BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045D22

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW86673.1|  hypothetical protein EUGRSUZ_B032971                    285   3e-91   Eucalyptus grandis [rose gum]
gb|AGZ20104.1|  copper methylamine oxidase-like protein                 296   6e-91   Camellia sinensis [black tea]
emb|CDP13211.1|  unnamed protein product                                278   2e-89   Coffea canephora [robusta coffee]
gb|KHN13432.1|  Copper methylamine oxidase                              286   2e-87   Glycine soja [wild soybean]
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    287   4e-87   Eucalyptus grandis [rose gum]
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       285   4e-87   Vitis vinifera
emb|CAN62304.1|  hypothetical protein VITISV_023689                     285   5e-87   Vitis vinifera
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    286   5e-87   
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      285   8e-87   
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       285   8e-87   Vitis vinifera
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    285   9e-87   Glycine max [soybeans]
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    284   1e-86   Nelumbo nucifera [Indian lotus]
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             285   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    284   2e-86   Nelumbo nucifera [Indian lotus]
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             282   3e-86   
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    282   4e-86   Populus euphratica
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      284   4e-86   
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    283   6e-86   Populus euphratica
ref|XP_002314600.1|  copper amine oxidase family protein                281   7e-86   Populus trichocarpa [western balsam poplar]
ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             283   7e-86   Citrus sinensis [apfelsine]
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             283   7e-86   Citrus clementina [clementine]
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             283   1e-85   
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        281   1e-85   
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    282   2e-85   Cicer arietinum [garbanzo]
ref|XP_010102489.1|  Putative primary amine oxidase 2                   280   2e-85   
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             282   2e-85   Nicotiana tomentosiformis
ref|XP_003613133.1|  Copper amine oxidase                               281   2e-85   
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             281   2e-85   Medicago truncatula
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   280   3e-85   Citrus sinensis [apfelsine]
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    281   4e-85   Malus domestica [apple tree]
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    281   4e-85   
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             281   4e-85   Vitis vinifera
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             279   5e-85   Medicago truncatula
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    281   5e-85   Nicotiana sylvestris
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         281   5e-85   Jatropha curcas
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             280   5e-85   Medicago truncatula
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   281   6e-85   Citrus sinensis [apfelsine]
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             280   6e-85   Glycine max [soybeans]
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             280   6e-85   Medicago truncatula
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             280   7e-85   Medicago truncatula
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         280   8e-85   Cicer arietinum [garbanzo]
ref|XP_002527922.1|  copper amine oxidase, putative                     280   1e-84   Ricinus communis
gb|KHN00390.1|  Copper methylamine oxidase                              280   1e-84   Glycine soja [wild soybean]
ref|XP_008777611.1|  PREDICTED: copper amine oxidase 1-like             263   1e-84   Phoenix dactylifera
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             280   1e-84   Phaseolus vulgaris [French bean]
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  280   1e-84   Solanum lycopersicum
gb|KJB50258.1|  hypothetical protein B456_008G160800                    280   2e-84   Gossypium raimondii
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             279   2e-84   Prunus persica
gb|AIS23648.1|  amine oxidase 5                                         280   2e-84   Malus domestica [apple tree]
gb|KJB50254.1|  hypothetical protein B456_008G160800                    280   2e-84   Gossypium raimondii
ref|XP_002511334.1|  copper amine oxidase, putative                     280   2e-84   Ricinus communis
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             279   2e-84   Phaseolus vulgaris [French bean]
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             279   2e-84   Prunus mume [ume]
gb|AIS23644.1|  amine oxidase 1                                         278   3e-84   Malus domestica [apple tree]
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             279   4e-84   
gb|KHG02854.1|  Copper methylamine oxidase                              279   5e-84   Gossypium arboreum [tree cotton]
gb|KHG02564.1|  Primary amine oxidase                                   278   5e-84   Gossypium arboreum [tree cotton]
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             277   8e-84   Phaseolus vulgaris [French bean]
gb|KJB15626.1|  hypothetical protein B456_002G186900                    278   8e-84   Gossypium raimondii
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             277   8e-84   
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             277   1e-83   
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    276   2e-83   Populus euphratica
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             276   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    276   2e-83   Populus euphratica
gb|AIS23647.1|  amine oxidase 4                                         276   3e-83   Malus domestica [apple tree]
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             276   3e-83   Populus euphratica
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             276   3e-83   
ref|XP_004301007.1|  PREDICTED: copper amine oxidase 1-like             276   3e-83   Fragaria vesca subsp. vesca
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             276   3e-83   Pyrus x bretschneideri [bai li]
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             276   3e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             276   4e-83   Solanum tuberosum [potatoes]
ref|XP_004309984.2|  PREDICTED: copper amine oxidase 1-like             276   5e-83   Fragaria vesca subsp. vesca
emb|CBI14968.3|  unnamed protein product                                281   8e-83   Vitis vinifera
gb|AFK48029.1|  unknown                                                 257   1e-82   Lotus japonicus
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   273   3e-82   Citrus sinensis [apfelsine]
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             273   4e-82   Citrus clementina [clementine]
ref|XP_010100391.1|  Copper methylamine oxidase                         274   7e-82   
gb|AES71447.2|  copper amine oxidase, enzyme domain protein             267   8e-82   Medicago truncatula
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       271   9e-82   Cucumis melo [Oriental melon]
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       272   1e-81   Cucumis melo [Oriental melon]
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      272   1e-81   
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          271   2e-81   Amborella trichopoda
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    271   2e-81   Citrus sinensis [apfelsine]
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             271   2e-81   Sesamum indicum [beniseed]
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             271   3e-81   Prunus mume [ume]
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    269   3e-81   Citrus sinensis [apfelsine]
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  271   3e-81   Eucalyptus grandis [rose gum]
gb|EPS71193.1|  hypothetical protein M569_03564                         254   5e-81   Genlisea aurea
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     275   7e-81   Eucalyptus grandis [rose gum]
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             270   8e-81   Tarenaya hassleriana [spider flower]
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             270   1e-80   Tarenaya hassleriana [spider flower]
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             268   1e-80   Medicago truncatula
gb|KHG07734.1|  Primary amine oxidase                                   269   1e-80   Gossypium arboreum [tree cotton]
ref|XP_003601196.1|  Primary amine oxidase                              267   1e-80   
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         268   2e-80   Cicer arietinum [garbanzo]
