   1e-44   Prunus mume [ume]
ref|XP_008231027.1|  PREDICTED: RING finger protein 10 isoform X2       170   1e-44   Prunus mume [ume]
ref|XP_007161621.1|  hypothetical protein PHAVU_001G084800g             170   1e-44   Phaseolus vulgaris [French bean]
ref|XP_007214973.1|  hypothetical protein PRUPE_ppa001768mg             170   1e-44   Prunus persica
ref|XP_010660682.1|  PREDICTED: RING finger protein 10 isoform X2       169   2e-44   Vitis vinifera
ref|XP_008347984.1|  PREDICTED: RING finger protein 10-like isofo...    169   3e-44   
ref|XP_003624500.1|  RING finger protein                                168   7e-44   Medicago truncatula
ref|XP_010028937.1|  PREDICTED: RING finger protein 10                  167   1e-43   Eucalyptus grandis [rose gum]
gb|KHN28587.1|  RING finger protein 10                                  167   2e-43   Glycine soja [wild soybean]
ref|XP_003553982.1|  PREDICTED: RING finger protein 10-like isofo...    166   3e-43   Glycine max [soybeans]
ref|XP_010096031.1|  RING finger protein 10                             166   5e-43   
ref|XP_009378043.1|  PREDICTED: RING finger protein 10 isoform X5       164   2e-42   Pyrus x bretschneideri [bai li]
gb|EYU34830.1|  hypothetical protein MIMGU_mgv1a002265mg                162   7e-42   Erythranthe guttata [common monkey flower]
gb|KDP41854.1|  hypothetical protein JCGZ_26872                         162   1e-41   Jatropha curcas
ref|XP_009378041.1|  PREDICTED: RING finger protein 10 isoform X3       161   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_008362084.1|  PREDICTED: RING finger protein 10-like isofo...    161   2e-41   
ref|XP_009378042.1|  PREDICTED: RING finger protein 10 isoform X4       161   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009378039.1|  PREDICTED: RING finger protein 10 isoform X1       161   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009378040.1|  PREDICTED: RING finger protein 10 isoform X2       160   4e-41   Pyrus x bretschneideri [bai li]
ref|XP_008791034.1|  PREDICTED: RING finger protein 10                  159   5e-41   Phoenix dactylifera
ref|XP_008362083.1|  PREDICTED: RING finger protein 10-like isofo...    160   8e-41   
ref|XP_011468214.1|  PREDICTED: RING finger protein 10                  158   3e-40   Fragaria vesca subsp. vesca
ref|XP_002320428.2|  hypothetical protein POPTR_0014s14220g             155   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010929676.1|  PREDICTED: RING finger protein 10                  152   5e-38   Elaeis guineensis
ref|XP_006598997.1|  PREDICTED: RING finger protein 10-like             150   8e-38   
gb|KHM99214.1|  RING finger protein 10                                  150   1e-37   Glycine soja [wild soybean]
ref|XP_008450025.1|  PREDICTED: RING finger protein 10 isoform X2       149   4e-37   Cucumis melo [Oriental melon]
gb|KGN58249.1|  hypothetical protein Csa_3G599440                       147   7e-37   Cucumis sativus [cucumbers]
ref|XP_008450024.1|  PREDICTED: RING finger protein 10 isoform X1       148   1e-36   Cucumis melo [Oriental melon]
ref|XP_004159146.1|  PREDICTED: RING finger protein 10-like             146   2e-36   
ref|XP_004145702.1|  PREDICTED: RING finger protein 10-like             146   5e-36   Cucumis sativus [cucumbers]
ref|XP_004493075.1|  PREDICTED: RING finger protein 10-like isofo...    144   4e-35   Cicer arietinum [garbanzo]
ref|XP_002875336.1|  hypothetical protein ARALYDRAFT_484446             143   7e-35   
ref|XP_004493074.1|  PREDICTED: RING finger protein 10-like isofo...    140   1e-33   
ref|XP_006290605.1|  hypothetical protein CARUB_v10016694mg             139   1e-33   Capsella rubella
emb|CDY28532.1|  BnaC02g36280D                                          138   3e-33   Brassica napus [oilseed rape]
ref|XP_009129487.1|  PREDICTED: RING finger protein 10 isoform X2       137   6e-33   
ref|XP_009129485.1|  PREDICTED: RING finger protein 10 isoform X1       137   6e-33   
emb|CDY48977.1|  BnaA02g28190D                                          137   1e-32   Brassica napus [oilseed rape]
ref|XP_010514334.1|  PREDICTED: RING finger protein 10-like             135   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006844483.1|  hypothetical protein AMTR_s00016p00109400          134   8e-32   Amborella trichopoda
ref|XP_010502612.1|  PREDICTED: RING finger protein 10-like             134   9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010425391.1|  PREDICTED: RING finger protein 10-like             133   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006395529.1|  hypothetical protein EUTSA_v10003691mg             133   3e-31   Eutrema salsugineum [saltwater cress]
gb|KFK33594.1|  hypothetical protein AALP_AA5G034200                    132   6e-31   Arabis alpina [alpine rockcress]
ref|NP_001046958.1|  Os02g0516600                                       130   2e-30   
gb|EEC73269.1|  hypothetical protein OsI_07406                          130   3e-30   Oryza sativa Indica Group [Indian rice]
gb|EEE57081.1|  hypothetical protein OsJ_06908                          130   3e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EPS67903.1|  hypothetical protein M569_06871                         128   3e-30   Genlisea aurea
ref|XP_009405452.1|  PREDICTED: RING finger protein 10 isoform X1       129   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405454.1|  PREDICTED: RING finger protein 10 isoform X2       127   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011006118.1|  PREDICTED: uncharacterized protein LOC105112205    117   6e-29   Populus euphratica
ref|XP_006647257.1|  PREDICTED: RING finger protein 10-like             125   8e-29   
ref|XP_010528130.1|  PREDICTED: RING finger protein 10 isoform X1       125   2e-28   Tarenaya hassleriana [spider flower]
gb|ACN34207.1|  unknown                                                 124   2e-28   Zea mays [maize]
ref|XP_010528131.1|  PREDICTED: RING finger protein 10 isoform X2       124   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_002453901.1|  hypothetical protein SORBIDRAFT_04g021110          123   7e-28   Sorghum bicolor [broomcorn]
ref|NP_189307.2|  RING/U-box domain-containing protein                  123   8e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK00968.1|  predicted protein                                      122   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152489.1|  LOC100286129                                       121   2e-27   
ref|XP_004952585.1|  PREDICTED: RING finger protein 10-like             118   5e-26   Setaria italica
ref|XP_003575036.1|  PREDICTED: RING finger protein 10                  117   1e-25   Brachypodium distachyon [annual false brome]
gb|EMT18775.1|  RING finger protein 10                                  106   5e-23   
emb|CAA66823.1|  hypothetical protein                                   100   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290606.1|  hypothetical protein CARUB_v10016694mg             103   3e-21   
gb|ACN41106.1|  unknown                                               93.2    1e-17   Picea sitchensis
emb|CDX71433.1|  BnaC04g16680D                                        72.4    2e-12   
ref|XP_002977414.1|  hypothetical protein SELMODRAFT_443565           69.7    4e-10   
ref|XP_002974997.1|  hypothetical protein SELMODRAFT_442720           68.6    1e-09   
gb|KDO43574.1|  hypothetical protein CISIN_1g003879mg                 63.2    6e-08   Citrus sinensis [apfelsine]
gb|AFW71577.1|  hypothetical protein ZEAMMB73_891715                  63.2    6e-08   
ref|XP_001753592.1|  predicted protein                                63.2    8e-08   
ref|XP_007032023.1|  RING/U-box superfamily protein, putative iso...  61.6    2e-07   
gb|KCW55769.1|  hypothetical protein EUGRSUZ_I01601                   59.7    8e-07   Eucalyptus grandis [rose gum]
ref|XP_008450027.1|  PREDICTED: RING finger protein 10 isoform X3     55.8    2e-05   
ref|XP_008450028.1|  PREDICTED: RING finger protein 10 isoform X4     55.5    2e-05   



>ref|XP_006338736.1| PREDICTED: RING finger protein 10-like [Solanum tuberosum]
Length=715

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 139/189 (74%), Gaps = 7/189 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL K++P DALSPFM EI++REKQRK +AR E +E++KAE  G    PL +
Sbjct  533  TTTFQLCEIDLSKIMPMDALSPFMEEIRSREKQRKWLARKERREQVKAEAIGMYLEPLPF  592

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavA-GKLLFSNVARLGFAAGHDSPALK  461
            + ++ S+  QP F++DDFEALG+++V  +S  + V  G+ LFSNVARLGFAAG D PALK
Sbjct  593  SFSEPSFTEQPTFTSDDFEALGSTSVTVTSSSSPVPGGRQLFSNVARLGFAAGCDPPALK  652

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
            ++      E+++++S   G    G LSFANVTS+AK VE PN SK ++ GK+GKKPNR+L
Sbjct  653  MD------ESARDSSVAAGTSRPGILSFANVTSKAKAVEGPNASKTNDAGKRGKKPNRIL  706

Query  280  LSTSSSRRY  254
            +STS  RRY
Sbjct  707  MSTSGGRRY  715



>ref|XP_009800276.1| PREDICTED: RING finger protein 10 [Nicotiana sylvestris]
Length=732

 Score =   199 bits (507),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 139/189 (74%), Gaps = 4/189 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL KMLP DALSPFM EIK+REKQRK +AR E +EK+KAE  G    PL  
Sbjct  547  TTTFQLCEIDLSKMLPMDALSPFMEEIKSREKQRKWLARKELREKVKAEAIGMHLEPLPL  606

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavA-GKLLFSNVARLGFAAGHDSPALK  461
            + A  SY  QP F++DDFEALG+++   +S  + V  GK LFS+VARLGFAAG D PALK
Sbjct  607  SFAGPSYTEQPNFTSDDFEALGSTSTTVTSSSSLVPGGKQLFSSVARLGFAAGCDPPALK  666

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
             ++  P+ +++   S  +G K +GTLSFANVTS+AK VE PN SK+++ GK+GKKP R+L
Sbjct  667  TDE--PRRDSTV-ASVLSGTKSSGTLSFANVTSKAKAVEGPNASKSNDAGKRGKKPTRIL  723

Query  280  LSTSSSRRY  254
            +STS  RRY
Sbjct  724  MSTSGGRRY  732



>ref|XP_010315901.1| PREDICTED: RING finger protein 10 [Solanum lycopersicum]
Length=718

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 7/189 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL K++P DALSPFM EI++REKQR  +AR E +E++KAE  G    PL +
Sbjct  536  TTTFQLCEIDLSKIMPMDALSPFMEEIRSREKQRTWLARKERREQVKAEAIGMYLEPLPF  595

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavA-GKLLFSNVARLGFAAGHDSPALK  461
            + ++ S+  QP F+++DFEALG+++V  +S  + V  G+ LFSNVARLGFAAG D PALK
Sbjct  596  SFSEPSFTEQPTFTSNDFEALGSTSVTVTSSSSPVPGGRQLFSNVARLGFAAGCDPPALK  655

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
            ++      E+++ +S   G +  G LSFANVTS+AK VE PN SK+++ GK+GKKPNR+L
Sbjct  656  MD------ESARGSSVAAGTRSPGILSFANVTSKAKAVEGPNASKSNDAGKRGKKPNRIL  709

Query  280  LSTSSSRRY  254
            +STS  RRY
Sbjct  710  MSTSGGRRY  718



>ref|XP_009599649.1| PREDICTED: RING finger protein 10 [Nicotiana tomentosiformis]
Length=783

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 139/190 (73%), Gaps = 5/190 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL K+LP DALSPFM EIK+REKQRK +AR E +EK+KAE  G    PL +
Sbjct  597  TTTFQLCEIDLSKILPMDALSPFMEEIKSREKQRKWLARKELREKVKAEAIGMHLEPLPF  656

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavA-GKLLFSNVARLGFAAGHDSPALK  461
            + A  SY  QP F++DDFEALG+++   +S  + V  GK LFSNVARLGFAAG D PALK
Sbjct  657  SFAGPSYTEQPNFTSDDFEALGSTSTTVTSSSSLVPGGKQLFSNVARLGFAAGCDLPALK  716

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASE-VGKKGKKPNRV  284
             ++  P+ +++   S  +G + + TLSFANVTS+AK VE  N SK+++  GK+GKKPNR+
Sbjct  717  TDE--PRRDSTV-ASVLSGTRSSETLSFANVTSKAKAVEGSNASKSNDAAGKRGKKPNRI  773

Query  283  LLSTSSSRRY  254
            L+STS  RRY
Sbjct  774  LMSTSGGRRY  783



>gb|KDO43573.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=685

 Score =   190 bits (483),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 132/190 (69%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL + LP DALSPF+ EI+ REKQRK++A  E +EKMKAE       P   
Sbjct  497  TTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKERKEKMKAEAALVHSVPPVP  556

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   +SY   P FS DDFEALGNS V SSSPP     + LFSNV RLGFAAGHDSPALK+
Sbjct  557  SFGQSSYNDSPTFSMDDFEALGNSPVASSSPPNVGE-RRLFSNVTRLGFAAGHDSPALKI  615

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+T  L   E S + SG TG +++G+ SFAN+ SR K+ E     K +EVGKKGKKP+RV
Sbjct  616  EETNALNNNEQSNSYSGVTGSRNSGSPSFANIMSRDKSGESLEARKLNEVGKKGKKPSRV  675

Query  283  LLSTSSSRRY  254
            LLSTS  RRY
Sbjct  676  LLSTSGGRRY  685



>ref|XP_006468890.1| PREDICTED: RING finger protein 10-like [Citrus sinensis]
Length=789

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 132/190 (69%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL + LP DALSPF+ EI+ REKQRK++A  E +EKMKAE       P   
Sbjct  601  TTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKERKEKMKAEAALVHSVPPVP  660

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   +SY   P FS DDFEALGNS V SSSPP     + LFSNV RLGFAAGHDSPALK+
Sbjct  661  SFGQSSYNDSPTFSMDDFEALGNSPVASSSPPNVGE-RRLFSNVTRLGFAAGHDSPALKI  719

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+T  L   E S + SG TG +++G+ SFAN+ SR K+ E     K +EVGKKGKKP+RV
Sbjct  720  EETNALNNNEQSNSYSGVTGSRNSGSPSFANIMSRDKSGESLEARKLNEVGKKGKKPSRV  779