ref|XP_003601195.1|  Primary amine oxidase                              268   2e-80   Medicago truncatula
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         269   2e-80   
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  268   3e-80   Elaeis guineensis
emb|CDP12746.1|  unnamed protein product                                268   3e-80   Coffea canephora [robusta coffee]
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         268   4e-80   
gb|KJB19706.1|  hypothetical protein B456_003G116000                    268   5e-80   Gossypium raimondii
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    266   7e-80   Glycine max [soybeans]
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    267   8e-80   Glycine max [soybeans]
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    263   1e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             263   2e-78   Sesamum indicum [beniseed]
ref|XP_004289862.2|  PREDICTED: copper amine oxidase 1-like             262   3e-78   Fragaria vesca subsp. vesca
gb|KHN18421.1|  Copper methylamine oxidase                              261   3e-78   Glycine soja [wild soybean]
ref|XP_006411505.1|  hypothetical protein EUTSA_v100163161mg            251   4e-78   
gb|ACN27241.1|  unknown                                                 248   4e-78   Zea mays [maize]
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             262   5e-78   Phaseolus vulgaris [French bean]
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                262   5e-78   Erythranthe guttata [common monkey flower]
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    261   6e-78   Glycine max [soybeans]
gb|KJB19705.1|  hypothetical protein B456_003G116000                    262   9e-78   Gossypium raimondii
dbj|BAD95322.1|  putative copper amine oxidase                          254   3e-77   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16250.1|  unknown                                                 260   4e-77   Picea sitchensis
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             259   4e-77   Solanum lycopersicum
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             258   1e-76   Arabidopsis lyrata subsp. lyrata
gb|AAD23730.1|  putative copper amine oxidase                           258   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             258   2e-76   Solanum tuberosum [potatoes]
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             258   2e-76   Nicotiana tomentosiformis
ref|NP_001169559.1|  uncharacterized protein LOC100383438               247   2e-76   
emb|CAN76391.1|  hypothetical protein VITISV_023592                     258   2e-76   Vitis vinifera
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             258   3e-76   
ref|NP_181777.2|  copper amine oxidase family protein                   257   5e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             256   7e-76   Nicotiana sylvestris
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             256   9e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    254   1e-75   Nicotiana tomentosiformis
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             255   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             255   3e-75   Solanum lycopersicum
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             254   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    254   6e-75   Camelina sativa [gold-of-pleasure]
ref|NP_001053078.1|  Os04g0476100                                       248   6e-75   
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             253   8e-75   Brassica rapa
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             253   8e-75   Capsella rubella
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             253   9e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          253   1e-74   Sorghum bicolor [broomcorn]
dbj|BAF49520.1|  N-methylputrescine oxidase                             253   1e-74   Nicotiana tabacum [American tobacco]
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    253   1e-74   Nicotiana tomentosiformis
dbj|BAJ87935.1|  predicted protein                                      248   2e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    252   2e-74   Arabis alpina [alpine rockcress]
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             252   2e-74   Nicotiana sylvestris
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             252   3e-74   Brachypodium distachyon [annual false brome]
emb|CAE05498.2|  OSJNBa0022H21.18                                       250   4e-74   Oryza sativa Japonica Group [Japonica rice]
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             251   4e-74   Medicago truncatula
ref|XP_001774529.1|  predicted protein                                  250   4e-74   
ref|XP_001753509.1|  predicted protein                                  249   7e-74   
emb|CAH67316.1|  OSIGBa0106G07.12                                       249   7e-74   Oryza sativa [red rice]
emb|CDY35376.1|  BnaA03g19840D                                          253   1e-73   Brassica napus [oilseed rape]
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             249   1e-73   
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             250   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          251   2e-73   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94528.1|  hypothetical protein OsI_16305                          250   2e-73   Oryza sativa Indica Group [Indian rice]
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    249   2e-73   
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    249   2e-73   Brassica rapa
emb|CDY47975.1|  BnaA04g24530D                                          249   3e-73   Brassica napus [oilseed rape]
emb|CDY14839.1|  BnaC04g48360D                                          249   3e-73   Brassica napus [oilseed rape]
gb|KJB50255.1|  hypothetical protein B456_008G160800                    249   4e-73   Gossypium raimondii
gb|KJB50256.1|  hypothetical protein B456_008G160800                    249   4e-73   Gossypium raimondii
gb|KJB50257.1|  hypothetical protein B456_008G160800                    249   4e-73   Gossypium raimondii
gb|EMS63127.1|  Primary amine oxidase                                   248   5e-73   Triticum urartu
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             249   5e-73   Setaria italica
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             252   1e-72   Phaseolus vulgaris [French bean]
emb|CDY22564.1|  BnaC03g23740D                                          250   1e-72   Brassica napus [oilseed rape]
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    244   8e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    243   3e-71   Glycine max [soybeans]
ref|XP_001757203.1|  predicted protein                                  243   3e-71   
ref|XP_001759255.1|  predicted protein                                  241   1e-70   
gb|EMT09520.1|  Copper methylamine oxidase                              242   3e-70   
gb|EMS61925.1|  Copper methylamine oxidase                              239   1e-69   Triticum urartu
emb|CAE02362.2|  OSJNBb0016B03.15                                       239   2e-69   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001173054.1|  Os02g0593150                                       225   2e-68   
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    233   1e-67   Nicotiana tomentosiformis
gb|EEC76708.1|  hypothetical protein OsI_14715                          228   9e-66   Oryza sativa Indica Group [Indian rice]
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          226   1e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002985875.1|  hypothetical protein SELMODRAFT_123165             223   5e-64   
ref|XP_002984811.1|  hypothetical protein SELMODRAFT_121227             223   6e-64   
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358             221   3e-63   
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550          214   1e-60   
gb|EEE57286.1|  hypothetical protein OsJ_07344                          209   8e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642             208   5e-58   Selaginella moellendorffii
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             201   8e-56   
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   198   1e-54   Citrus sinensis [apfelsine]
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      196   8e-54   
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   194   4e-53   Citrus sinensis [apfelsine]
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      191   3e-52   
gb|KJB19704.1|  hypothetical protein B456_003G116000                    189   2e-51   Gossypium raimondii
ref|WP_027094208.1|  tyramine oxidase                                   159   5e-41   Cohnella thermotolerans
ref|WP_025696771.1|  tyramine oxidase                                   155   3e-40   Paenibacillus durus
ref|WP_008317043.1|  Cu2+-containing amine oxidase                      157   3e-40   Leptolyngbya sp. PCC 6406
gb|EEC73513.1|  hypothetical protein OsI_07883                          155   6e-40   Oryza sativa Indica Group [Indian rice]
ref|WP_007920030.1|  tyramine oxidase                                   155   8e-40   Ktedonobacter racemifer
ref|WP_036584415.1|  tyramine oxidase                                   155   1e-39   Paenibacillus darwinianus
ref|WP_017299862.1|  tyramine oxidase                                   152   8e-39   Nodosilinea nodulosa
gb|ETX01504.1|  hypothetical protein ETSY2_37115                        147   1e-38   Candidatus Entotheonella gemina
ref|WP_035986372.1|  tyramine oxidase                                   151   3e-38   Leptolyngbya sp. KIOST-1
ref|WP_012627324.1|  tyramine oxidase                                   150   4e-38   Cyanothece sp. PCC 7425
gb|ABD03718.1|  putative copper methylamine oxidase                     150   4e-38   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_041436864.1|  tyramine oxidase                                   150   4e-38   
ref|WP_011430198.1|  tyramine oxidase                                   150   5e-38   Synechococcus sp. JA-3-3Ab
ref|WP_036002001.1|  tyramine oxidase                                   150   6e-38   [Leptolyngbya] sp. JSC-1
ref|WP_039728302.1|  MULTISPECIES: tyramine oxidase                     149   1e-37   Lyngbya confervoides
ref|WP_012873420.1|  tyramine oxidase                                   149   2e-37   Sphaerobacter thermophilus
ref|WP_008314860.1|  Cu2+-containing amine oxidase                      149   2e-37   Leptolyngbya sp. PCC 6406
ref|WP_015845121.1|  tyramine oxidase                                   147   7e-37   Paenibacillus sp. JDR-2
ref|WP_015186652.1|  Copper amine oxidase domain-containing protein     147   7e-37   Gloeocapsa sp. PCC 7428
ref|WP_036531589.1|  tyramine oxidase                                   147   8e-37   Neosynechococcus sphagnicola
ref|WP_015124381.1|  Cu2+-containing amine oxidase                      147   1e-36   Synechococcus sp. PCC 6312
ref|WP_006520181.1|  Cu2+-containing amine oxidase                      147   1e-36   Leptolyngbya sp. PCC 7375
ref|WP_036480875.1|  tyramine oxidase                                   146   2e-36   
ref|WP_006456034.1|  tyramine oxidase                                   146   2e-36   Synechococcus sp. PCC 7335
ref|WP_009633550.1|  Cu2+-containing amine oxidase                      144   6e-36   Synechocystis sp. PCC 7509
ref|WP_012935344.1|  tyramine oxidase                                   144   8e-36   Conexibacter woesei
gb|AIA11119.1|  Copper amine oxidase, enzyme domain protein             136   9e-36   uncultured bacterium
ref|WP_029635581.1|  hypothetical protein                               142   2e-35   
ref|WP_026159538.1|  hypothetical protein                               142   3e-35   
ref|WP_037709969.1|  tyramine oxidase                                   142   4e-35   Streptomyces mirabilis
ref|WP_029018078.1|  hypothetical protein                               142   4e-35   
ref|WP_041858942.1|  hypothetical protein                               142   5e-35   
gb|ABJ81915.1|  Amine oxidase (copper-containing)                       141   7e-35   Candidatus Solibacter usitatus Ellin6076
emb|CEG30995.1|  Primary amine oxidase precursor                        139   6e-34   Bacillus simplex
ref|WP_028063099.1|  tyramine oxidase                                   139   9e-34   Solirubrobacter soli
ref|WP_042206338.1|  tyramine oxidase                                   139   9e-34   Paenibacillus durus
ref|WP_041339143.1|  tyramine oxidase                                   138   1e-33   Rubrobacter radiotolerans
gb|AHY48354.1|  Cu2+-containing amine oxidase                           138   1e-33   Rubrobacter radiotolerans
ref|WP_043457655.1|  tyramine oxidase                                   138   2e-33   
ref|WP_024819190.1|  tyramine oxidase                                   138   2e-33   Arthrobacter sp. 31Y
ref|WP_009075996.1|  tyramine oxidase                                   137   2e-33   Actinobacteria
ref|WP_035742293.1|  tyramine oxidase                                   133   2e-33   
ref|WP_043836428.1|  tyramine oxidase                                   137   2e-33   Amycolatopsis orientalis
ref|WP_026844103.1|  tyramine oxidase                                   137   2e-33   Geodermatophilaceae bacterium URHA0031
gb|EHN12772.1|  Monoamine oxidase                                       137   3e-33   Patulibacter medicamentivorans
ref|WP_037817779.1|  tyramine oxidase                                   137   3e-33   Streptomyces sp. NRRL F-3213
ref|WP_040597665.1|  tyramine oxidase                                   137   3e-33   Patulibacter medicamentivorans
ref|WP_037715216.1|  tyramine oxidase                                   137   3e-33   Actinobacteria
ref|WP_036725089.1|  tyramine oxidase                                   137   3e-33   Paenibacillus forsythiae
gb|EFL10175.1|  tyramine oxidase                                        137   3e-33   Streptomyces sp. AA4
ref|WP_019310622.1|  tyramine oxidase                                   137   4e-33   Kocuria
ref|WP_035741463.1|  tyramine oxidase                                   134   4e-33   
gb|EMP12147.1|  primary amine oxidase                                   137   4e-33   Gordonia sp. NB4-1Y
ref|WP_028074137.1|  tyramine oxidase                                   137   4e-33   
ref|WP_015320499.1|  Cu2+-containing amine oxidase                      137   4e-33   Natronococcus occultus
ref|WP_028930454.1|  tyramine oxidase                                   136   5e-33   Pseudonocardia asaccharolytica
ref|WP_020471082.1|  hypothetical protein                               136   5e-33   Zavarzinella formosa
ref|WP_033318483.1|  hypothetical protein                               137   5e-33   Streptomyces yerevanensis
ref|WP_033288818.1|  tyramine oxidase                                   136   6e-33   Amycolatopsis jejuensis
ref|WP_037362055.1|  tyramine oxidase                                   135   7e-33   Amycolatopsis orientalis
ref|WP_034299865.1|  hypothetical protein                               128   8e-33   
ref|WP_018685630.1|  hypothetical protein                               135   1e-32   Actinokineospora enzanensis
ref|WP_034315126.1|  tyramine oxidase                                   135   2e-32   Bacillus simplex
ref|WP_014740127.1|  tyramine oxidase                                   135   2e-32   Modestobacter marinus
ref|WP_003805961.1|  copper-containing amine oxidase                    132   2e-32   
ref|WP_028921142.1|  tyramine oxidase                                   134   3e-32   Pseudonocardia acaciae
ref|WP_028921006.1|  hypothetical protein                               134   4e-32   
ref|XP_005964261.1|  PREDICTED: copper amine oxidase 1-like             134   4e-32   Pantholops hodgsonii [Tibetan antelope]
ref|WP_005179100.1|  putative copper-containing amine oxidase           134   4e-32   Gordonia aichiensis
ref|WP_035743334.1|  tyramine oxidase                                   134   5e-32   Arthrobacter sp. MA-N2
ref|WP_004562824.1|  tyramine oxidase                                   133   5e-32   Amycolatopsis vancoresmycina
ref|WP_028065493.1|  tyramine oxidase                                   134   5e-32   Solirubrobacter soli
ref|WP_012714637.1|  tyramine oxidase                                   134   6e-32   Sulfolobus islandicus
ref|WP_014513326.1|  tyramine oxidase                                   134   6e-32   
ref|WP_016730365.1|  tyramine oxidase                                   134   6e-32   Sulfolobus islandicus
sp|Q07123.1|AMO2_ARTS1  RecName: Full=Copper methylamine oxidase;...    134   6e-32   Arthrobacter sp. P1
ref|WP_033349571.1|  tyramine oxidase                                   133   6e-32   
ref|WP_041312973.1|  tyramine oxidase                                   133   7e-32   Saccharothrix espanaensis
sp|Q07121.1|AMO1_ARTS1  RecName: Full=Primary amine oxidase; AltN...    133   7e-32   Arthrobacter sp. P1
ref|WP_037411516.1|  tyramine oxidase                                   133   7e-32   Solirubrobacter sp. URHD0082
ref|WP_017651781.1|  tyramine oxidase                                   133   8e-32   Fortiea contorta
ref|WP_012411235.1|  tyramine oxidase                                   133   8e-32   Nostoc punctiforme
ref|WP_027416719.1|  tyramine oxidase                                   133   8e-32   Aneurinibacillus terranovensis
ref|WP_034290510.1|  tyramine oxidase                                   133   8e-32   Bacillus sp. 72
emb|CCH30742.1|  Histamine oxidase                                      133   9e-32   Saccharothrix espanaensis DSM 44229
ref|WP_005556120.1|  tyramine oxidase                                   133   9e-32   Natronococcus amylolyticus
ref|WP_005168021.1|  Monoamine oxidase                                  132   1e-31   Amycolatopsis azurea
ref|WP_022928833.1|  tyramine oxidase                                   132   1e-31   Patulibacter americanus
ref|WP_034306167.1|  tyramine oxidase                                   132   1e-31   Amycolatopsis lurida
ref|WP_026421607.1|  tyramine oxidase                                   132   1e-31   Actinokineospora inagensis
ref|WP_026556533.1|  tyramine oxidase                                   132   1e-31   Arthrobacter sp. 35W
ref|WP_026556508.1|  tyramine oxidase                                   132   1e-31   Arthrobacter sp. 35W
ref|WP_016333935.1|  primary-amine oxidase                              132   1e-31   Amycolatopsis keratiniphila
ref|WP_037078438.1|  tyramine oxidase                                   132   1e-31   
ref|WP_035837338.1|  histamine oxidase                                  132   1e-31   