Query  283  LLSTSSSRRY  254
            LLSTS  RRY
Sbjct  780  LLSTSGGRRY  789



>gb|KDO43572.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=789

 Score =   190 bits (483),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 132/190 (69%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL + LP DALSPF+ EI+ REKQRK++A  E +EKMKAE       P   
Sbjct  601  TTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKERKEKMKAEAALVHSVPPVP  660

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   +SY   P FS DDFEALGNS V SSSPP     + LFSNV RLGFAAGHDSPALK+
Sbjct  661  SFGQSSYNDSPTFSMDDFEALGNSPVASSSPPNVGE-RRLFSNVTRLGFAAGHDSPALKI  719

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+T  L   E S + SG TG +++G+ SFAN+ SR K+ E     K +EVGKKGKKP+RV
Sbjct  720  EETNALNNNEQSNSYSGVTGSRNSGSPSFANIMSRDKSGESLEARKLNEVGKKGKKPSRV  779

Query  283  LLSTSSSRRY  254
            LLSTS  RRY
Sbjct  780  LLSTSGGRRY  789



>ref|XP_006446937.1| hypothetical protein CICLE_v10014332mg [Citrus clementina]
 gb|ESR60177.1| hypothetical protein CICLE_v10014332mg [Citrus clementina]
Length=789

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 131/190 (69%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL + LP DALSPF+ EI+ REKQRK++A  E +EKMKAE       P   
Sbjct  601  TTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKERKEKMKAEAALVHSVPPVP  660

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   +SY   P FS DDFEALGNS V SSSPP     + LFSNV RLGFAAGHDSPALK+
Sbjct  661  SFGQSSYNDSPTFSMDDFEALGNSPVTSSSPPNVGE-RRLFSNVTRLGFAAGHDSPALKI  719

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+T  L   E S   SG TG +++G+ SFAN+ SR K+ E     K +EVGKKGKKP+RV
Sbjct  720  EETNALNNNEQSNGYSGVTGSRNSGSPSFANIMSRDKSGESLEARKLNEVGKKGKKPSRV  779

Query  283  LLSTSSSRRY  254
            LLSTS  RRY
Sbjct  780  LLSTSGGRRY  789



>ref|XP_010249226.1| PREDICTED: RING finger protein 10 isoform X2 [Nelumbo nucifera]
Length=707

 Score =   187 bits (475),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL +MLP DALSPF+ EIK RE QRKR+A+ E QEK+KAE        +  
Sbjct  520  TTTFQLCEIDLTEMLPPDALSPFIEEIKKRENQRKRLAKKERQEKIKAEAAAMNAMSIPS  579

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            N   +SY     FS DDFEALGNS + +S P      K LFS+V RLGFAAGHDSP+LK+
Sbjct  580  NYPHSSY-KDTTFSMDDFEALGNSTIPTSGPTIIGERK-LFSDVTRLGFAAGHDSPSLKV  637

Query  457  E--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E  D L  TEA+ N SG TG + A TLSFAN+ S A + E  +V K +  GKKGKKP RV
Sbjct  638  ESSDGLSNTEAATNASGLTGPRSAATLSFANIISTANSSESLDVPKMNGFGKKGKKPTRV  697

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  698  LLSTAGGRRY  707



>ref|XP_010249224.1| PREDICTED: RING finger protein 10 isoform X1 [Nelumbo nucifera]
Length=750

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL +MLP DALSPF+ EIK RE QRKR+A+ E QEK+KAE        +  
Sbjct  563  TTTFQLCEIDLTEMLPPDALSPFIEEIKKRENQRKRLAKKERQEKIKAEAAAMNAMSIPS  622

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            N   +SY     FS DDFEALGNS + +S P      K LFS+V RLGFAAGHDSP+LK+
Sbjct  623  NYPHSSY-KDTTFSMDDFEALGNSTIPTSGPTIIGERK-LFSDVTRLGFAAGHDSPSLKV  680

Query  457  E--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E  D L  TEA+ N SG TG + A TLSFAN+ S A + E  +V K +  GKKGKKP RV
Sbjct  681  ESSDGLSNTEAATNASGLTGPRSAATLSFANIISTANSSESLDVPKMNGFGKKGKKPTRV  740

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  741  LLSTAGGRRY  750



>ref|XP_011097256.1| PREDICTED: RING finger protein 10 [Sesamum indicum]
Length=749

 Score =   183 bits (465),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEID+  +LPA++LSPFM EIKNREKQRKR+A+ E ++K+KAE    Q  P+ Y
Sbjct  566  TTTFQLCEIDVRDVLPAESLSPFMDEIKNREKQRKRLAKKELKDKIKAEAACNQLVPVQY  625

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
               D      P+FS DDFEALG+ AV SSS P     +L FS+VA+LGFAA HDSPALK 
Sbjct  626  YSCDVP----PSFSMDDFEALGSPAVASSSLPTVGE-RLSFSSVAKLGFAAAHDSPALKT  680

Query  457  EDTL--PKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++    PK +  Q +S   G ++AG  SFAN+TSRAK VE  +  K +EVGKKGKKP+RV
Sbjct  681  DEIQAPPKIDLPQESSSAIGWRNAGA-SFANITSRAKHVEVQHTPKVNEVGKKGKKPSRV  739

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  740  LLSTAGGRRY  749



>ref|XP_007032022.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02948.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=741

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 133/191 (70%), Gaps = 7/191 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET-TGFQYAPLS  641
            TT FQLCEIDL  +LP DAL PFM EIK REK RK++AR E +EK+KAE     Q+ P+ 
Sbjct  555  TTTFQLCEIDLSGVLPPDALLPFMDEIKKREKHRKQLARKERKEKIKAEVAAAVQFTPMI  614

Query  640  YNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             +L  +SY   P FS DDFEALG+S  ISSSP      K LFSNV RLGFAA HDSP+LK
Sbjct  615  SSLGRSSYSDSPTFSMDDFEALGSSTTISSSPVVIGERK-LFSNVTRLGFAAAHDSPSLK  673

Query  460  LED--TLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            +++  T+   + + ++   TG K++GT SFANV SRAK VE+    K +E+GKKGKK +R
Sbjct  674  IDEGNTVQNNDVATDS---TGSKNSGTPSFANVISRAKAVENLETPKMNEMGKKGKKASR  730

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  731  VLLSTAGGRRY  741



>ref|XP_002512841.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49344.1| conserved hypothetical protein [Ricinus communis]
Length=746

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 10/196 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL ++LP DAL PFM EIK REKQRK +A+ E +EK+KAE      + LS 
Sbjct  553  TTTFQLCEIDLSEVLPPDALFPFMDEIKKREKQRKELAKKERKEKIKAEAAAHPDSILSG  612

Query  637  NLADTSYVGQ-PAFSNDDFEALGNsavisssppaavAG-----KLLFSNVARLGFAAGHD  476
              +  S++   P FS DDFEALG+S  + SSPP + +      K+LFSNV RLGFAAGHD
Sbjct  613  --SGHSFLNDSPKFSMDDFEALGSSTAMPSSPPMSSSPPVVGEKILFSNVTRLGFAAGHD  670

Query  475  SPALKLEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKG  302
            SP LK+E+T  L   + + +++G +G ++ GT +FAN+TSR  + E+ NVSK +E+GKKG
Sbjct  671  SPTLKIEETSALHSNKVTNDSTGVSGTRNTGTPTFANITSRMNSGENLNVSKMNEIGKKG  730

Query  301  KKPNRVLLSTSSSRRY  254
            KK NRVL+ST+  RRY
Sbjct  731  KKQNRVLMSTAGGRRY  746



>emb|CBI21277.3| unnamed protein product [Vitis vinifera]
Length=685

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL ++LP  A  PFM EIK RE+QRK++AR + +EK+KAE T     P+  
Sbjct  499  TTTFQLCEIDLREVLPPSAFFPFMDEIKKRERQRKKLARKDTKEKLKAEATTTDSLPIPS  558

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
               +  YV  P FS DDFEALG+  V S+SPP     K LFSNV +LGFAAGHDSP LK+
Sbjct  559  RFGE--YVYPPTFSIDDFEALGSPVVTSTSPPTFGERK-LFSNVTKLGFAAGHDSPGLKI  615

Query  457  ED--TLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+  ++  T  + ++SG TG ++AGT SFANV SR K+VE  + SK    GKKGKK N++
Sbjct  616  EEVHSVHSTSMASDSSGVTGSRNAGTPSFANVISRGKSVESLDASKTIGTGKKGKKSNQI  675

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  676  LLSTAGGRRY  685



>ref|XP_002275712.2| PREDICTED: RING finger protein 10 isoform X1 [Vitis vinifera]
Length=765

 Score =   176 bits (446),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 130/190 (68%), Gaps = 5/190 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL ++LP  A  PFM EIK RE+QRK++AR + +EK+KAE T     P+  
Sbjct  579  TTTFQLCEIDLREVLPPSAFFPFMDEIKKRERQRKKLARKDTKEKLKAEATTTDSLPIPS  638

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
               +  YV  P FS DDFEALG+  V S+SPP     K LFSNV +LGFAAGHDSP LK+
Sbjct  639  RFGE--YVYPPTFSIDDFEALGSPVVTSTSPPTFGERK-LFSNVTKLGFAAGHDSPGLKI  695

Query  457  ED--TLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+  ++  T  + ++SG TG ++AGT SFANV SR K+VE  + SK    GKKGKK N++
Sbjct  696  EEVHSVHSTSMASDSSGVTGSRNAGTPSFANVISRGKSVESLDASKTIGTGKKGKKSNQI  755

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  756  LLSTAGGRRY  765



>ref|XP_011006127.1| PREDICTED: RING finger protein 10 [Populus euphratica]
Length=737

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 124/190 (65%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL   LP +AL PFM EIK REK RK++A  E +EK+KAE       P   
Sbjct  549  TTTFQLCEIDLNAALPPNALLPFMDEIKKREKLRKQLANKERKEKIKAEAAASASMPTLP  608

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   +SY   P FS +DFEALG      SS P     ++LFSNVAR GFAAGHDSPALK+
Sbjct  609  SFGQSSYDTSPNFSMEDFEALG-ICSPMSSSPPVAGERILFSNVARFGFAAGHDSPALKI  667

Query  457  EDTLP--KTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+ +P    +   N+S   G +++G  SFANVT+R K  E+ + SK +EV KKGKKPNRV
Sbjct  668  EENVPLQNNKPGNNSSNLNGSRNSGPSSFANVTARPKPEENVDPSKMNEVSKKGKKPNRV  727

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  728  LLSTTGGRRY  737



>emb|CDP16737.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 131/190 (69%), Gaps = 10/190 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            T  FQ CEIDL ++LPAD+LSPF+ EI+NREKQRKRVAR EH++K+KAE     YA +S 
Sbjct  569  TATFQFCEIDLSEVLPADSLSPFLDEIRNREKQRKRVARKEHRDKVKAEAVESNYA-MSL  627

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            NL    +   P FS DDFE LG S   SSSPP     +  FSNVARLGFAA HDSPALK+
Sbjct  628  NLEHNPHDEPPNFSIDDFEVLGTSTTTSSSPPNIRE-RQSFSNVARLGFAAAHDSPALKI  686

Query  457  EDTLPKTEASQNTSGE--TGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E      EA  +T  E  TG ++    SFAN+TSR K  E  +V++ +++GKKGKKP+RV
Sbjct  687  E------EARSHTGMEVSTGARNNSGPSFANITSRGKPPERTDVAEVNKMGKKGKKPSRV  740

Query  283  LLSTSSSRRY  254
            LLST+ SRRY
Sbjct  741  LLSTAGSRRY  750



>ref|XP_010682974.1| PREDICTED: RING finger protein 10 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=745

 Score =   174 bits (442),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL +++PA+AL+PFM E+K REKQRKR+A+ E ++K+KAE       P+ Y
Sbjct  558  TTTFQLCEIDLREIVPAEALTPFMDELKKREKQRKRLAKQEQEDKIKAEAVAAYSLPVPY  617

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            N    SY G P F  DDFEALG+    + +      G+ LFS+V RLGFAAG DSP+L +
Sbjct  618  NFIQASYDGPPTFCMDDFEALGS-PATTVASSPPAQGRQLFSSVTRLGFAAGCDSPSLII  676

Query  457  EDTLPKTEASQ--NTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T P+  +++  ++SG     + G  SFANV SR  +V+     K +E GKKGKKP+RV
Sbjct  677  QETAPEANSTRTPSSSGFNESTNQGVRSFANVISR-DSVDTNTPRKTNEAGKKGKKPSRV  735

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  736  LLSTAGGRRY  745



>gb|KJB70712.1| hypothetical protein B456_011G088400 [Gossypium raimondii]
Length=740

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 131/191 (69%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET-TGFQYAPLS  641
            TT FQLCEIDL  +LP DAL PFM EIK REKQRK++AR E +EK+KAE     Q+ P+ 
Sbjct  551  TTTFQLCEIDLSGVLPPDALHPFMDEIKKREKQRKQLARKEQKEKIKAEVAAAVQFTPMI  610

Query  640  YNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             N    SY   P FS DDFEALG+S VISSSPP     K LFSNV RLGFAA HDSP+LK
Sbjct  611  SNFGHCSYNDSPTFSMDDFEALGSSTVISSSPPVTGERK-LFSNVTRLGFAAAHDSPSLK  669

Query  460  LED--TLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            +E+   +   E + +++G  G + +GT SFANV SRAK  E+    K +E+GKKGKK  R
Sbjct  670  IEEGNGMHNNEGAADSTGAAGSRSSGTQSFANVISRAKAPENLQTPKMNEIGKKGKKGGR  729

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  730  VLLSTAGGRRY  740



>gb|KJB70711.1| hypothetical protein B456_011G088400 [Gossypium raimondii]
Length=738

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 131/191 (69%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET-TGFQYAPLS  641
            TT FQLCEIDL  +LP DAL PFM EIK REKQRK++AR E +EK+KAE     Q+ P+ 
Sbjct  549  TTTFQLCEIDLSGVLPPDALHPFMDEIKKREKQRKQLARKEQKEKIKAEVAAAVQFTPMI  608

Query  640  YNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             N    SY   P FS DDFEALG+S VISSSPP     K LFSNV RLGFAA HDSP+LK
Sbjct  609  SNFGHCSYNDSPTFSMDDFEALGSSTVISSSPPVTGERK-LFSNVTRLGFAAAHDSPSLK  667