ref|WP_028271227.1|  histamine oxidase                                  132   2e-31   
ref|WP_003350826.1|  tyramine oxidase                                   132   3e-31   
ref|WP_024477500.1|  histamine oxidase                                  131   3e-31   
ref|WP_018774097.1|  tyramine oxidase                                   132   3e-31   
ref|WP_032385619.1|  hypothetical protein                               132   3e-31   
ref|WP_037040542.1|  tyramine oxidase                                   132   3e-31   
ref|WP_035876493.1|  histamine oxidase                                  131   3e-31   
ref|WP_037336996.1|  tyramine oxidase                                   131   3e-31   
ref|WP_034266611.1|  tyramine oxidase                                   131   3e-31   
ref|WP_026104174.1|  tyramine oxidase                                   131   4e-31   
ref|WP_043709977.1|  tyramine oxidase                                   131   4e-31   
ref|WP_042341482.1|  tyramine oxidase                                   131   4e-31   
ref|WP_044853065.1|  tyramine oxidase                                   131   4e-31   
ref|WP_037305302.1|  tyramine oxidase                                   130   5e-31   
ref|WP_016205391.1|  tyramine oxidase                                   131   5e-31   
gb|AFY34999.1|  Copper amine oxidase domain-containing protein          131   5e-31   
ref|XP_008907114.1|  hypothetical protein PPTG_13290                    131   5e-31   
gb|ETI44133.1|  hypothetical protein F443_11140                         131   5e-31   
ref|WP_018760783.1|  tyramine oxidase                                   131   5e-31   
ref|WP_039705665.1|  hypothetical protein                               130   5e-31   
gb|ETO72786.1|  hypothetical protein F444_11200                         131   5e-31   
ref|WP_038514355.1|  tyramine oxidase                                   130   6e-31   
ref|WP_011693327.1|  tyramine oxidase                                   130   6e-31   
ref|WP_020636390.1|  tyramine oxidase                                   130   6e-31   
ref|WP_007029111.1|  tyramine oxidase                                   130   6e-31   
ref|WP_039923589.1|  tyramine oxidase                                   130   7e-31   
ref|WP_026538164.1|  histamine oxidase                                  130   7e-31   
ref|WP_018393282.1|  hypothetical protein                               130   7e-31   
ref|WP_038549924.1|  histamine oxidase                                  130   8e-31   
gb|ERK69570.1|  histamine oxidase                                       130   8e-31   
gb|KGT47861.1|  hypothetical protein GW12_10980                         126   9e-31   
ref|WP_043484145.1|  histamine oxidase                                  130   9e-31   
ref|WP_028276189.1|  histamine oxidase                                  130   9e-31   
ref|WP_034584673.1|  tyramine oxidase                                   127   1e-30   
ref|WP_019483707.1|  tyramine oxidase                                   130   1e-30   
ref|WP_009377663.1|  tyramine oxidase                                   130   1e-30   
ref|WP_034284434.1|  tyramine oxidase                                   130   1e-30   
ref|WP_018778238.1|  tyramine oxidase                                   130   1e-30   
ref|WP_024084556.1|  tyramine oxidase                                   130   1e-30   
ref|WP_015595580.1|  tyramine oxidase                                   129   1e-30   
ref|WP_024819386.1|  histamine oxidase                                  129   2e-30   
ref|XP_005702395.1|  primary-amine oxidase                              129   2e-30   
ref|WP_018770046.1|  tyramine oxidase                                   129   2e-30   
ref|WP_034285194.1|  tyramine oxidase                                   129   2e-30   
ref|WP_043710196.1|  tyramine oxidase                                   129   2e-30   
ref|WP_009881574.1|  tyramine oxidase                                   129   2e-30   
ref|WP_026552762.1|  histamine oxidase                                  129   3e-30   
ref|WP_039243055.1|  histamine oxidase                                  129   3e-30   
ref|WP_028676864.1|  tyramine oxidase                                   129   3e-30   
ref|WP_010612233.1|  tyramine oxidase                                   129   3e-30   
gb|ABM10664.1|  amine oxidase, copper-containing                        129   3e-30   
gb|AHG88986.1|  Copper amine oxidase domain-containing protein          129   3e-30   
ref|WP_043807325.1|  histamine oxidase                                  129   3e-30   
ref|WP_002616189.1|  nickel transporter                                 129   3e-30   
ref|WP_006090340.1|  tyramine oxidase                                   129   3e-30   
ref|WP_043470977.1|  histamine oxidase                                  129   3e-30   
ref|WP_007694497.1|  tyramine oxidase                                   129   4e-30   
ref|WP_043806482.1|  histamine oxidase                                  128   4e-30   
gb|AFR27483.1|  Cu2+-containing amine oxidase                           129   4e-30   
gb|KHN14535.1|  Histamine oxidase                                       120   4e-30   
gb|ABM10002.1|  amine oxidase (copper-containing)                       129   4e-30   
ref|WP_041457930.1|  tyramine oxidase                                   129   4e-30   
ref|WP_011278970.1|  tyramine oxidase                                   129   4e-30   
gb|AFW94818.1|  amine oxidase                                           129   4e-30   
ref|WP_028267210.1|  histamine oxidase                                  128   5e-30   
ref|WP_026543389.1|  histamine oxidase                                  128   5e-30   
ref|WP_015217010.1|  Copper amine oxidase domain-containing protein     128   5e-30   
gb|EEB83863.1|  amine oxidase (copper-containing)                       122   5e-30   
ref|WP_028390396.1|  tyramine oxidase                                   128   5e-30   
ref|WP_034341918.1|  hypothetical protein                               128   5e-30   
ref|WP_014922900.1|  tyramine oxidase                                   128   6e-30   
ref|WP_025780611.1|  histamine oxidase                                  128   6e-30   
ref|WP_027749196.1|  tyramine oxidase                                   127   7e-30   
ref|WP_043806367.1|  histamine oxidase                                  128   7e-30   
pdb|3WA2|X  Chain X, High Resolution Crystal Structure Of Copper ...    127   7e-30   
pdb|2E2U|A  Chain A, Substrate Schiff-base Analogue Of Copper Ami...    127   7e-30   
ref|WP_035485230.1|  tyramine oxidase                                   127   8e-30   
pdb|1UI7|A  Chain A, Site-Directed Mutagenesis Of His433 Involved...    127   8e-30   
ref|WP_003799421.1|  tyramine oxidase                                   127   8e-30   
ref|WP_018330660.1|  hypothetical protein                               127   8e-30   
pdb|2YX9|A  Chain A, Crystal Structure Of D298k Copper Amine Oxid...    127   8e-30   
pdb|1IVV|A  Chain A, Crystal Structure Of Copper Amine Oxidase Fr...    127   8e-30   
pdb|2CWT|A  Chain A, Catalytic Base Deletion In Copper Amine Oxid...    127   8e-30   
ref|WP_015938722.1|  tyramine oxidase                                   127   9e-30   
ref|WP_024818298.1|  histamine oxidase                                  127   9e-30   
pdb|1SIH|A  Chain A, Agao In Covalent Complex With The Inhibitor ...    127   9e-30   
ref|WP_043742548.1|  tyramine oxidase                                   127   9e-30   
ref|WP_010144585.1|  tyramine oxidase                                   127   9e-30   
ref|WP_039731529.1|  tyramine oxidase                                   127   1e-29   
ref|WP_043455865.1|  histamine oxidase                                  127   1e-29   
ref|WP_036335313.1|  tyramine oxidase                                   127   1e-29   
ref|WP_028066479.1|  tyramine oxidase                                   127   1e-29   
ref|WP_043427296.1|  tyramine oxidase                                   127   1e-29   
ref|WP_037049762.1|  tyramine oxidase                                   127   1e-29   
ref|WP_026547874.1|  histamine oxidase                                  127   1e-29   
ref|WP_036338604.1|  tyramine oxidase                                   127   1e-29   
ref|XP_005703912.1|  primary-amine oxidase                              127   1e-29   
ref|WP_006066801.1|  tyramine oxidase                                   127   1e-29   
ref|WP_036454811.1|  tyramine oxidase                                   127   2e-29   
ref|WP_017200065.1|  tyramine oxidase                                   127   2e-29   
ref|WP_011777249.1|  tyramine oxidase                                   127   2e-29   
gb|ELQ86689.1|  primary amine oxidase                                   126   2e-29   
ref|WP_044571418.1|  histamine oxidase                                  126   2e-29   
gb|ETP41443.1|  hypothetical protein F442_11410                         127   2e-29   
ref|WP_037408872.1|  tyramine oxidase                                   126   2e-29   
gb|ETI43485.1|  hypothetical protein F443_11515                         126   2e-29   
ref|WP_026439043.1|  tyramine oxidase                                   126   2e-29   
ref|XP_008907589.1|  hypothetical protein PPTG_13573                    126   2e-29   
ref|WP_031465870.1|  tyramine oxidase                                   126   2e-29   
ref|WP_008494925.1|  tyramine oxidase                                   126   2e-29   
ref|WP_020673325.1|  hypothetical protein                               126   3e-29   
ref|XP_009515861.1|  hypothetical protein PHYSODRAFT_343894             126   3e-29   
ref|WP_033288996.1|  tyramine oxidase                                   126   3e-29   
ref|WP_043643838.1|  tyramine oxidase                                   126   3e-29   
ref|WP_007144763.1|  tyramine oxidase                                   126   4e-29   
ref|WP_043834413.1|  tyramine oxidase                                   125   4e-29   
ref|WP_036475588.1|  tyramine oxidase                                   125   4e-29   
ref|WP_026005433.1|  histamine oxidase                                  125   4e-29   
gb|EXF24973.1|  Histamine oxidase                                       126   4e-29   
ref|WP_040019527.1|  tyramine oxidase                                   125   4e-29   
ref|WP_040270524.1|  tyramine oxidase                                   125   4e-29   
gb|EWM22333.1|  copper amine oxidase                                    125   5e-29   
ref|WP_008413752.1|  tyramine oxidase                                   125   5e-29   
gb|AJP05492.1|  tyramine oxidase                                        125   5e-29   
ref|WP_044379234.1|  tyramine oxidase                                   125   5e-29   
ref|WP_013678400.1|  tyramine oxidase                                   125   5e-29   
ref|WP_003895293.1|  primary amine oxidase                              125   5e-29   
ref|WP_018395580.1|  hypothetical protein                               125   6e-29   
ref|XP_009515875.1|  hypothetical protein PHYSODRAFT_343895             127   6e-29   
ref|WP_040728048.1|  tyramine oxidase                                   125   6e-29   
gb|AJT42947.1|  tyramine oxidase                                        125   6e-29   
gb|AGB23966.1|  Cu2+-containing amine oxidase                           125   6e-29   
ref|WP_041312313.1|  tyramine oxidase                                   125   6e-29   
ref|WP_020510980.1|  hypothetical protein                               125   6e-29   
ref|WP_011729366.1|  tyramine oxidase                                   125   7e-29   
ref|WP_040167401.1|  hypothetical protein                               125   7e-29   
ref|WP_003803495.1|  tyramine oxidase                                   125   7e-29   
ref|WP_041038062.1|  tyramine oxidase                                   125   7e-29   
ref|WP_016882495.1|  tyramine oxidase                                   125   9e-29   
ref|WP_011595316.1|  tyramine oxidase                                   124   9e-29   
ref|WP_005260964.1|  tyramine oxidase                                   124   9e-29   
ref|WP_043806534.1|  tyramine oxidase                                   124   9e-29   
ref|WP_032366965.1|  tyramine oxidase                                   124   9e-29   
ref|WP_005562649.1|  tyramine oxidase                                   124   9e-29   
ref|WP_014877840.1|  tyramine oxidase                                   125   1e-28   
ref|WP_005250970.1|  tyramine oxidase                                   124   1e-28   
gb|ABM07053.1|  copper methylamine oxidase                              124   1e-28   
ref|WP_009078783.1|  tyramine oxidase                                   124   1e-28   
ref|XP_005851907.1|  hypothetical protein CHLNCDRAFT_18415              124   1e-28   
gb|AII08562.1|  tyramine oxidase                                        124   1e-28   
ref|WP_040431327.1|  tyramine oxidase                                   124   1e-28   
ref|WP_007301564.1|  tyramine oxidase                                   124   1e-28   
ref|WP_037226125.1|  tyramine oxidase                                   124   1e-28   
ref|XP_009515100.1|  hypothetical protein PHYSODRAFT_539188             124   1e-28   
ref|WP_009990204.1|  tyramine oxidase                                   124   1e-28   
ref|WP_012689537.1|  tyramine oxidase                                   124   1e-28   
pdb|1UI8|A  Chain A, Site-directed Mutagenesis Of His592 Involved...    124   1e-28   
gb|KJF19252.1|  Histamine oxidase                                       124   2e-28   
ref|WP_027133873.1|  hypothetical protein                               124   2e-28   
ref|WP_015140710.1|  Cu2+-containing amine oxidase                      124   2e-28   
ref|WP_037368234.1|  tyramine oxidase                                   124   2e-28   
ref|XP_009515103.1|  hypothetical protein PHYSODRAFT_247622             124   2e-28   
ref|WP_006066345.1|  tyramine oxidase                                   124   2e-28   
ref|WP_020502057.1|  hypothetical protein                               123   2e-28   
ref|WP_009475297.1|  tyramine oxidase                                   124   2e-28   
ref|WP_038993072.1|  histamine oxidase                                  124   2e-28   
ref|WP_044440882.1|  hypothetical protein                               123   2e-28   
ref|WP_043120134.1|  hypothetical protein                               123   3e-28   
ref|WP_043709465.1|  tyramine oxidase                                   123   3e-28   
ref|WP_014377254.1|  tyramine oxidase                                   123   3e-28   
ref|WP_026266296.1|  tyramine oxidase                                   123   3e-28   
ref|WP_039731313.1|  tyramine oxidase                                   123   3e-28   
ref|WP_013675838.1|  tyramine oxidase                                   123   3e-28   
ref|WP_043742191.1|  tyramine oxidase                                   123   3e-28   
ref|WP_037709039.1|  tyramine oxidase                                   123   4e-28   
ref|WP_037805791.1|  tyramine oxidase                                   122   5e-28   
ref|WP_035653101.1|  hypothetical protein                               122   5e-28   
ref|WP_015889407.1|  tyramine oxidase                                   122   6e-28   
gb|ERF79999.1|  hypothetical protein C207_06798                         122   6e-28   
gb|AII05461.1|  tyramine oxidase                                        122   6e-28   
ref|WP_035952394.1|  tyramine oxidase                                   122   6e-28   
ref|WP_037080446.1|  hypothetical protein                               122   6e-28   
ref|WP_038680250.1|  tyramine oxidase                                   122   7e-28   
gb|EFC82890.1|  Primary-amine oxidase                                   122   7e-28   
ref|WP_041242048.1|  tyramine oxidase                                   122   7e-28   
ref|WP_015320488.1|  Cu2+-containing amine oxidase                      122   7e-28   
ref|WP_010997581.1|  tyramine oxidase                                   122   8e-28   
ref|WP_029121388.1|  tyramine oxidase                                   122   8e-28   
gb|ADB74456.1|  Primary-amine oxidase                                   122   8e-28   
ref|WP_029104655.1|  tyramine oxidase                                   122   8e-28   
ref|WP_033292479.1|  tyramine oxidase                                   122   8e-28   
ref|WP_020874939.1|  hypothetical protein                               115   8e-28   
ref|WP_035740546.1|  tyramine oxidase                                   122   9e-28   
ref|WP_020464622.1|  tyramine oxidase                                   122   1e-27   
ref|WP_037243707.1|  tyramine oxidase                                   121   1e-27   
ref|WP_036548944.1|  tyramine oxidase                                   121   1e-27   
ref|WP_035756669.1|  histamine oxidase                                  121   1e-27   
sp|Q59118.3|AMOH_ARTGO  RecName: Full=Histamine oxidase; AltName:...    121   1e-27   
ref|WP_015113274.1|  Copper amine oxidase domain-containing protein     121   1e-27   
ref|WP_039714126.1|  tyramine oxidase                                   121   1e-27   
ref|WP_027941288.1|  tyramine oxidase                                   121   2e-27   
ref|WP_035770172.1|  hypothetical protein                               121   2e-27   
ref|WP_036398013.1|  histamine oxidase                                  121   2e-27   
ref|WP_014358553.1|  tyramine oxidase                                   121   2e-27   
ref|WP_010523912.1|  tyramine oxidase                                   121   2e-27   
ref|WP_026536743.1|  tyramine oxidase                                   120   2e-27   
ref|WP_024451999.1|  tyramine oxidase                                   120   2e-27   
ref|WP_005238602.1|  tyramine oxidase                                   120   2e-27   
ref|WP_039403219.1|  tyramine oxidase                                   120   2e-27   
ref|WP_004517446.1|  tyramine oxidase                                   121   2e-27   
ref|WP_036397349.1|  tyramine oxidase                                   120   2e-27   
ref|WP_038376103.1|  hypothetical protein                               114   2e-27   
ref|WP_015155560.1|  Copper amine oxidase domain-containing protein     120   3e-27   
ref|WP_011440032.1|  tyramine oxidase                                   120   3e-27   
ref|WP_026134453.1|  tyramine oxidase                                   120   3e-27   
ref|WP_043968455.1|  monoamine oxidase                                  120   3e-27   
ref|WP_007296131.1|  MULTISPECIES: tyramine oxidase                     120   3e-27   
ref|WP_028276231.1|  tyramine oxidase                                   120   3e-27   
ref|WP_027331473.1|  tyramine oxidase                                   120   3e-27   