Query  460  LED--TLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            +E+   +   E + +++G  G + +GT SFANV SRAK  E+    K +E+GKKGKK  R
Sbjct  668  IEEGNGMHNNEGAADSTGAAGSRSSGTQSFANVISRAKAPENLQTPKMNEIGKKGKKGGR  727

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  728  VLLSTAGGRRY  738



>ref|XP_010682973.1| PREDICTED: RING finger protein 10 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=751

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 128/196 (65%), Gaps = 10/196 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL +++PA+AL+PFM E+K REKQRKR+A+ E ++K+KAE       P+ Y
Sbjct  558  TTTFQLCEIDLREIVPAEALTPFMDELKKREKQRKRLAKQEQEDKIKAEAVAAYSLPVPY  617

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            N    SY G P F  DDFEALG+    + +      G+ LFS+V RLGFAAG DSP+L +
Sbjct  618  NFIQASYDGPPTFCMDDFEALGS-PATTVASSPPAQGRQLFSSVTRLGFAAGCDSPSLII  676

Query  457  EDTLPKTEASQ--NTSGETG------RKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKG  302
            ++T P+  +++  ++SG  G        + G  SFANV SR  +V+     K +E GKKG
Sbjct  677  QETAPEANSTRTPSSSGFNGFGACVESTNQGVRSFANVISR-DSVDTNTPRKTNEAGKKG  735

Query  301  KKPNRVLLSTSSSRRY  254
            KKP+RVLLST+  RRY
Sbjct  736  KKPSRVLLSTAGGRRY  751



>ref|XP_008347985.1| PREDICTED: RING finger protein 10-like isoform X2 [Malus domestica]
Length=775

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 127/190 (67%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  587  TTILQFCEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQREKMKAESTVAYPIPIVA  646

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+S   SSS P     K LFS+V RLGFAA HDSPALKL
Sbjct  647  GYGQSFHDGSPTFSMDDFEALGSSTATSSSSPVVGERK-LFSSVTRLGFAAAHDSPALKL  705

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E T  L    A + +    G ++AG  SFANV SRAK  E+ +  K +E GKKG+KP+RV
Sbjct  706  EGTSSLNGDGAGRVSPKTNGTQNAGVTSFANVISRAKPGENMDPPKINESGKKGRKPSRV  765

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  766  LLSTAGGRRY  775



>ref|XP_008231028.1| PREDICTED: RING finger protein 10 isoform X3 [Prunus mume]
Length=768

 Score =   171 bits (432),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 129/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE+QRK++AR EH+EKMKAE+      PL  
Sbjct  579  TTILQFCEIDLSELLSPDALSPFMEDIKKRERQRKQLARKEHKEKMKAESAMAYPIPLVA  638

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +   G P FS DDFEALG+S V SSS P     K LFS+V RLGFAAGHDSP LKL
Sbjct  639  GYGQSFQDGSPTFSMDDFEALGSSTVTSSSSPVVGERK-LFSSVTRLGFAAGHDSPTLKL  697

Query  457  EDT--LPKTEASQNTSGET-GRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            E T  L   +A++ +   T G + AG  SFAN+ SRAK  E+ +  K ++ GKKGKKP+R
Sbjct  698  EGTNSLNDDDAARYSLETTAGTQSAGVTSFANIISRAKPGENLDTPKMNDSGKKGKKPSR  757

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  758  VLLSTAGGRRY  768



>ref|XP_008231029.1| PREDICTED: RING finger protein 10 isoform X4 [Prunus mume]
Length=767

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 129/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE+QRK++AR EH+EKMKAE+      PL  
Sbjct  578  TTILQFCEIDLSELLSPDALSPFMEDIKKRERQRKQLARKEHKEKMKAESAMAYPIPLVA  637

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +   G P FS DDFEALG+S V SSS P     K LFS+V RLGFAAGHDSP LKL
Sbjct  638  GYGQSFQDGSPTFSMDDFEALGSSTVTSSSSPVVGERK-LFSSVTRLGFAAGHDSPTLKL  696

Query  457  EDT--LPKTEASQNTSGET-GRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            E T  L   +A++ +   T G + AG  SFAN+ SRAK  E+ +  K ++ GKKGKKP+R
Sbjct  697  EGTNSLNDDDAARYSLETTAGTQSAGVTSFANIISRAKPGENLDTPKMNDSGKKGKKPSR  756

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  757  VLLSTAGGRRY  767



>ref|XP_007214972.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
 gb|EMJ16171.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
Length=767

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL K+L  DALSPFM +IK RE+QRK++AR EH+EKMKAE+      PL  
Sbjct  578  TTILQFCEIDLSKLLSPDALSPFMEDIKKRERQRKQLARKEHKEKMKAESAMAYPIPLVA  637

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +   G P FS DDFEALG+S V SSS P     K LFS+V RLGFAAGHDSP LKL
Sbjct  638  GYGQSFQDGSPTFSMDDFEALGSSTVTSSSSPVVGERK-LFSSVTRLGFAAGHDSPTLKL  696

Query  457  EDT--LPKTEASQNTSGET-GRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            E T  L   +A++ +   T G +  G  SFAN+ SRAK  E+ +  K ++ GKKGKKP+R
Sbjct  697  EGTNSLNDDDAARYSLETTAGTQSVGVTSFANIISRAKPGENLDTPKMNDSGKKGKKPSR  756

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  757  VLLSTAGGRRY  767



>ref|XP_008231025.1| PREDICTED: RING finger protein 10 isoform X1 [Prunus mume]
Length=769

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE+QRK++AR EH+EKMKAE+      PL  
Sbjct  579  TTILQFCEIDLSELLSPDALSPFMEDIKKRERQRKQLARKEHKEKMKAESAMAYPIPLVA  638

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +   G P FS DDFEALG+S V SSS P     K LFS+V RLGFAAGHDSP LKL
Sbjct  639  GYGQSFQDGSPTFSMDDFEALGSSTVTSSSSPVVGERK-LFSSVTRLGFAAGHDSPTLKL  697

Query  457  EDT--LPKTEASQNTSGET--GRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPN  290
            E T  L   +A++ +   T  G + AG  SFAN+ SRAK  E+ +  K ++ GKKGKKP+
Sbjct  698  EGTNSLNDDDAARYSLETTAAGTQSAGVTSFANIISRAKPGENLDTPKMNDSGKKGKKPS  757

Query  289  RVLLSTSSSRRY  254
            RVLLST+  RRY
Sbjct  758  RVLLSTAGGRRY  769



>ref|XP_008231027.1| PREDICTED: RING finger protein 10 isoform X2 [Prunus mume]
Length=768

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 129/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE+QRK++AR EH+EKMKAE+      PL  
Sbjct  578  TTILQFCEIDLSELLSPDALSPFMEDIKKRERQRKQLARKEHKEKMKAESAMAYPIPLVA  637

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +   G P FS DDFEALG+S V SSS P     K LFS+V RLGFAAGHDSP LKL
Sbjct  638  GYGQSFQDGSPTFSMDDFEALGSSTVTSSSSPVVGERK-LFSSVTRLGFAAGHDSPTLKL  696

Query  457  EDT--LPKTEASQNTSGET--GRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPN  290
            E T  L   +A++ +   T  G + AG  SFAN+ SRAK  E+ +  K ++ GKKGKKP+
Sbjct  697  EGTNSLNDDDAARYSLETTAAGTQSAGVTSFANIISRAKPGENLDTPKMNDSGKKGKKPS  756

Query  289  RVLLSTSSSRRY  254
            RVLLST+  RRY
Sbjct  757  RVLLSTAGGRRY  768



>ref|XP_007161621.1| hypothetical protein PHAVU_001G084800g [Phaseolus vulgaris]
 gb|ESW33615.1| hypothetical protein PHAVU_001G084800g [Phaseolus vulgaris]
Length=741

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 132/190 (69%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCE+DL ++LP +AL+PFM EIK R  QRK++A+ E +EK++AE T     P+S 
Sbjct  554  TTTFQLCEVDLSELLPPEALTPFMDEIKKRANQRKQLAKKERKEKIRAEATDTYSLPISL  613

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   TS+   P FS DDFEALGNS V SS+P A    K  FSNV RLGFAA HDSP+L++
Sbjct  614  SSRFTSHDDPPTFSMDDFEALGNSTVSSSTPVAGE--KKSFSNVTRLGFAAAHDSPSLQI  671

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L    A+ ++S  TG ++  T S++NV SRA++    N  K +E+GKKGKKP+RV
Sbjct  672  QETSGLHNNNATTDSSATTGSRNGETQSYSNVISRAESNISSNAPKTNELGKKGKKPSRV  731

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  732  LLSTAGGRRY  741



>ref|XP_007214973.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
 gb|EMJ16172.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
Length=768

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 128/192 (67%), Gaps = 5/192 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL K+L  DALSPFM +IK RE+QRK++AR EH+EKMKAE+      PL  
Sbjct  578  TTILQFCEIDLSKLLSPDALSPFMEDIKKRERQRKQLARKEHKEKMKAESAMAYPIPLVA  637

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +   G P FS DDFEALG+S V SSS P     K LFS+V RLGFAAGHDSP LKL
Sbjct  638  GYGQSFQDGSPTFSMDDFEALGSSTVTSSSSPVVGERK-LFSSVTRLGFAAGHDSPTLKL  696

Query  457  EDT--LPKTEASQNTSGET--GRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPN  290
            E T  L   +A++ +   T  G +  G  SFAN+ SRAK  E+ +  K ++ GKKGKKP+
Sbjct  697  EGTNSLNDDDAARYSLETTAAGTQSVGVTSFANIISRAKPGENLDTPKMNDSGKKGKKPS  756

Query  289  RVLLSTSSSRRY  254
            RVLLST+  RRY
Sbjct  757  RVLLSTAGGRRY  768



>ref|XP_010660682.1| PREDICTED: RING finger protein 10 isoform X2 [Vitis vinifera]
Length=762

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 126/188 (67%), Gaps = 4/188 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL ++LP  A  PFM EIK RE+QRK++AR + +EK+KAE T     P+  
Sbjct  579  TTTFQLCEIDLREVLPPSAFFPFMDEIKKRERQRKKLARKDTKEKLKAEATTTDSLPIPS  638

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
               +  YV  P FS DDFEALG+  V S+SPP     K LFSNV +LGFAAGHDSP LK+
Sbjct  639  RFGE--YVYPPTFSIDDFEALGSPVVTSTSPPTFGERK-LFSNVTKLGFAAGHDSPGLKI  695

Query  457  EDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVLL  278
            E+ +    ++   S  +G ++AGT SFANV SR K+VE  + SK    GKKGKK N++LL
Sbjct  696  EE-VHSVHSTSMASDSSGSRNAGTPSFANVISRGKSVESLDASKTIGTGKKGKKSNQILL  754

Query  277  STSSSRRY  254
            ST+  RRY
Sbjct  755  STAGGRRY  762



>ref|XP_008347984.1| PREDICTED: RING finger protein 10-like isoform X1 [Malus domestica]
Length=776

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 127/199 (64%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  587  TTILQFCEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQREKMKAESTVAYPIPIVA  646

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+S   SSS P     K LFS+V RLGFAA HDSPALKL
Sbjct  647  GYGQSFHDGSPTFSMDDFEALGSSTATSSSSPVVGERK-LFSSVTRLGFAAAHDSPALKL  705

Query  457  EDT-----------LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVG  311
            E T            PKT A        G ++AG  SFANV SRAK  E+ +  K +E G
Sbjct  706  EGTSSLNGDGAGRVSPKTNA--------GTQNAGVTSFANVISRAKPGENMDPPKINESG  757

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKG+KP+RVLLST+  RRY
Sbjct  758  KKGRKPSRVLLSTAGGRRY  776



>ref|XP_003624500.1| RING finger protein [Medicago truncatula]
 gb|AES80718.1| RING finger protein [Medicago truncatula]
Length=744

 Score =   168 bits (425),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+FQLCE+DL +MLP +AL+PFM EIK R  QRK++A+ E +EK+KAE T      +S 
Sbjct  557  TTIFQLCEVDLSEMLPPEALAPFMDEIKKRANQRKQIAKKEQKEKLKAEATDNYALSMST  616

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +    S    P FS DDFEALGNSA+ SS P      + LFS+V RLGFAAGHDSP+   
Sbjct  617  HYQFISRDDPPTFSMDDFEALGNSALSSSPPVVGE--RKLFSSVTRLGFAAGHDSPSFPT  674

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L    +   +SG  G ++  TLS++NV SRA++    N  K +++GKKGKKPNRV
Sbjct  675  QETSDLHSNNSIAGSSGTAGLRNGETLSYSNVISRAESNGTSNAPKTNDLGKKGKKPNRV  734

Query  283  LLSTSSSRRY  254
            LLSTS  RRY
Sbjct  735  LLSTSGGRRY  744



>ref|XP_010028937.1| PREDICTED: RING finger protein 10 [Eucalyptus grandis]
 gb|KCW55768.1| hypothetical protein EUGRSUZ_I01601 [Eucalyptus grandis]
Length=670

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 130/190 (68%), Gaps = 7/190 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+D+L PFM EIK REK+RK++A+ E +EK+KAE      + L Y
Sbjct  486  TTAFQLCEIDLTGILPSDSLLPFMDEIKKREKERKQLAKKERKEKLKAEAAEVPMSIL-Y  544

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            ++  +S VG P FS DDFEALGN  V+SSSPP     K  FSNV RLGFAA HDSPALK+
Sbjct  545  DIGQSSSVGSPTFSADDFEALGNPVVMSSSPPTVGERK-TFSNVTRLGFAAAHDSPALKI  603

Query  457  E--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E  D+L +T    ++ G      A   SFA + S+AK+VE    SK SE+GKKGKK ++V
Sbjct  604  EEDDSLRRTILKTDSPGGG---EAKAPSFATMISKAKSVESLEASKMSEMGKKGKKQSQV  660

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  661  LLSTAGGRRY  670



>gb|KHN28587.1| RING finger protein 10 [Glycine soja]
Length=719

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 126/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCE+DL +MLP +A SPFM EIK R  QRK++A+ E +EK+ AE T     P+S 
Sbjct  532  TTTFQLCEVDLSEMLPPEAFSPFMDEIKKRANQRKQLAKKEKKEKIMAEATAAYSLPISL  591

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   TS    P FS DDFEALGNS + SS P A       FSNV RLGFAA HDSP+L++
Sbjct  592  SHQFTSRNDPPTFSMDDFEALGNSTISSSPPLAGERKS--FSNVTRLGFAAAHDSPSLQI  649

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L     + ++S  TG ++  T S++NVTSR ++    N  K +E+GKKGKKPNRV
Sbjct  650  QETSGLHNNNTTADSSVTTGLRNGETQSYSNVTSRTESNISSNAPKTNELGKKGKKPNRV  709

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  710  LLSTAGGRRY  719



>ref|XP_003553982.1| PREDICTED: RING finger protein 10-like isoform X1 [Glycine max]
Length=747

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 125/190 (66%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCE+DL +MLP +A SPFM EIK R  QRK++AR E +EK+ AE T     P+S 
Sbjct  560  TTTFQLCEVDLSEMLPPEAFSPFMDEIKKRANQRKQLARKEKKEKIMAEATAAYSLPISL  619

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   TS    P FS DDFEALGNS + SS P A       FSNV RLGFAA HDSP+L++
Sbjct  620  SHQFTSRNDPPTFSMDDFEALGNSTISSSPPLAGERKS--FSNVTRLGFAAAHDSPSLQI  677

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L     + ++S  TG ++  T S++N TSR ++    N  K +E+GKKGKKPNRV
Sbjct  678  QETSGLHNNNTTADSSVTTGLRNGETQSYSNATSRTESNISSNAPKTNELGKKGKKPNRV  737

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  738  LLSTAGGRRY  747



>ref|XP_010096031.1| RING finger protein 10 [Morus notabilis]
 gb|EXB62837.1| RING finger protein 10 [Morus notabilis]
Length=778

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 128/209 (61%), Gaps = 22/209 (11%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQ CEIDL   LPADAL PFM EIK REKQRK+VAR E +EK+KAE +     P+  
Sbjct  571  TTTFQFCEIDLSDSLPADALQPFMDEIKKREKQRKQVARKERKEKIKAEASMEGPMPIVS  630

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                +     P FS DDFEALG S   SSSPP     K LFS+V RLGFAAGHDSPALK+
Sbjct  631  RFEHSFQDESPIFSMDDFEALGTSTPTSSSPPIVGERK-LFSSVTRLGFAAGHDSPALKI  689

Query  457  E------DTLPKTEASQNTSGETG---------------RKHAGTLSFANVTSRAKTVED  341
            E      D     ++S  T  E+G               R +AGT SFAN+ SRA++VE 
Sbjct  690  EENNSQDDNQMIRDSSGVTDIESGACFCGLSEPLSNAGPRNNAGTPSFANIISRAESVES  749

Query  340  PNVSKASEVGKKGKKPNRVLLSTSSSRRY  254
                K +++GKKGKKP+RVLLST+  RRY
Sbjct  750  LGARKMNDLGKKGKKPSRVLLSTAGGRRY  778



>ref|XP_009378043.1| PREDICTED: RING finger protein 10 isoform X5 [Pyrus x bretschneideri]
Length=782

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 126/190 (66%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q  EIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  594  TTILQFSEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQKEKMKAESTMAYPIPIVA  653

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V RLGFAA HDSP LKL
Sbjct  654  GYGQSFHDGSPTFSMDDFEALGSCTVTSSSPPVVGERK-LFSSVTRLGFAAAHDSPVLKL  712

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E T  L   +A + +    G ++AG  SFAN+ SRAK  E+ +  K ++ GKKGKK +RV
Sbjct  713  EGTNSLNGNDAGRVSPKTNGTQNAGVASFANIISRAKPGENTDPPKTNDSGKKGKKQSRV  772

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  773  LLSTTGGRRY  782



>gb|EYU34830.1| hypothetical protein MIMGU_mgv1a002265mg [Erythranthe guttata]
Length=693

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 128/194 (66%), Gaps = 10/194 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEI+L   LPA++ SPFM EIKNREKQRK++A+ E ++K+KAE    Q+  + Y
Sbjct  504  TTTFQLCEINLADTLPAESTSPFMDEIKNREKQRKQLAKKELKDKIKAEAESSQFVHVPY  563

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppa--avAGKLLFSNVARLGFAAGHDSPAL  464
                 SY   P+FS DDFEALG SAV SSS      +  K  FSNVARLGFAA HDSP+L
Sbjct  564  ----YSYEDTPSFSMDDFEALGTSAVASSSSSRPLTIGEKHSFSNVARLGFAAAHDSPSL  619

Query  463  KLED--TLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPN--VSKASEVGKKGKK  296
            K ++  T  + +    +S   G ++ G  SFAN+TSRAK VE P    SK +EV KKGKK
Sbjct  620  KFDEIQTALEMDKPDESSSTIGSRNVGGASFANITSRAKKVEVPPQIPSKGNEVVKKGKK  679

Query  295  PNRVLLSTSSSRRY  254
              R+L+ST+  RRY
Sbjct  680  ATRILMSTAGGRRY  693



>gb|KDP41854.1| hypothetical protein JCGZ_26872 [Jatropha curcas]
Length=747

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 129/195 (66%), Gaps = 7/195 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT  QLCEIDL  ML   AL PFM EIK REKQRK++A+ E +EK+KAE       P   
Sbjct  553  TTTIQLCEIDLSGMLTPAALLPFMDEIKKREKQRKKLAQKERKEKIKAEAASAHSMPGLS  612

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAG-----KLLFSNVARLGFAAGHDS  473
            ++  +     P FS DDFEALG+S  +SSSPP + +      +LLFSNV RLGFAAGH S
Sbjct  613  SIGRSFCDDSPKFSMDDFEALGSSTAMSSSPPMSSSPPVVGERLLFSNVTRLGFAAGHGS  672

Query  472  PALKLEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGK  299
            PAL+ E+T  L   + + ++S  +G K++GT SFANV SR K+ E  +  K +E+GKKGK
Sbjct  673  PALRTEETSALHNNKVTNDSSSVSGTKNSGTPSFANVISRVKSGEALDAPKTNEIGKKGK  732

Query  298  KPNRVLLSTSSSRRY  254
            K +RVLLST+  RRY
Sbjct  733  KSSRVLLSTAGGRRY  747



>ref|XP_009378041.1| PREDICTED: RING finger protein 10 isoform X3 [Pyrus x bretschneideri]
Length=783

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 126/199 (63%), Gaps = 19/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q  EIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  593  TTILQFSEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQKEKMKAESTMAYPIPIVA  652

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V RLGFAA HDSP LKL
Sbjct  653  GYGQSFHDGSPTFSMDDFEALGSCTVTSSSPPVVGERK-LFSSVTRLGFAAAHDSPVLKL  711

Query  457  EDT-----------LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVG  311
            E T            PKT A+       G ++AG  SFAN+ SRAK  E+ +  K ++ G
Sbjct  712  EGTNSLNGNDAGRVSPKTNAA-------GTQNAGVASFANIISRAKPGENTDPPKTNDSG  764

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKK +RVLLST+  RRY
Sbjct  765  KKGKKQSRVLLSTTGGRRY  783



>ref|XP_008362084.1| PREDICTED: RING finger protein 10-like isoform X2 [Malus domestica]
Length=776

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 3/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE++RK++AR E +EKMKAE+T     P+  
Sbjct  588  TTIXQFCEIDLSEVLSPDALSPFMEDIKKREQKRKQLARKEQKEKMKAESTMAYPIPIVA  647

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V +LGFAA HDSPALKL
Sbjct  648  GYGQSLHEGSPTFSMDDFEALGSXTVTSSSPPVVGERK-LFSSVTKLGFAAAHDSPALKL  706

Query  457  E--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E  ++L   +A +      G ++AG  SFAN+ +RAK  E+ +    ++ GKKGKK +RV
Sbjct  707  EGSNSLNGNDAGRVFPKTNGTQNAGVASFANIIARAKPGENMDPPXINDSGKKGKKQSRV  766

Query  283  LLSTSSSRRY  254
            LLST+S RRY
Sbjct  767  LLSTASGRRY  776



>ref|XP_009378042.1| PREDICTED: RING finger protein 10 isoform X4 [Pyrus x bretschneideri]
Length=783

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 126/199 (63%), Gaps = 19/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q  EIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  593  TTILQFSEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQKEKMKAESTMAYPIPIVA  652

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V RLGFAA HDSP LKL
Sbjct  653  GYGQSFHDGSPTFSMDDFEALGSCTVTSSSPPVVGERK-LFSSVTRLGFAAAHDSPVLKL  711

Query  457  EDT-----------LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVG  311
            E T            PKT A+       G ++AG  SFAN+ SRAK  E+ +  K ++ G
Sbjct  712  EGTNSLNGNDAGRVSPKTNAA-------GTQNAGVASFANIISRAKPGENTDPPKTNDSG  764

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKK +RVLLST+  RRY
Sbjct  765  KKGKKQSRVLLSTTGGRRY  783



>ref|XP_009378039.1| PREDICTED: RING finger protein 10 isoform X1 [Pyrus x bretschneideri]
Length=784

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 126/199 (63%), Gaps = 19/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q  EIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  594  TTILQFSEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQKEKMKAESTMAYPIPIVA  653

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V RLGFAA HDSP LKL
Sbjct  654  GYGQSFHDGSPTFSMDDFEALGSCTVTSSSPPVVGERK-LFSSVTRLGFAAAHDSPVLKL  712

Query  457  EDT-----------LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVG  311
            E T            PKT A+       G ++AG  SFAN+ SRAK  E+ +  K ++ G
Sbjct  713  EGTNSLNGNDAGRVSPKTNAA-------GTQNAGVASFANIISRAKPGENTDPPKTNDSG  765

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKK +RVLLST+  RRY
Sbjct  766  KKGKKQSRVLLSTTGGRRY  784



>ref|XP_009378040.1| PREDICTED: RING finger protein 10 isoform X2 [Pyrus x bretschneideri]
Length=783

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 125/199 (63%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q  EIDL ++L  DALSPFM +IK REKQRK++AR E +EKMKAE+T     P+  
Sbjct  594  TTILQFSEIDLSEVLSPDALSPFMEDIKKREKQRKQLARKEQKEKMKAESTMAYPIPIVA  653

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V RLGFAA HDSP LKL
Sbjct  654  GYGQSFHDGSPTFSMDDFEALGSCTVTSSSPPVVGERK-LFSSVTRLGFAAAHDSPVLKL  712

Query  457  EDT-----------LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVG  311
            E T            PKT A        G ++AG  SFAN+ SRAK  E+ +  K ++ G
Sbjct  713  EGTNSLNGNDAGRVSPKTNA--------GTQNAGVASFANIISRAKPGENTDPPKTNDSG  764

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKK +RVLLST+  RRY
Sbjct  765  KKGKKQSRVLLSTTGGRRY  783



>ref|XP_008791034.1| PREDICTED: RING finger protein 10 [Phoenix dactylifera]
Length=628

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 124/191 (65%), Gaps = 5/191 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP  +L+PFM E+K REKQRKR+AR E +++++AE    Q+A L  
Sbjct  440  TTTFQLCEIDLSDILPPRSLAPFMDELKKREKQRKRLARKEQEDRVRAEAAA-QHASLIT  498

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +           FS+DDFEALG+ +V SSSPP     K LFS+VARLGFAA HDSP+L+ 
Sbjct  499  HDQGQYSPKDVTFSSDDFEALGSCSVQSSSPPVTGERK-LFSDVARLGFAAAHDSPSLRT  557

Query  457  E---DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            E   D+  K E    +S   G + A TLSFAN+ S A+ +E P   K +  GKKGKKP +
Sbjct  558  EERTDSSGKMERMHESSSIQGPRTAATLSFANIISSARVIESPEAQKTNGFGKKGKKPTK  617

Query  286  VLLSTSSSRRY  254
            VLLS +  RRY
Sbjct  618  VLLSNAGGRRY  628



>ref|XP_008362083.1| PREDICTED: RING finger protein 10-like isoform X1 [Malus domestica]
Length=777

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 127/199 (64%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE++RK++AR E +EKMKAE+T     P+  
Sbjct  588  TTIXQFCEIDLSEVLSPDALSPFMEDIKKREQKRKQLARKEQKEKMKAESTMAYPIPIVA  647

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + + G P FS DDFEALG+  V SSSPP     K LFS+V +LGFAA HDSPALKL
Sbjct  648  GYGQSLHEGSPTFSMDDFEALGSXTVTSSSPPVVGERK-LFSSVTKLGFAAAHDSPALKL  706

Query  457  EDT-----------LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVG  311
            E +            PKT A        G ++AG  SFAN+ +RAK  E+ +    ++ G
Sbjct  707  EGSNSLNGNDAGRVFPKTNA--------GTQNAGVASFANIIARAKPGENMDPPXINDSG  758

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKK +RVLLST+S RRY
Sbjct  759  KKGKKQSRVLLSTASGRRY  777



>ref|XP_011468214.1| PREDICTED: RING finger protein 10 [Fragaria vesca subsp. vesca]
Length=749

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 4/191 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+ Q CEIDL ++L  DALSPFM +IK RE+QRK++AR E +E++KAE+      P+  
Sbjct  560  TTILQFCEIDLSELLSPDALSPFMEDIKKRERQRKQLARKERKEQIKAESAMAYPIPIVA  619

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
              A + +   P FS DDFEALG+++V SSSPP     + LFS+V +LGFAAGHDSP+LKL
Sbjct  620  GFAQSFHDESPTFSMDDFEALGSTSVTSSSPPIVGE-RRLFSSVTKLGFAAGHDSPSLKL  678

Query  457  EDT--LPKTEA-SQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            + T  L   +A S   S   G ++AG  SFAN+TSRAK  E+ +  K +  GKKGKK +R
Sbjct  679  DGTNSLNGNDAGSSLQSTAAGTQNAGVTSFANITSRAKPEENLDAPKINGSGKKGKKQSR  738

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  739  VLLSTTGGRRY  749



>ref|XP_002320428.2| hypothetical protein POPTR_0014s14220g [Populus trichocarpa]
 gb|EEE98743.2| hypothetical protein POPTR_0014s14220g [Populus trichocarpa]
Length=735

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 123/190 (65%), Gaps = 5/190 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL   LP +AL PFM EIK REK RK++A  E +EK+KAE +     P   
Sbjct  549  TTTFQLCEIDLNAALPPNALLPFMDEIKKREKLRKQLANKERKEKIKAEASA--SMPTLP  606