>gb|KCW86673.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
 gb|KCW86674.1| hypothetical protein EUGRSUZ_B032971, partial [Eucalyptus grandis]
Length=345

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  179  CNPLSARHWIIRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  238

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  239  ARDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  298

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  299  RIGFMLMPHGFFNCSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  345



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   296 bits (757),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 152/167 (91%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY
Sbjct  585  CDPLSARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  644

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  645  ARDEMYPGGEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGVTHIPRLEDWPVMPVE  704

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPSS D D K+N V+TKP + GLVAKL
Sbjct  705  RIGFMLMPHGFFNCSPAVDVPPSSCDSDVKDNVVVTKPINNGLVAKL  751



>emb|CDP13211.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = -2

Query  764  KLNWKPCVTCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFL  585
            K   +    CNP +ARHWI++NTR VNRTGQLTGYKLVPGSNC  LA  EAKFLRRAAFL
Sbjct  107  KTELEAMCDCNPSTARHWIVRNTRAVNRTGQLTGYKLVPGSNCQRLARPEAKFLRRAAFL  166

Query  584  KHNLWVTPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  405
            KHNLWVTPY+ +E FPGGEFPNQNPRVGEGLA+WV++NRPLEETDIVLWYVFGVTHVPRL
Sbjct  167  KHNLWVTPYSHDEKFPGGEFPNQNPRVGEGLATWVRENRPLEETDIVLWYVFGVTHVPRL  226

Query  404  EDWPVMPVERIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            EDWPVMPVE IGF LMPHGFFNCSPA+DVP SS D D KENG+ITKPCH GLVAKL
Sbjct  227  EDWPVMPVEHIGFTLMPHGFFNCSPAIDVPLSSCDSDVKENGMITKPCHNGLVAKL  282



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  572  CDPLSARHWIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  631

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  632  ARDEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  691

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  692  RIGFMLMPHGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  738



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   287 bits (734),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  630  CNPLSARHWIIRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  689

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  690  ARDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  749

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+S D + KENG+  K    GL+AK+
Sbjct  750  RIGFMLMPHGFFNCSPAVDVPPNSGDSELKENGMAAKSIQNGLLAKM  796



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   285 bits (728),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  534  CNPLSARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  594  ARDEMYPGGEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  654  HIGFRLMPHGFFNCSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  700



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   285 bits (728),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  540  CNPLSARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  599

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  600  ARDEMYPGGEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVE  659

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPPS+ D D K+NGV  KP   GL+AKL
Sbjct  660  HIGFRLMPHGFFNCSPAVDVPPSTCDLDLKDNGVTGKPIQNGLLAKL  706



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   286 bits (731),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  600  CDPLSARHWIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  659

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  660  ARDEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  719

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  720  RIGFMLMPHGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  766



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   285 bits (730),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  603  CNPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  662

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR EM+PGGEFPNQNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  663  AREEMYPGGEFPNQNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  722

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  723  RIGFMLMPHGFFNCSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  769



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   285 bits (730),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  608  CNPLSARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  667

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WV QNR LEETDIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  668  ARDEMYPGGEFPNQNPRVGEGLATWVNQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVE  727

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPPS+ + D K+NGV  KP   GL+AKL
Sbjct  728  HIGFRLMPHGFFNCSPAVDVPPSTCELDLKDNGVTGKPIQNGLLAKL  774



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  598  CDPLSARHWIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  657

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  658  ARDEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  717

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  718  RIGFMLMPHGFFNCSPAVDVPPNPSDLDDKENGLPAKPIQNGLIAKL  764



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR+VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRA+FLKHNLWVTPY
Sbjct  575  CNPLSARHWIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPY  634

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EM+PGGEFPNQNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVE
Sbjct  635  SRDEMYPGGEFPNQNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVE  694

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  695  RIGFMLMPHGFFNCSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  740



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR+VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  615  CNPLTARHWIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EM+PGGEFPNQNPR+GEGLA+WVKQ+R LEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  675  SRDEMYPGGEFPNQNPRIGEGLATWVKQDRSLEETDIVLWYVFGITHIPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+++D D K+N ++TK  H GL+AKL
Sbjct  735  RIGFMLMPHGFFNCSPAVDVPPNASDLDLKDN-IVTKSIHNGLLAKL  780



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 160/167 (96%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR+VNRTGQLTGYKLVPGSNCLPLAG+EAK LRRA+FLKHNLWVTPY
Sbjct  601  CNPLSARHWIVRNTRSVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRASFLKHNLWVTPY  660

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EM+PGGEFPNQNPRVGEGLA+WVKQ+RPLEETDIVLWY+FG+TH+PRLEDWPVMPVE
Sbjct  661  SRDEMYPGGEFPNQNPRVGEGLATWVKQDRPLEETDIVLWYIFGITHIPRLEDWPVMPVE  720

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS++D D K+N ++TKP   GL+AKL
Sbjct  721  RIGFMLMPHGFFNCSPAVDVPPSTSDLDLKDN-IVTKPIQNGLLAKL  766



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  535  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  594

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  595  AHDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  654

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  655  RIGFMLMPHGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  701



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   282 bits (721),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNR+GQLTG+KL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  534  CNPLSARHWIIRNTRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVE
Sbjct  594  ARDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  654  RIGFMLMPHGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   284 bits (727),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  631  CNPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  690

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR EM+PGGEFPNQNPRVGEGLA+WVK+NR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  691  AREEMYPGGEFPNQNPRVGEGLATWVKKNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  750

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+N + TKP   G++AKL
Sbjct  751  RIGFMLMPHGFFNCSPAVDVPPSATDLELKDNDIATKPIQNGIIAKL  797



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNR+GQLTG+KL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  600  CNPLSARHWIIRNTRTVNRSGQLTGFKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  659

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVE
Sbjct  660  ARDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVE  719

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  720  RIGFMLMPHGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  766



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   281 bits (720),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWII+NTRTVNR+GQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  534  CNPLSARHWIIRNTRTVNRSGQLTGYKLMPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETD+VLWYVFGVTH+PRLEDWPVMPVE
Sbjct  594  ARDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDVVLWYVFGVTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMP+GFFN SPAVDVPPS++D D K+N V  KP   GL+AKL
Sbjct  654  RIGFMLMPYGFFNSSPAVDVPPSASDLDLKDNVVAAKPIQNGLLAKL  700



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   283 bits (724),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  609  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  669  AHDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  729  RIGFMLMPHGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   283 bits (724),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  609  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  669  AHDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  729  RIGFMLMPHGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  775



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  619  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  678

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  679  AHDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  738

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  739  RIGFMLMPHGFFNCSPAVDVPPNESDLDLKDTVIAEKPVQNGLLAKL  785



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   281 bits (718),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSAR WI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  535  CDPLSARPWIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  594

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  595  ARDEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  654

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D KENG+  KP   GL+AKL
Sbjct  655  RIGFMLMPHGFFNCSPAVDVPPNQSDLDDKENGLPAKPIQNGLIAKL  701



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR+VNRTG LTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  594  CDPLSARHWIVRNTRSVNRTGYLTGYKLVPGANCLPLAGSEAKFLRRAAFLKHNLWVTPY  653

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR EM+PGGEFPNQNPR GEGLA+WVKQNRPLEE D+VLWYVFGVTH+PRLEDWPVMPVE
Sbjct  654  ARGEMYPGGEFPNQNPRDGEGLATWVKQNRPLEEADVVLWYVFGVTHIPRLEDWPVMPVE  713

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPS +D D KENG+  KP   GL+AKL
Sbjct  714  HIGFMLMPHGFFNCSPAVDVPPSPSDLDDKENGMPAKPSQNGLIAKL  760



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 156/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTG LTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  538  CNPLTARHWIIRNTRTVNRTGHLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  597

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPRVGEGLA+WV+QNRPLEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  598  ARDEMFPGGEFPNQNPRVGEGLATWVQQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVE  657

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFML PHGFFNCSPAVDVPP++ + D K++ V    + KP   G+++KL
Sbjct  658  RIGFMLTPHGFFNCSPAVDVPPNACELDAKDSDVKDAGVAKPIQNGMLSKL  708



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  612  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPY  671

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +EMFPGGEFPNQNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE
Sbjct  672  SGDEMFPGGEFPNQNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVE  731

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHP-GLVAKL  237
             IGFML PHGFFNCSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  732  HIGFMLQPHGFFNCSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  584  CNPLSARHWIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  643

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              NEM PGGEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  644  VHNEMHPGGEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  703

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  704  RIGFMLMPHGFFNCSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  750



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  571  CNPLSARHWIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  630

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              NEM PGGEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  631  VHNEMHPGGEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  690

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D D KENG+  KP    L+AKL
Sbjct  691  RIGFMLMPHGFFNCSPAVDVPPSAGDLDDKENGMPAKPIQNELIAKL  737



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPY
Sbjct  535  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPY  594

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  595  AHDEMYPGGEFPNQNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  654

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  655  RIGFMLMPHGFFNCSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  701



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  615  CNPLSARHWIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  675  ARDEMYPGGEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF LMPHGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  735  RIGFTLMPHGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  781



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  609  CNPLSARHWIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  669  ARDEMYPGGEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF LMPHGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  729  RIGFTLMPHGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  621  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVE
Sbjct  681  ARDEMFPGGEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVE  740

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFML PHGFFNCSPAVDVPP++ + D K+N V    + KP   GL++K+
Sbjct  741  RIGFMLQPHGFFNCSPAVDVPPNACELDGKDNDVKDNGVAKPIQTGLLSKI  791



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   279 bits (714),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  534  CDPLSARHWIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+E+ PGGEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  594  ARDELHPGGEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  654  HIGFMLMPHGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  700



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 156/168 (93%), Gaps = 1/168 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  612  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGTNCLPLAGSEAKFLRRAAFLKHNLWVTPY  671

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EMFPGGEFPNQNPRVGEGLA+WVKQNR LEET IVLWYVFG+ HVPRLEDWPVMPVE
Sbjct  672  CGDEMFPGGEFPNQNPRVGEGLATWVKQNRSLEETQIVLWYVFGLIHVPRLEDWPVMPVE  731

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHP-GLVAKL  237
             IGFML PHGFFNCSPAVDVPPS+AD D KENGV+TK CH  G++AKL
Sbjct  732  HIGFMLQPHGFFNCSPAVDVPPSTADSDIKENGVVTKSCHDGGIMAKL  779



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   281 bits (719),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  617  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  676

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  677  ARDEMFPGGEFPNQNPRVGEGLATWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVE  736

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFML PHGFFNCSPAVDVPP++ + D KE  V    + KP   GL++KL
Sbjct  737  RIGFMLSPHGFFNCSPAVDVPPNACELDAKETDVKENGVGKPIQSGLLSKL  787



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  558  CDPLSARHWIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  617

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+E+ PGGEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  618  ARDELHPGGEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVE  677

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  678  HIGFMLMPHGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  724



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   281 bits (718),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPY
Sbjct  609  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WV+QNR LEETDIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  669  AHDEMYPGGEFPNQNPRVGEGLATWVEQNRSLEETDIVLWYVFGVTHIPRLEDWPVMPVD  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP+ +D D K+  +  KP   GL+AKL
Sbjct  729  RIGFMLMPHGFFNCSPAVDVPPNESDLDLKDTAIAEKPVQNGLLAKL  775