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   +SY   P FS +DFEALG  +   SS P     ++LFSNVAR GFAAGHDSPALK+
Sbjct  607  SFGQSSYDTSPNFSMEDFEALG-ISSSMSSSPPVAGERILFSNVARFGFAAGHDSPALKI  665

Query  457  EDTLP--KTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            E+ +P        N+S   G  ++G  SFANVT+R K  E+ +  K +EV KKGKKPNRV
Sbjct  666  EENVPLQNNMPGNNSSNLNGSSNSGPSSFANVTARPKPEENVDPPKMNEVSKKGKKPNRV  725

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  726  LLSTTGGRRY  735



>ref|XP_010929676.1| PREDICTED: RING finger protein 10 [Elaeis guineensis]
Length=774

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 121/191 (63%), Gaps = 5/191 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP  +L+PFM E+K REKQRK++AR E +E++KAE      + +++
Sbjct  586  TTTFQLCEIDLSDILPPGSLAPFMDELKKREKQRKQLARKEQEERLKAEAASLHASLITH  645

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +    S      FS+DDFEALG+ +  S+SPP A   K LFS+V RLGFAA HDSP+L+ 
Sbjct  646  DKGRYS-PKDVTFSSDDFEALGSCSAPSTSPPVAGERK-LFSDVTRLGFAAAHDSPSLRA  703

Query  457  E---DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            E   D+    E     S   G + A TLSFAN+ S A+  E P   K +  GKKGKKP +
Sbjct  704  EERTDSSGHMERMGEASSIQGPRTAATLSFANIISSARITESPEAQKTNGFGKKGKKPTK  763

Query  286  VLLSTSSSRRY  254
            VL+S +  RRY
Sbjct  764  VLMSNAGGRRY  774



>ref|XP_006598997.1| PREDICTED: RING finger protein 10-like [Glycine max]
Length=664

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCE+DL +MLP +AL+PF+ EIK R  QRK++A+ E +EK+KAE T     P+S 
Sbjct  477  TTTFQLCEVDLSEMLPPEALAPFIDEIKKRANQRKQLAKKEKKEKIKAEATAAYSLPISL  536

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   TS    P FS DDFEALGNS + SS P A       FSNV RLGFAA HDSP+L++
Sbjct  537  SHQFTSRDDPPTFSMDDFEALGNSTISSSPPLAGERKS--FSNVTRLGFAAAHDSPSLQI  594

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L     + ++S  TG ++  T S++NV SRA++    N  K +E+GKKGKKPNRV
Sbjct  595  QETSGLHNNNRTSDSSVSTGLRNGETQSYSNVISRAESNISSNAPKTNELGKKGKKPNRV  654

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  655  LLSTAGGRRY  664



>gb|KHM99214.1| RING finger protein 10 [Glycine soja]
Length=748

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCE+DL +MLP +AL+PF+ EIK R  QRK++A+ E +EK+KAE T     P+S 
Sbjct  561  TTTFQLCEVDLSEMLPPEALAPFIDEIKKRANQRKQLAKKEKKEKIKAEATAAYSLPISL  620

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   TS    P FS DDFEALGNS + SS P A       FSNV RLGFAA HDSP+L++
Sbjct  621  SHQFTSRDDPPTFSMDDFEALGNSTISSSPPLAGERKS--FSNVTRLGFAAAHDSPSLQI  678

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L     + ++S  TG ++  T S++NV SRA++    N  K +E+GKKGKKPNRV
Sbjct  679  QETSGLHNNNRTSDSSVSTGLRNGETQSYSNVISRAESNISSNAPKTNELGKKGKKPNRV  738

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  739  LLSTAGGRRY  748



>ref|XP_008450025.1| PREDICTED: RING finger protein 10 isoform X2 [Cucumis melo]
Length=740

 Score =   149 bits (377),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 120/193 (62%), Gaps = 10/193 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQR ++A+   +EK+K E +      +  
Sbjct  553  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRNQLAKKMRREKIKEEASSTCSLSMMA  612

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + +   P  S DDFEALG  +   +S    + G+ LFS+V RLGFAA HDSP+L++
Sbjct  613  TSGSSYHHNTPILSLDDFEALG--SSPVTSSSPPLGGRQLFSSVTRLGFAAAHDSPSLRI  670

Query  457  E--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAK---TVEDPNVSKASEVGKKGKKP  293
            E  D+L   E   + S  +      T SFANV SRAK   ++E P   KA+EVGKKGKKP
Sbjct  671  EETDSLHIHEVKSDLSVASSGTQNATPSFANVISRAKSGGSIESP---KANEVGKKGKKP  727

Query  292  NRVLLSTSSSRRY  254
            +RVLLST+  RRY
Sbjct  728  SRVLLSTAGGRRY  740



>gb|KGN58249.1| hypothetical protein Csa_3G599440 [Cucumis sativus]
Length=653

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 122/194 (63%), Gaps = 11/194 (6%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQRK++A+   +EK+K E +      +  
Sbjct  465  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRKQLAKKMRREKIKEEASSTCSLSMMA  524

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   + +   P  S DDFEALG  +   +S    V G+ LFS+V RLGFAA HDSP+L++
Sbjct  525  SSGSSYHHNTPILSLDDFEALG--SSPVTSSSPPVGGRQLFSSVTRLGFAAAHDSPSLRI  582

Query  457  E--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAK---TVEDPNVSKASE-VGKKGKK  296
            E  D+L   E   + S  +      T SFANV SRAK   ++E P   KA+E VGKKGKK
Sbjct  583  EETDSLHIHEVKSDLSVASSGTQNATPSFANVISRAKSGGSIESP---KANEVVGKKGKK  639

Query  295  PNRVLLSTSSSRRY  254
            P+RVLLST+  RRY
Sbjct  640  PSRVLLSTAGGRRY  653



>ref|XP_008450024.1| PREDICTED: RING finger protein 10 isoform X1 [Cucumis melo]
Length=741

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 125/195 (64%), Gaps = 13/195 (7%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQR ++A+   +EK+K E +      +  
Sbjct  553  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRNQLAKKMRREKIKEEASSTCSLSMMA  612

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                + +   P  S DDFEALG  +   +S    + G+ LFS+V RLGFAA HDSP+L++
Sbjct  613  TSGSSYHHNTPILSLDDFEALG--SSPVTSSSPPLGGRQLFSSVTRLGFAAAHDSPSLRI  670

Query  457  EDT----LPKTEASQNTSGETGRKHAGTLSFANVTSRAK---TVEDPNVSKASEVGKKGK  299
            E+T    + + ++  + +   G ++A T SFANV SRAK   ++E P   KA+EVGKKGK
Sbjct  671  EETDSLHIHEVKSDLSVASSAGTQNA-TPSFANVISRAKSGGSIESP---KANEVGKKGK  726

Query  298  KPNRVLLSTSSSRRY  254
            KP+RVLLST+  RRY
Sbjct  727  KPSRVLLSTAGGRRY  741



>ref|XP_004159146.1| PREDICTED: RING finger protein 10-like [Cucumis sativus]
Length=654

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 127/196 (65%), Gaps = 14/196 (7%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQRK++A+   +EK+K E +      +  
Sbjct  465  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRKQLAKKMRREKIKEEASSTCSLSMMA  524

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   + +   P  S DDFEALG  +   +S    V G+ LFS+V RLGFAA HDSP+L++
Sbjct  525  SSGSSYHHNTPILSLDDFEALG--SSPVTSSSPPVGGRQLFSSVTRLGFAAAHDSPSLRI  582

Query  457  EDT----LPKTEASQNTSGETGRKHAGTLSFANVTSRAK---TVEDPNVSKASE-VGKKG  302
            E+T    + + ++  + +   G ++A T SFANV SRAK   ++E P   KA+E VGKKG
Sbjct  583  EETDSLHIHEVKSDLSVASSAGTQNA-TPSFANVISRAKSGGSIESP---KANEVVGKKG  638

Query  301  KKPNRVLLSTSSSRRY  254
            KKP+RVLLST+  RRY
Sbjct  639  KKPSRVLLSTAGGRRY  654



>ref|XP_004145702.1| PREDICTED: RING finger protein 10-like [Cucumis sativus]
Length=742

 Score =   146 bits (369),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 127/196 (65%), Gaps = 14/196 (7%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQRK++A+   +EK+K E +      +  
Sbjct  553  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRKQLAKKMRREKIKEEASSTCSLSMMA  612

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +   + +   P  S DDFEALG  +   +S    V G+ LFS+V RLGFAA HDSP+L++
Sbjct  613  SSGSSYHHNTPILSLDDFEALG--SSPVTSSSPPVGGRQLFSSVTRLGFAAAHDSPSLRI  670

Query  457  EDT----LPKTEASQNTSGETGRKHAGTLSFANVTSRAK---TVEDPNVSKASE-VGKKG  302
            E+T    + + ++  + +   G ++A T SFANV SRAK   ++E P   KA+E VGKKG
Sbjct  671  EETDSLHIHEVKSDLSVASSAGTQNA-TPSFANVISRAKSGGSIESP---KANEVVGKKG  726

Query  301  KKPNRVLLSTSSSRRY  254
            KKP+RVLLST+  RRY
Sbjct  727  KKPSRVLLSTAGGRRY  742



>ref|XP_004493075.1| PREDICTED: RING finger protein 10-like isoform X2 [Cicer arietinum]
Length=747

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 4/190 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT+FQLCE+DL +MLP +AL+PFM EIK R  QRK++A+ E +EK+KAE T     P+S 
Sbjct  560  TTIFQLCEVDLSEMLPPEALAPFMDEIKKRAIQRKQLAKKELKEKLKAEATSNYALPIST  619

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
            +    S    P FS DDFEALGNSA+ SS P      + LFS+VARLGFAAGHDSP+ + 
Sbjct  620  SYQFISRDDPPTFSMDDFEALGNSAMSSSPPVVGE--RKLFSSVARLGFAAGHDSPSFQT  677

Query  457  EDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRV  284
            ++T  L    +   +S  +G ++ GT S++NV SR ++    N  K +++GKKGKKPNRV
Sbjct  678  QETSDLHINNSITGSSSTSGLRNGGTPSYSNVISRPESNGSSNTPKTNDLGKKGKKPNRV  737

Query  283  LLSTSSSRRY  254
            LLST+  RRY
Sbjct  738  LLSTAGGRRY  747



>ref|XP_002875336.1| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51595.1| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 118/189 (62%), Gaps = 4/189 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK-AETTGFQYAPLS  641
            TT FQ+CEID+ + LP DA +PF+ EIK REKQRK  AR + + K+K       +  PL 
Sbjct  575  TTTFQICEIDMRESLPPDAFAPFIDEIKKREKQRKDRARKDRKNKIKAEVAAAAELVPLM  634

Query  640  YNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             +   +S    P FS DDFEALGNSA ISSSPP     +  FS+V RLGFAAGHDSP   
Sbjct  635  SSFGQSSRDDFPPFSLDDFEALGNSAPISSSPPNIGE-RSSFSHVTRLGFAAGHDSPNFS  693

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
             E T  ++ +S  T+  TG ++    SFA+VTSR  T   P      E GK+GKKP+RVL
Sbjct  694  KEPTNAQSSSSVVTNATTGARNTNITSFASVTSRTTT--PPIAPTIKEPGKRGKKPSRVL  751

Query  280  LSTSSSRRY  254
            LST+S RRY
Sbjct  752  LSTTSVRRY  760



>ref|XP_004493074.1| PREDICTED: RING finger protein 10-like isoform X1 [Cicer arietinum]
Length=772

 Score =   140 bits (352),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 127/188 (68%), Gaps = 4/188 (2%)
 Frame = -3

Query  811  LFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSYNL  632
            +FQLCE+DL +MLP +AL+PFM EIK R  QRK++A+ E +EK+KAE T     P+S + 
Sbjct  587  IFQLCEVDLSEMLPPEALAPFMDEIKKRAIQRKQLAKKELKEKLKAEATSNYALPISTSY  646

Query  631  ADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKLED  452
               S    P FS DDFEALGNSA+ SS P      + LFS+VARLGFAAGHDSP+ + ++
Sbjct  647  QFISRDDPPTFSMDDFEALGNSAMSSSPPVVGE--RKLFSSVARLGFAAGHDSPSFQTQE  704

Query  451  T--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVLL  278
            T  L    +   +S  +G ++ GT S++NV SR ++    N  K +++GKKGKKPNRVLL
Sbjct  705  TSDLHINNSITGSSSTSGLRNGGTPSYSNVISRPESNGSSNTPKTNDLGKKGKKPNRVLL  764

Query  277  STSSSRRY  254
            ST+  RRY
Sbjct  765  STAGGRRY  772



>ref|XP_006290605.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
 gb|EOA23503.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
Length=769

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 122/191 (64%), Gaps = 7/191 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK--AETTGFQYAPL  644
            TT FQ+CEID+ + LP DA +PF+ EIK REKQRK  AR E ++K+K           PL
Sbjct  583  TTTFQICEIDMRESLPPDAFAPFIDEIKKREKQRKDRARKEQKDKIKAEVAAAAELVVPL  642

Query  643  SYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
              +   +S+   P+FS DDFEALGNSA ISSSPP     +  FS+V RLGFAAGHDSP L
Sbjct  643  MASFGRSSHDDFPSFSLDDFEALGNSAPISSSPPNIRE-RNSFSHVTRLGFAAGHDSPNL  701

Query  463  KLEDTLPKTEASQNTSGETGRKHAGTL-SFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
              + T  ++ +++ T+  TG ++     SFA+VTSR  T   P +    E GK+GKK +R
Sbjct  702  NNDPTNVQSSSNEVTNATTGARNTNIASSFASVTSRTSTPSTPII---KEPGKRGKKASR  758

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  759  VLLSTTSVRRY  769



>emb|CDY28532.1| BnaC02g36280D [Brassica napus]
Length=727

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 119/192 (62%), Gaps = 8/192 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQ+CEID+ + LP +A +PFM EIK REKQRK  AR E ++K+KAE           
Sbjct  540  TTTFQICEIDMRESLPPEAFAPFMDEIKKREKQRKERARKERKDKIKAEVAAAAELAPLM  599

Query  637  NLADTSYVG-QPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
                  Y G  P+FS DDFEALGNSA + SS P  +  +  FS+V RLGFAAGHDSP L 
Sbjct  600  ASRGQFYYGDDPSFSLDDFEALGNSAPVVSSSPPTIGERSSFSHVTRLGFAAGHDSPNLN  659

Query  460  LEDTL---PKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPN  290
             E T      + +S+ T+  TG ++  T SFA+VTSR  T   P   K  E GK+GKK +
Sbjct  660  NEPTTNVQSSSSSSEVTNATTGARNTNTTSFASVTSRTPTT--PVAIK--EPGKRGKKQS  715

Query  289  RVLLSTSSSRRY  254
            RVLLST+S RRY
Sbjct  716  RVLLSTTSVRRY  727



>ref|XP_009129487.1| PREDICTED: RING finger protein 10 isoform X2 [Brassica rapa]
Length=735

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 118/191 (62%), Gaps = 7/191 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQ+CEID+ + LP +A +PFM EIK REKQRK  AR E ++K+KAE           
Sbjct  549  TTTFQICEIDMRESLPPEAFAPFMDEIKKREKQRKERARKEQKDKIKAEVAAAAELAPLM  608

Query  637  NLADTSYVG-QPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
                  Y G  P+FS DDFEALGNSA + SS P  +  +  FS+V RLGFAAGHDSP L 
Sbjct  609  ASCGQFYYGDDPSFSLDDFEALGNSAPVVSSSPPTIGERSSFSHVTRLGFAAGHDSPNLN  668

Query  460  LEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
             E T     +  S+ ++  TG ++  T SFA+VTSR  T   P   K  E GK+GKK +R
Sbjct  669  NEPTNIQSSSSNSEVSNATTGARNTNTTSFASVTSRTPTT--PVAIK--EPGKRGKKQSR  724

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  725  VLLSTTSVRRY  735



>ref|XP_009129485.1| PREDICTED: RING finger protein 10 isoform X1 [Brassica rapa]
 ref|XP_009129486.1| PREDICTED: RING finger protein 10 isoform X1 [Brassica rapa]
Length=757

 Score =   137 bits (346),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 118/191 (62%), Gaps = 7/191 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQ+CEID+ + LP +A +PFM EIK REKQRK  AR E ++K+KAE           
Sbjct  571  TTTFQICEIDMRESLPPEAFAPFMDEIKKREKQRKERARKEQKDKIKAEVAAAAELAPLM  630

Query  637  NLADTSYVG-QPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
                  Y G  P+FS DDFEALGNSA + SS P  +  +  FS+V RLGFAAGHDSP L 
Sbjct  631  ASCGQFYYGDDPSFSLDDFEALGNSAPVVSSSPPTIGERSSFSHVTRLGFAAGHDSPNLN  690

Query  460  LEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
             E T     +  S+ ++  TG ++  T SFA+VTSR  T   P   K  E GK+GKK +R
Sbjct  691  NEPTNIQSSSSNSEVSNATTGARNTNTTSFASVTSRTPTT--PVAIK--EPGKRGKKQSR  746

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  747  VLLSTTSVRRY  757



>emb|CDY48977.1| BnaA02g28190D [Brassica napus]
Length=732

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 118/191 (62%), Gaps = 7/191 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQ+CEID+ + LP +A +PFM EIK REKQRK  AR E ++K+KAE           
Sbjct  546  TTTFQICEIDMRESLPPEAFAPFMDEIKKREKQRKERARKERKDKIKAEVAAAAELAPLM  605

Query  637  NLADTSYVG-QPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
                  Y G  P+FS DDFEALGNSA + SS P  +  +  FS+V RLGFAAGHDSP L 
Sbjct  606  ASCGQFYYGDDPSFSLDDFEALGNSAPVVSSSPPTIGERSSFSHVTRLGFAAGHDSPNLN  665

Query  460  LEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
             E T     +  S+ ++  TG ++  T SFA+VTSR  T   P   K  E GK+GKK +R
Sbjct  666  NEPTNIQSSSSNSEVSNATTGARNTNTTSFASVTSRTPTT--PVAIK--EPGKRGKKQSR  721

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  722  VLLSTTSVRRY  732



>ref|XP_010514334.1| PREDICTED: RING finger protein 10-like [Camelina sativa]
Length=767

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 117/191 (61%), Gaps = 6/191 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK--AETTGFQYAPL  644
            TT FQ+CEID+   LP DA +PF+ +IK REKQRK  AR E ++K+K           PL
Sbjct  580  TTTFQICEIDMRDSLPPDAFAPFIDDIKKREKQRKDRARKEQKDKIKAEVAAAAELVVPL  639

Query  643  SYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
              +   +S+   P +S DDFEALGNSA ISSSPP     +  FS+V R GFAAGHDSP L
Sbjct  640  MASFGQSSHNDFPPYSLDDFEALGNSAPISSSPPNIRE-RNSFSHVTRHGFAAGHDSPNL  698

Query  463  KLEDT-LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
              + T +  + +S+  +  TG +     SFA+VTSR  T   P   K  E GK+GKK NR
Sbjct  699  NNDATNVQSSSSSEVANATTGARTTNMTSFASVTSRTVTPSAPAAIK--EPGKRGKKQNR  756

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  757  VLLSTTSVRRY  767



>ref|XP_006844483.1| hypothetical protein AMTR_s00016p00109400 [Amborella trichopoda]
 gb|ERN06158.1| hypothetical protein AMTR_s00016p00109400 [Amborella trichopoda]
Length=772

 Score =   134 bits (338),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 9/191 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVAR-MEHQEKMKAETTGFQYAPLS  641
            TT FQLCEI+L  +LP DA +PFM EIK RE QRKR A+ +E Q + KA     +  P++
Sbjct  588  TTTFQLCEINLHSILPPDAFTPFMDEIKTRENQRKRQAKQLEKQARAKAA----EAVPVT  643

Query  640  YNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             +   +SY  +  FS DDFEALG+ +   S+ P  V G+ LFS VAR GFA+GHDSP+L+
Sbjct  644  SHFQHSSY-NETTFSMDDFEALGS-SAALSTSPPVVGGRKLFSQVARFGFASGHDSPSLR  701

Query  460  LEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
            L D+  +       N S +TG  +    SFA + + +       V K + + KKGKK  R
Sbjct  702  LGDSSGVSTNHTEDNLSTQTGSGNTTMQSFAGIIASSAKPATLEVPKVNALRKKGKKQTR  761

Query  286  VLLSTSSSRRY  254
            VLLST+  RRY
Sbjct  762  VLLSTAGDRRY  772



>ref|XP_010502612.1| PREDICTED: RING finger protein 10-like [Camelina sativa]
Length=766

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 120/193 (62%), Gaps = 9/193 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK--AETTGFQYAPL  644
            TT FQ+CEID+   LP DA +PF+ EIK REKQRK  AR E ++K+K           PL
Sbjct  578  TTTFQICEIDMRDSLPPDAFAPFIDEIKKREKQRKDRARKEQKDKIKAEVAAAAELVVPL  637

Query  643  SYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
              +   +S+   P +S DDFEALGNSA ISSSPP     +  FS+V R GFAAGHDSP L
Sbjct  638  MASFGQSSHNDFPPYSLDDFEALGNSAPISSSPPNIRE-RNSFSHVTRHGFAAGHDSPNL  696

Query  463  KLEDT-LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKAS--EVGKKGKKP  293
              + T +  + +S+  +  TG +     SFA+VTSR  T   P+V  A+  E GK+GKK 
Sbjct  697  NNDATNVQSSSSSEVANATTGARTTNMTSFASVTSRTTT---PSVPAATIKEPGKRGKKQ  753

Query  292  NRVLLSTSSSRRY  254
            +RVLLST+S RRY
Sbjct  754  SRVLLSTTSVRRY  766



>ref|XP_010425391.1| PREDICTED: RING finger protein 10-like [Camelina sativa]
Length=771

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 117/191 (61%), Gaps = 5/191 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK--AETTGFQYAPL  644
            TT FQ+CEID+   LP DA +PF+ EIK REKQRK  AR E ++K+K           PL
Sbjct  583  TTTFQICEIDMRNSLPHDAFAPFIDEIKKREKQRKDRARKEQKDKIKAEVAAAAELVVPL  642

Query  643  SYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
              +   +S+   P +S DDFEALGNSA ISSSPP     +  FS+V R GFAAGHDSP L
Sbjct  643  MASFGQSSHNDFPPYSLDDFEALGNSAPISSSPPNIGE-RNSFSHVTRHGFAAGHDSPNL  701

Query  463  KLEDT-LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
              + T +  + +S+  +  TG ++    SFA+VTSR      P  +   E GK+GKK +R
Sbjct  702  NNDPTNVQSSSSSEVANATTGARNTNMTSFASVTSRTTAPSAP-AATIKEPGKRGKKQSR  760

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  761  VLLSTTSVRRY  771



>ref|XP_006395529.1| hypothetical protein EUTSA_v10003691mg [Eutrema salsugineum]
 gb|ESQ32815.1| hypothetical protein EUTSA_v10003691mg [Eutrema salsugineum]
Length=760

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 121/189 (64%), Gaps = 6/189 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK-AETTGFQYAPLS  641
            TT FQ+CEID+ + LP DA +PFM EIK R+KQRK  AR + + K+K       + APL 
Sbjct  577  TTTFQICEIDMRESLPPDAFAPFMDEIKKRDKQRKERARKDQKNKIKAEVAAAAELAPLM  636

Query  640  YNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             +   +     P FS DDFEALGNSA ISSSPP     +  FS+V RLGFAAGHDSP L 
Sbjct  637  GSFIQSPRDDFPPFSLDDFEALGNSAPISSSPPNIGE-RSSFSHVTRLGFAAGHDSPNLN  695

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
             E T  ++ +S+ T+   G ++    SFA VTSR  +   P++ K  E GK+GKKP+RVL
Sbjct  696  NESTSVQSSSSEVTNATAGARNTNITSFATVTSRTPSA--PSIIK--EPGKRGKKPSRVL  751

Query  280  LSTSSSRRY  254
            LST+S RRY
Sbjct  752  LSTTSVRRY  760



>gb|KFK33594.1| hypothetical protein AALP_AA5G034200 [Arabis alpina]
Length=752

 Score =   132 bits (332),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 121/191 (63%), Gaps = 10/191 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK---AETTGFQYAP  647
            TT FQ+CEID+ + LP++A +PFM EIK REKQRK  AR + ++K+K   A         
Sbjct  569  TTTFQICEIDMRESLPSEAFTPFMEEIKKREKQRKERARKDRKDKIKAEVAAAAELAPLM  628

Query  646  LSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPA  467
             SY  +   +   P+FS DDFEALGNSA ISSSPP     +  FSNV RLGFAAGHDSP 
Sbjct  629  ASYGQSSRDHF--PSFSLDDFEALGNSAPISSSPPNIGE-RSSFSNVTRLGFAAGHDSPN  685

Query  466  LKLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNR  287
               E T  ++ +S+ T+  TG ++  T SFA+VTSR  +      +   E GK+GKK +R
Sbjct  686  FNNEPTNVQSSSSEVTNATTGVRNTNTTSFASVTSRTPSTP----TTVKEPGKRGKKASR  741

Query  286  VLLSTSSSRRY  254
            VLLST+S RRY
Sbjct  742  VLLSTTSVRRY  752



>ref|NP_001046958.1| Os02g0516600 [Oryza sativa Japonica Group]
 dbj|BAD38143.1| putative ring finger protein 10 [Oryza sativa Japonica Group]
 dbj|BAF08872.1| Os02g0516600 [Oryza sativa Japonica Group]
Length=744

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 121/199 (61%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL  MLP  +L+PFM EIK REKQRKR A+ E  +++KAE           
Sbjct  555  TTTFQFCEIDLGDMLPPSSLAPFMDEIKKREKQRKRTAKKEESDRVKAEVAAAAQASAML  614

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F++   S     +   G   FS DDFEALGN+A  S+SPPA+   + LFS+VARLGFA+ 
Sbjct  615  FEHTSFS---PSSGPHGDFMFSLDDFEALGNNAGPSTSPPASE--RKLFSDVARLGFASA  669

Query  481  HDSPALKLE--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDP-NVSKASEVG  311
             DSP L++E  D   K+E+    +GE G      LSFA++ S  +  ++  +  K + VG
Sbjct  670  QDSPPLRVESGDLTGKSES----TGEQGPAATPALSFASIISSTRASDNSLDTHKPNVVG  725

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKKP +VLLST   RRY
Sbjct  726  KKGKKPTKVLLSTGGGRRY  744



>gb|EEC73269.1| hypothetical protein OsI_07406 [Oryza sativa Indica Group]
Length=735

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 121/199 (61%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL  MLP  +L+PFM EIK REKQRKR A+ E  +++KAE           
Sbjct  546  TTTFQFCEIDLGDMLPPSSLAPFMDEIKKREKQRKRTAKKEESDRVKAEVAAAAQASAML  605

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F++   S     +   G   FS DDFEALGN+A  S+SPPA+   + LFS+VARLGFA+ 
Sbjct  606  FEHTSFS---PSSGPHGDFMFSLDDFEALGNNAGPSTSPPASE--RKLFSDVARLGFASA  660

Query  481  HDSPALKLE--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDP-NVSKASEVG  311
             DSP L++E  D   K+E+    +GE G      LSFA++ S  +  ++  +  K + VG
Sbjct  661  QDSPPLRVESGDLTGKSES----TGEQGPAATPALSFASIISSTRASDNSLDTHKPNVVG  716

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKKP +VLLST   RRY
Sbjct  717  KKGKKPTKVLLSTGGGRRY  735



>gb|EEE57081.1| hypothetical protein OsJ_06908 [Oryza sativa Japonica Group]
Length=735

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 121/199 (61%), Gaps = 20/199 (10%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL  MLP  +L+PFM EIK REKQRKR A+ E  +++KAE           
Sbjct  546  TTTFQFCEIDLGDMLPPSSLAPFMDEIKKREKQRKRTAKKEESDRVKAEVAAAAQASAML  605

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F++   S     +   G   FS DDFEALGN+A  S+SPPA+   + LFS+VARLGFA+ 
Sbjct  606  FEHTSFS---PSSGPHGDFMFSLDDFEALGNNAGPSTSPPASE--RKLFSDVARLGFASA  660

Query  481  HDSPALKLE--DTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDP-NVSKASEVG  311
             DSP L++E  D   K+E+    +GE G      LSFA++ S  +  ++  +  K + VG
Sbjct  661  QDSPPLRVESGDLTGKSES----TGEQGPAATPALSFASIISSTRASDNSLDTHKPNVVG  716

Query  310  KKGKKPNRVLLSTSSSRRY  254
            KKGKKP +VLLST   RRY
Sbjct  717  KKGKKPTKVLLSTGGGRRY  735



>gb|EPS67903.1| hypothetical protein M569_06871, partial [Genlisea aurea]
Length=587

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 116/191 (61%), Gaps = 17/191 (9%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEI+L  +LPA++L PF+ E+ NREKQRKRVAR E +EK+KAE    Q++   Y
Sbjct  410  TTTFQLCEINLGHLLPAESLFPFLDEVNNREKQRKRVARKESKEKLKAEAAANQFSLEPY  469

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKL----LFSNVARLGFAAGHDSP  470
                + Y   P++S DDFEALG+ +       ++ + +      FS+VARLGFA+ HDSP
Sbjct  470  Y---SRYDAAPSYSMDDFEALGSGSADVVVAASSSSSRWPAAQSFSSVARLGFASAHDSP  526

Query  469  ALKLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPN  290
            AL+       ++ + ++   T  +    +SFA+V S ++    P  +  S  GKKGK+  
Sbjct  527  ALR------NSQEASSSVSSTSSESRNKVSFASVLSGSQ----PASASRSHAGKKGKRAA  576

Query  289  RVLLSTSSSRR  257
            R+LLST+  RR
Sbjct  577  RILLSTAGGRR  587



>ref|XP_009405452.1| PREDICTED: RING finger protein 10 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=791

 Score =   129 bits (324),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 115/188 (61%), Gaps = 4/188 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ +L+PF+ E+K REKQR R+AR E+ E+ +AE    Q   +S 
Sbjct  608  TTTFQLCEIDLRDLLPSSSLAPFLDEMKKREKQRHRLARKENDERARAEAASAQLNLISS  667

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                 ++     FS+DDFEALG  A I+ S       + LFS+V RLGFAA HDSP+L+ 
Sbjct  668  AQRQLTH-KDVVFSSDDFEALG--ANIAPSSSPPTGERKLFSDVTRLGFAAAHDSPSLRA  724

Query  457  EDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVLL  278
            E++   +      S     +   T SFA + S A  VE  +  + S  GKKGKKPNRVLL
Sbjct  725  EESADVSGDVAEASHVYAPRPMTTSSFATILSSACDVES-SEQQTSAQGKKGKKPNRVLL  783

Query  277  STSSSRRY  254
            ST+SSRRY
Sbjct  784  STASSRRY  791



>ref|XP_009405454.1| PREDICTED: RING finger protein 10 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=781

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 115/188 (61%), Gaps = 14/188 (7%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LP+ +L+PF+ E+K REKQR R+AR E+ E+ +AE    Q   +S 
Sbjct  608  TTTFQLCEIDLRDLLPSSSLAPFLDEMKKREKQRHRLARKENDERARAEAASAQLNLISS  667

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKL  458
                 ++     FS+DDFEALG  A I+ S       + LFS+V RLGFAA HDSP+L+ 
Sbjct  668  AQRQLTH-KDVVFSSDDFEALG--ANIAPSSSPPTGERKLFSDVTRLGFAAAHDSPSLRA  724

Query  457  EDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVLL  278
            E+          ++  +  +   T SFA + S A  VE  +  + S  GKKGKKPNRVLL
Sbjct  725  EE----------SADVSAPRPMTTSSFATILSSACDVES-SEQQTSAQGKKGKKPNRVLL  773

Query  277  STSSSRRY  254
            ST+SSRRY
Sbjct  774  STASSRRY  781



>ref|XP_011006118.1| PREDICTED: uncharacterized protein LOC105112205 [Populus euphratica]
Length=134

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 3/129 (2%)
 Frame = -3

Query  634  LADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKLE  455
               +SY   P FS +DFEALG      SS P     ++LFSNVAR GFAAGHDSPALK+E
Sbjct  7    FGQSSYDTSPNFSMEDFEALG-ICSPMSSSPPVAGERILFSNVARFGFAAGHDSPALKIE  65

Query  454  DTLP--KTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
            + +P    +   N+S   G +++G  SFANVT+R K  E+ + SK +EV KKGKKPNRVL
Sbjct  66   ENVPLQNNKPGNNSSNLNGSRNSGPSSFANVTARPKPEENVDPSKMNEVSKKGKKPNRVL  125

Query  280  LSTSSSRRY  254
            LST+  RRY
Sbjct  126  LSTTGGRRY  134



>ref|XP_006647257.1| PREDICTED: RING finger protein 10-like [Oryza brachyantha]
Length=681

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 123/195 (63%), Gaps = 12/195 (6%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK------AETTGFQ  656
            TT FQ CEIDL  MLP  +L+PFM EIK R KQRK+ A+ E ++++K      A+ +  +
Sbjct  492  TTTFQFCEIDLGDMLPPSSLAPFMDEIKKRGKQRKQTAKKEERDRVKAEVAAAAQASAMR  551

Query  655  YAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHD  476
            +  L+++ +   + G   FS DDFEALGN+   S+SPPA+   + LFS+V RLGFA+  D
Sbjct  552  FEHLNFSHSSGPH-GDFMFSLDDFEALGNNPGPSTSPPASE--RKLFSDVTRLGFASAQD  608

Query  475  SPALKLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDP-NVSKASEVGKKGK  299
            SP L++E  +  T  S++T GE G      LSFA++ S  +  ++  +  K + VGKKGK
Sbjct  609  SPPLRVETGV-LTGKSEST-GEQGPAATSALSFASIISSTRAADNSLDTHKPNGVGKKGK  666

Query  298  KPNRVLLSTSSSRRY  254
            KP +VLLST   RRY
Sbjct  667  KPTKVLLSTGGGRRY  681



>ref|XP_010528130.1| PREDICTED: RING finger protein 10 isoform X1 [Tarenaya hassleriana]
Length=746

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT F +CEID+ + LP +A +PF+ EIK REKQRK  AR E +EK+KAE           
Sbjct  564  TTTFLICEIDMRESLPPNAFAPFLDEIKKREKQRKDRARKERKEKVKAEVAAAAELAPLV  623

Query  637  -NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             +   +S    P FS DDFEALGN+A +SSSPP     +  FSNV RLGFAAGHDSP L 
Sbjct  624  TSFGQSSRNDFPPFSLDDFEALGNAAPVSSSPPNTGE-RSSFSNVTRLGFAAGHDSPGLI  682

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
               T  +  + Q  +   G ++ G +SFA+  SR    E        E GK+GKKP RVL
Sbjct  683  NLPTSIQNNSIQVANTVIGSRNPGVMSFASAISRTPVTE-----TVKEAGKRGKKPARVL  737

Query  280  LSTSSSRRY  254
            LSTSS RRY
Sbjct  738  LSTSSVRRY  746



>gb|ACN34207.1| unknown [Zea mays]
 gb|AFW71576.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=743

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 116/193 (60%), Gaps = 9/193 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET-TGFQYAPLS  641
            TT FQ CEIDL  ++  ++L+PF+ EIK REKQRKR A+ E  E++KAE     Q + + 
Sbjct  555  TTTFQFCEIDLSDVVSPNSLAPFLDEIKKREKQRKRAAKKEESERVKAEVAAAVQASAMR  614

Query  640  YNLADTSYVGQPA-FSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
            +   ++S       FS DDFEALGN+A  S+SPPA+   + LFS+V RLGFA+  DSP L
Sbjct  615  FEYTNSSQSHNDVMFSLDDFEALGNNAGPSTSPPASE--RKLFSDVTRLGFASAQDSPPL  672

Query  463  KLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTV---EDPNVSKASEVGKKGKKP  293
            +L            TS + G      LSFA++ S ++ V   ++  + KA+  GKKGKK 
Sbjct  673  RLGTG--DANGQSETSRDQGPLATPALSFASIISSSRAVTAADNSEMQKANGAGKKGKKA  730

Query  292  NRVLLSTSSSRRY  254
             RVLLST   RRY
Sbjct  731  TRVLLSTGGGRRY  743



>ref|XP_010528131.1| PREDICTED: RING finger protein 10 isoform X2 [Tarenaya hassleriana]
Length=740

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 112/189 (59%), Gaps = 7/189 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT F +CEID+ + LP +A +PF+ EIK REKQRK  AR E +EK+KAE           
Sbjct  558  TTTFLICEIDMRESLPPNAFAPFLDEIKKREKQRKDRARKERKEKVKAEVAAAAELAPLV  617

Query  637  -NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK  461
             +   +S    P FS DDFEALGN+A +SSSPP     +  FSNV RLGFAAGHDSP L 
Sbjct  618  TSFGQSSRNDFPPFSLDDFEALGNAAPVSSSPPNTGE-RSSFSNVTRLGFAAGHDSPGLI  676

Query  460  LEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVL  281
               T  +  + Q  +   G ++ G +SFA+  SR    E        E GK+GKKP RVL
Sbjct  677  NLPTSIQNNSIQVANTVIGSRNPGVMSFASAISRTPVTE-----TVKEAGKRGKKPARVL  731

Query  280  LSTSSSRRY  254
            LSTSS RRY
Sbjct  732  LSTSSVRRY  740



>ref|XP_002453901.1| hypothetical protein SORBIDRAFT_04g021110 [Sorghum bicolor]
 gb|EES06877.1| hypothetical protein SORBIDRAFT_04g021110 [Sorghum bicolor]
Length=742

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 117/193 (61%), Gaps = 9/193 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET-TGFQYAPLS  641
            TT FQ CEIDL  ++   +L+PF+ EIK REKQR+R A+ E  E+ KAE     Q + + 
Sbjct  554  TTTFQFCEIDLSDIVSPSSLAPFLDEIKKREKQRRRTAKKEESERAKAEVAAAVQASAMR  613

Query  640  YNLADTSYVGQPA-FSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
            +  A++S       FS DDFEALGN+A  S+SP  +   + LFS+V RLGFA+  DSP L
Sbjct  614  FEYANSSQSHNDVMFSLDDFEALGNNAGPSTSPRVSE--RKLFSDVTRLGFASAQDSPPL  671

Query  463  KLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTV---EDPNVSKASEVGKKGKKP  293
            +L  T      S+N S + G      LSFA++ S ++ V   ++  + KA+  GKKGKK 
Sbjct  672  RL-GTGDANGQSEN-SRDQGPLATPALSFASIISSSRAVAAADNSEMQKANGTGKKGKKA  729

Query  292  NRVLLSTSSSRRY  254
             RVLLST  +RRY
Sbjct  730  TRVLLSTGGARRY  742



>ref|NP_189307.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAB01736.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL67021.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAO22812.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEE77205.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=772

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 116/192 (60%), Gaps = 8/192 (4%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK-AETTGFQYAPLS  641
            +T  Q+CEID+ + LP DA +PF+ EIK REKQRK  A  + + K+K       +  PL 
Sbjct  585  STTLQICEIDMKESLPPDAFAPFIHEIKKREKQRKERAWKDRKNKIKAEVAAAAELVPLM  644

Query  640  YNLADTSYVGQ-PAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
             +   +S     P FS DDFEALGNSA ISSSPP     +  FS+V RLGFAAGHDSP L
Sbjct  645  ASFGQSSSSDDFPPFSLDDFEALGNSAPISSSPPNIGE-RSSFSHVTRLGFAAGHDSPNL  703

Query  463  KLEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPN  290
              E T     + +S+ ++  TG ++    SFA+V SR  T   P V    E GK+GKK +
Sbjct  704  NNEPTNVQSSSSSSEVSNATTGARNTNITSFASVASRTTTPMAPTV---KEPGKRGKKQS  760

Query  289  RVLLSTSSSRRY  254
            RVLLST+S RRY
Sbjct  761  RVLLSTTSVRRY  772



>dbj|BAK00968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 114/198 (58%), Gaps = 22/198 (11%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL  MLP  +L+PFM EIK REKQR + A+ E ++++KAE           
Sbjct  546  TTTFQFCEIDLSDMLPPISLAPFMDEIKRREKQRVQTAKKEEKDRVKAEVAAAAQESAMR  605

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F+Y   S   +D        FS DDFEALGN+A  S+SPPA+   + LFS+V RLGFA+ 
Sbjct  606  FEYTNFSRTQSDV------MFSLDDFEALGNNAGPSTSPPASE--RKLFSDVTRLGFASA  657

Query  481  HDSPALKLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDP--NVSKASEVGK  308
             DSP L+ E      + +   + + G   A ++SFA++ S  +   D    + K + VGK
Sbjct  658  QDSPPLRAE----TGDTNNEITRDQGPVAASSMSFASILSSTRAAADSRGEMPKPNGVGK  713

Query  307  KGKKPNRVLLSTSSSRRY  254
             GKK  +VLLST   RRY
Sbjct  714  AGKKRTKVLLSTGGGRRY  731



>ref|NP_001152489.1| LOC100286129 [Zea mays]
 gb|ACG47846.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=743

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 114/193 (59%), Gaps = 9/193 (5%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET-TGFQYAPLS  641
            TT FQ CEIDL  ++  ++L+PF+ EIK REKQRKR A+ E  E++KAE     Q + + 
Sbjct  555  TTTFQFCEIDLSDVVSPNSLAPFLDEIKKREKQRKRAAKKEESERVKAEVAAAVQASAMR  614

Query  640  YNLADTSYVGQPA-FSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
            +   ++S       FS DDFEALGN+A  S+SPPA+     LFS+V  LGFA+  DSP L
Sbjct  615  FEYTNSSQSHNDVMFSLDDFEALGNNAGPSTSPPASEXK--LFSDVTHLGFASAQDSPPL  672

Query  463  KLEDTLPKTEASQNTSGETGRKHAGTLSFANVTSRAKTV---EDPNVSKASEVGKKGKKP  293
            +L            TS + G      LSFA++ S ++ V   ++  + KA+  GKKGKK 
Sbjct  673  RLGTG--DANGQSETSRDQGPLATPALSFASIISSSRAVTAADNSEMQKANGAGKKGKKA  730

Query  292  NRVLLSTSSSRRY  254
             RVLLST   RRY
Sbjct  731  TRVLLSTGGGRRY  743



>ref|XP_004952585.1| PREDICTED: RING finger protein 10-like [Setaria italica]
Length=745

 Score =   118 bits (295),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 116/201 (58%), Gaps = 25/201 (12%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL  ++   +L+PF+ EIK REKQRKR A+ E  E++KAE           
Sbjct  557  TTTFQFCEIDLSDIVSPSSLAPFLDEIKKREKQRKRTAKKEESERVKAEVAAAVQASAMR  616

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F++   S +  D        FS DDFEALGN+A  S+SPPA+   + LFS+V RLGFA+ 
Sbjct  617  FEFTNFSQSHNDV------MFSLDDFEALGNNAGPSTSPPASE--RKLFSDVTRLGFASA  668

Query  481  HDSPALKLE--DTLPKTEASQNTSGETGRKHAGTLSF---ANVTSRAKTVEDPNVSKASE  317
             DSP L++E  D   K E+++    + G      LSF    + +  A   ++  + K + 
Sbjct  669  QDSPPLRVETGDASGKNESAR----DQGPSAPPALSFASIISSSRAAAAADNLEMQKPNG  724

Query  316  VGKKGKKPNRVLLSTSSSRRY  254
            VGKKGKKP RVLLST   RRY
Sbjct  725  VGKKGKKPARVLLSTGGGRRY  745



>ref|XP_003575036.1| PREDICTED: RING finger protein 10 [Brachypodium distachyon]
Length=744

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 113/198 (57%), Gaps = 18/198 (9%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL + LP  +L PFM E+K REKQRKR A  E  ++ +AE           
Sbjct  555  TTTFQFCEIDLSEELPCISLGPFMDEMKKREKQRKRTAEKEESDRARAEVAAAVQLSAMR  614

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F++A  S++  D        FS DDFEALGN A  S+SPPA+   + LFS+V RLGFA+ 
Sbjct  615  FEHANFSHSHNDV------MFSLDDFEALGNIAGPSTSPPASE--RKLFSDVTRLGFASA  666

Query  481  HDSPALKLEDTLPKTEASQNTSGETGRKHAGTLSFANV--TSRAKTVEDPNVSKASEVGK  308
             DSP L ++     T     +S +       +LSFA++  ++RA       + + +  GK
Sbjct  667  QDSPPLGVDSGPGDTAGKHESSRDQAPAATSSLSFASILASTRAAAGNSVEMHRPNGAGK  726

Query  307  KGKKPNRVLLSTSSSRRY  254
            KGKKP++VLLST   RRY
Sbjct  727  KGKKPSKVLLSTGGGRRY  744



>gb|EMT18775.1| RING finger protein 10 [Aegilops tauschii]
Length=380

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 114/244 (47%), Gaps = 63/244 (26%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTG--------  662
            TT FQ CEIDL  MLP  +L+PFM EIK REKQR + A+ E ++++KAE           
Sbjct  144  TTTFQFCEIDLSDMLPPASLAPFMDEIKRREKQRIQTAKKEEKDRVKAEVAAAAQESAMR  203

Query  661  FQYAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAG  482
            F+Y   S   +D        FS DDFEALGN+A   S+ P A   K LFS+V RLGFA+ 
Sbjct  204  FEYTNFSRTQSDV------MFSLDDFEALGNNAAGPSTSPPAGERK-LFSDVTRLGFASA  256

Query  481  HDSPALKLE------------------------------------------DTLPKTEAS  428
              SP L+ E                                          D+ P    +
Sbjct  257  LGSPPLRAETGDTNNEITRDQGTPHHNQVFLHMAGSSVFRVLCQHPIFYSLDSPPLRAET  316

Query  427  QNTSGETGRKH----AGTLSFANVTS--RAKTVEDPNVSKASEVGKKGKKPNRVLLSTSS  266
             +T+ E  R      A ++SFA++ S  RA       + K + VGK GKK  +VLLST  
Sbjct  317  GDTNNEITRDQGPVAASSVSFASILSSTRASADSSAEMPKPNGVGKAGKKRTKVLLSTGG  376

Query  265  SRRY  254
             RRY
Sbjct  377  GRRY  380



>emb|CAA66823.1| hypothetical protein [Arabidopsis thaliana]
Length=191

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 97/166 (58%), Gaps = 5/166 (3%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK-AETTGFQYAPLS  641
            +T  Q+CEID+ + LP DA +PF+ EIK REKQRK  A  + + K+K       +  PL 
Sbjct  23   STTLQICEIDMKESLPPDAFAPFIHEIKKREKQRKERAWKDRKNKIKAEVAAAAELVPLM  82

Query  640  YNLADTSYVGQ-PAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
             +   +S     P FS DDFEALGNSA ISSSPP     +  FS+V RLGFAAGHDSP L
Sbjct  83   ASFGQSSSSDDFPPFSLDDFEALGNSAPISSSPPNIGE-RSSFSHVTRLGFAAGHDSPNL  141

Query  463  KLEDT--LPKTEASQNTSGETGRKHAGTLSFANVTSRAKTVEDPNV  332
              E T     + +S+ ++  TG ++    SFA+V SR  T   P V
Sbjct  142  NNEPTNVQSSSSSSEVSNATTGARNTNITSFASVASRTTTPMAPTV  187



>ref|XP_006290606.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
 gb|EOA23504.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
Length=817

 Score =   103 bits (258),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 69/140 (49%), Positives = 90/140 (64%), Gaps = 3/140 (2%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMK--AETTGFQYAPL  644
            TT FQ+CEID+ + LP DA +PF+ EIK REKQRK  AR E ++K+K           PL
Sbjct  583  TTTFQICEIDMRESLPPDAFAPFIDEIKKREKQRKDRARKEQKDKIKAEVAAAAELVVPL  642

Query  643  SYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPAL  464
              +   +S+   P+FS DDFEALGNSA ISSSPP     +  FS+V RLGFAAGHDSP L
Sbjct  643  MASFGRSSHDDFPSFSLDDFEALGNSAPISSSPPNIRE-RNSFSHVTRLGFAAGHDSPNL  701

Query  463  KLEDTLPKTEASQNTSGETG  404
              + T  ++ +++ T+  TG
Sbjct  702  NNDPTNVQSSSNEVTNATTG  721



>gb|ACN41106.1| unknown [Picea sitchensis]
Length=828

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 105/203 (52%), Gaps = 17/203 (8%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAETTGFQYAPLSY  638
            TT FQLCEIDL  +LPA A  PF  EI+ R  +R+R  + E + K        Q  P+  
Sbjct  628  TTTFQLCEIDLSDLLPASAFFPFTDEIEKRNAERRRRRKQEARAKRVDSAVTVQARPVLP  687

Query  637  NLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALK-  461
                 S   +P  S+ DFEALG     S S P     K LFS+V RLG AAG+DSPALK 
Sbjct  688  EFTYVSTDDKPP-SSADFEALGEPKSASVSSPVLNERK-LFSHVTRLGLAAGYDSPALKE  745

Query  460  -LEDTL-PKTEASQN---------TSGETGRKHAGTLSFANVTSRAKTVEDP---NVSKA  323
             L   L P + AS +          S + G   + T+SFA++ +  K         VSK+
Sbjct  746  GLSGELSPGSMASASNSINMERVGVSADGGTSSSSTMSFADIITAPKPSGQECSRQVSKS  805

Query  322  SEVGKKGKKPNRVLLSTSSSRRY  254
               GKKGKK  +VLLST+  RRY
Sbjct  806  QSSGKKGKKATKVLLSTAGGRRY  828



>emb|CDX71433.1| BnaC04g16680D [Brassica napus]
Length=134

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = -3

Query  580  ALGNsavisssppaavAGKLLFSNVARLGFAAGHDSPALKLEDTL---PKTEASQNTSGE  410
            ALGNSA + SS P  +  +  FS+V RLGFAAGHDSP L  E T      + +S+ T+  
Sbjct  27   ALGNSAPVVSSSPPTIGERSSFSHVTRLGFAAGHDSPNLNNEPTTNVQSSSSSSEVTNAT  86

Query  409  TGRKHAGTLSFANVTSRAKTVEDPNVSKASEVGKKGKKPNRVLLSTSSSRRY  254
            TG ++  T SFA+VTSR  T   P   K  E GK+GKK +RVLLST+S RRY
Sbjct  87   TGARNTNTTSFASVTSRTPTT--PVAIK--EPGKRGKKQSRVLLSTTSVRRY  134



>ref|XP_002977414.1| hypothetical protein SELMODRAFT_443565 [Selaginella moellendorffii]
 gb|EFJ21418.1| hypothetical protein SELMODRAFT_443565 [Selaginella moellendorffii]
Length=829

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 100/203 (49%), Gaps = 29/203 (14%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKM------KAETTGFQ  656
            T+ FQLCE+DL K+LP+ +LSPF  E+  RE +R+R  +   QEKM      + E     
Sbjct  591  TSTFQLCEVDLSKILPSSSLSPFKDELHAREVRRQRRLK---QEKMLKSAGQRLEEKVVP  647

Query  655  YAPLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHD  476
             +P  Y +A  + + +    ND  E +  S     +    V  + LFS VA+LGFA+GHD
Sbjct  648  PSPADY-IAIMNALHEDEVPNDS-EFVAPSTAPVPASSPPVDERRLFSRVAKLGFASGHD  705

Query  475  SPALK---LEDTLP----KTEASQNTSGETGRKHAGTLSFANVTSR---AKTVEDPNVSK  326
            +P L    L    P    ++  +Q  +         +LSFA+   R    KT E P+   
Sbjct  706  APDLTNDGLSSNRPPIQQQSPWNQKQAPAGSSSGGASLSFADAIQRKVEKKTPEAPSRGA  765

Query  325  ASEVGKKGKKPNRVLLSTSSSRR  257
            A    +KGK    VLLST S R+
Sbjct  766  A----RKGK----VLLSTGSGRK  780



>ref|XP_002974997.1| hypothetical protein SELMODRAFT_442720 [Selaginella moellendorffii]
 gb|EFJ23782.1| hypothetical protein SELMODRAFT_442720 [Selaginella moellendorffii]
Length=1011

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 101/202 (50%), Gaps = 27/202 (13%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKA-----ETTGFQY  653
            T+ FQLCE+DL K+LP+ +LSPF  E+  RE +R+R  R++  + +K+     E      
Sbjct  785  TSTFQLCEVDLSKILPSSSLSPFKDELHAREVRRQR--RLKQDKMLKSAGQRLEEKVVPP  842

Query  652  APLSYNLADTSYVGQPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFAAGHDS  473
            +P  Y +A  + + +    ND  E +  S     +    V  + LFS VA+LGFA+GHD+
Sbjct  843  SPADY-IAIMNALHEDEVPNDS-EFVAASTAPVPASSPPVDERRLFSRVAKLGFASGHDA  900

Query  472  PALK---LEDTLP----KTEASQNTSGETGRKHAGTLSFANVTSR---AKTVEDPNVSKA  323
            P L    L    P    ++  +Q  +         +LSFA+   R    KT E P+   A
Sbjct  901  PDLTNDGLSSNRPPIQQQSPWNQKQAPAGSSSGGASLSFADAIQRKVEKKTPEAPSRGAA  960

Query  322  SEVGKKGKKPNRVLLSTSSSRR  257
                +KGK    VLLST S R+
Sbjct  961  ----RKGK----VLLSTGSGRK  974



>gb|KDO43574.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=549

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEH  692
            TT FQLCEIDL + LP DALSPF+ EI+ REKQRK++A   H
Sbjct  497  TTTFQLCEIDLTEALPPDALSPFIDEIRKREKQRKQLANKSH  538



>gb|AFW71577.1| hypothetical protein ZEAMMB73_891715 [Zea mays]
Length=638

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEKMKAET  668
            TT FQ CEIDL  ++  ++L+PF+ EIK REKQRKR A+ E  E++KAE 
Sbjct  555  TTTFQFCEIDLSDVVSPNSLAPFLDEIKKREKQRKRAAKKEESERVKAEV  604



>ref|XP_001753592.1| predicted protein [Physcomitrella patens]
 gb|EDQ81815.1| predicted protein [Physcomitrella patens]
Length=877

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 87/167 (52%), Gaps = 25/167 (15%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARME-----HQEKMKAETTGFQY  653
            T  FQLCE+DL  MLP +A SPF  EI+ R+++R+R  ++E      +E++ A T     
Sbjct  650  TANFQLCEVDLNGMLPPEAFSPFSEEIRVRQQRRRRAIKLEKNERAREERLAAFTASQPR  709

Query  652  APLSYNLADTSYVG-----QPAFSNDDFEALGNsavisssppaavAGKLLFSNVARLGFA  488
            AP   + A  +Y+G     +P  S  D   LG       +       + LFSNVA++GFA
Sbjct  710  APTPADFA--AYMGSLQIEEPVSSGFD---LGE--PTVVTASPPSDSRSLFSNVAKMGFA  762

Query  487  AGHDSPAL-KLEDTL-------PKTEASQNTSGETGRKHAGTLSFAN  371
            +G+D+P L  LE  L         + +S  + GE G   + +LSFA+
Sbjct  763  SGYDAPQLVPLESVLSTPWGSSAASSSSSLSKGEAGGHGSSSLSFAD  809



>ref|XP_007032023.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY02949.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=599

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVAR  701
            TT FQLCEIDL  +LP DAL PFM EIK REK RK++AR
Sbjct  555  TTTFQLCEIDLSGVLPPDALLPFMDEIKKREKHRKQLAR  593



>gb|KCW55769.1| hypothetical protein EUGRSUZ_I01601 [Eucalyptus grandis]
Length=531

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARMEHQEK  683
            TT FQLCEIDL  +LP+D+L PFM EIK REK+RK++A+   + K
Sbjct  486  TTAFQLCEIDLTGILPSDSLLPFMDEIKKREKERKQLAKKVKERK  530



>ref|XP_008450027.1| PREDICTED: RING finger protein 10 isoform X3 [Cucumis melo]
Length=628

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVARME  695
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQR ++A+ +
Sbjct  553  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRNQLAKKD  593



>ref|XP_008450028.1| PREDICTED: RING finger protein 10 isoform X4 [Cucumis melo]
Length=610

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  817  TTLFQLCEIDLLKMLPADALSPFMTEIKNREKQRKRVAR  701
            TT FQLCEIDL  +LP+ ++ PFM EIK REKQR ++A+
Sbjct  553  TTSFQLCEIDLTNLLPSVSMIPFMDEIKKREKQRNQLAK  591



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1673236833030