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  594  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  653

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               EM PGGEFPNQNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  654  VPGEMHPGGEFPNQNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVE  713

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  714  RIGFMLMPHGFFNCSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  760



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  595  CDPLSARHWIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  654

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+E+ PGGEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  655  ARDELHPGGEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVE  714

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  715  HIGFMLMPHGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  761



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR+VNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  608  CDPLSARHWIVRNTRSVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  667

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+E+ PGGEFPNQNPRVGEGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  668  ARDELHPGGEFPNQNPRVGEGLATWVKQNRPLEEADIVLWYVFGVTHIPRLEDWPVMPVE  727

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPS  D D KENG+  K    GL+AKL
Sbjct  728  HIGFMLMPHGFFNCSPAVDVPPSPGDLDDKENGMPAKHSQNGLIAKL  774



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   280 bits (716),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  595  CNPLSARHWIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  654

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              NEM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  655  VHNEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  714

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPS+ D D KEN +  KP   GL+AKL
Sbjct  715  HIGFMLMPHGFFNCSPAVDVPPSAGDLDDKENVMSAKPIQNGLIAKL  761



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 157/168 (93%), Gaps = 1/168 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  628  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  687

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEET+IVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  688  APDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVE  747

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITK-PCHPGLVAKL  237
            RIGF+LMPHGFFNCSPAVDVPPS+ D D K+NG+  K P   GL+AKL
Sbjct  748  RIGFILMPHGFFNCSPAVDVPPSACDMDIKDNGITAKPPIQNGLLAKL  795



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLP+AG+EAKFLRRAAFLKHNLWVTPY
Sbjct  604  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPMAGSEAKFLRRAAFLKHNLWVTPY  663

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               EM PGGEFPNQNPRVGEGLA+WV++NR LEE DIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  664  VPGEMHPGGEFPNQNPRVGEGLATWVQKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVE  723

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS++D D KENG+  KP   G++AKL
Sbjct  724  RIGFMLMPHGFFNCSPAVDVPPSASDLDDKENGMSAKPIQNGMIAKL  770



>ref|XP_008777611.1| PREDICTED: copper amine oxidase 1-like, partial [Phoenix dactylifera]
Length=204

 Score =   263 bits (673),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 148/167 (89%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  38   CDPSSARHWIVRNTRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  97

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R+EM+PGGEFPNQNPR  EGLA+WVK+NR LEETDIVLWY+FGVTH+PRLEDWPVMPVE
Sbjct  98   NRDEMYPGGEFPNQNPRPNEGLATWVKKNRSLEETDIVLWYIFGVTHIPRLEDWPVMPVE  157

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCS AVDVPPS+++ D K+N    K     L+AKL
Sbjct  158  RIGFMLMPHGFFNCSTAVDVPPSTSEMDVKDNNGTPKLIQNALLAKL  204



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  603  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  662

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               EM PGGEFPNQNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  663  VPEEMHPGGEFPNQNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  722

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF+LMPHGFFNCSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  723  RIGFLLMPHGFFNCSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  769



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  609  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EMFPGGEFPNQNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE
Sbjct  669  SREEMFPGGEFPNQNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVE  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCH-PGLVAKL  237
             IGFML PHGFFNCSPAVDVPPS +D D KENG + K CH  G+++KL
Sbjct  729  HIGFMLQPHGFFNCSPAVDVPPSMSDSDIKENGTVAKSCHNDGVMSKL  776



>gb|KJB50258.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=779

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY
Sbjct  613  CDPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPY  672

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  673  SREEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  732

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  733  RIGFMLMPHGFFNCSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  779



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  611  CNPLSARHWIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSY  670

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+E++PGGEFPNQNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  671  ARDEVYPGGEFPNQNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  730

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF LMPHGFFNCS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  731  RIGFTLMPHGFFNCSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  618  CNPLTARHWIVQNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  677

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  678  SRDEMFPGGEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  737

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  738  RIGFMLMPHGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQSGLLAKL  788



>gb|KJB50254.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=789

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY
Sbjct  623  CDPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPY  682

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  683  SREEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  742

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  743  RIGFMLMPHGFFNCSPAVDVPPSATDLELKDTDIATKPIQNGIIAKL  789



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
             CNPL+ARHWI++NTRTVNR GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTP
Sbjct  626  ACNPLTARHWIVRNTRTVNRMGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTP  685

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            YAR+EMFPGGEFPNQNPRV EGL++WVKQNR LEETD+VLWYVFG+THVPRLEDWPVMPV
Sbjct  686  YARDEMFPGGEFPNQNPRVAEGLSTWVKQNRSLEETDVVLWYVFGITHVPRLEDWPVMPV  745

Query  380  ERIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            ERIGFMLMPHGFFNCSPAVDVPP+  + D KEN V    + KP   GL+AKL
Sbjct  746  ERIGFMLMPHGFFNCSPAVDVPPNVCELDIKENDVKENGVAKPLQNGLLAKL  797



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  591  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  650

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               EM PGGEFPNQNPRVGEGLA+WV+QNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  651  VPEEMHPGGEFPNQNPRVGEGLATWVQQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  710

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF+LMPHGFFNCSPAVDVPPS++D D K+NG+  KP   G++AKL
Sbjct  711  RIGFLLMPHGFFNCSPAVDVPPSASDLDDKDNGMSAKPIQNGVIAKL  757



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  611  CNPLSARHWIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSY  670

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+E++PGGEFPNQNPR+GEGLA+WVK+NR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  671  ARDEVYPGGEFPNQNPRIGEGLATWVKKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  730

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF LMPHGFFNCS AVDVPP++ D D K+NG+  KP   GL+AKL
Sbjct  731  RIGFTLMPHGFFNCSTAVDVPPNTCDLDLKDNGMTAKPIQNGLLAKL  777



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  609  CNPLSARHWIVRNTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM PGGEFPNQNPR+GEGLA+WV++NR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  669  ARDEMNPGGEFPNQNPRIGEGLATWVQKNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGF LMPHGFFNCSPAVDVPPS+ + D K+NG+  KP   GL+AKL
Sbjct  729  RIGFTLMPHGFFNCSPAVDVPPSTCELDLKDNGMAAKPIQSGLLAKL  775



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  618  CNPLTARHWIVQNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  677

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  678  SRDEMFPGGEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  737

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  738  RIGFMLMPHGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 152/167 (91%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY
Sbjct  638  CDPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPY  697

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  698  SREEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  757

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+  + TKP   G++AKL
Sbjct  758  RIGFMLMPHGFFNCSPAVDVPPSATDLELKDADIATKPIQNGIIAKL  804



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  590  CNPLTARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  649

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+
Sbjct  650  AHDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVD  709

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  710  RIGFMLMPHGFFNCSPAVDVPPSTTDLELKDNDIATKPIQNVIIAKL  756



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   277 bits (709),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTG LTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  588  CDPLSARHWIVRNTRTVNRTGHLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  647

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  648  ARDEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  707

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKE-NGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPA+DVPP+  D D KE NG+  KP   GL+AKL
Sbjct  708  HIGFMLMPHGFFNCSPAIDVPPNPGDLDDKENNGLPAKPNQNGLIAKL  755



>gb|KJB15626.1| hypothetical protein B456_002G186900 [Gossypium raimondii]
Length=771

 Score =   278 bits (710),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  605  CNPLTARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EM+PGGEFPNQNPRVGEGLA+WVKQNR LEE D+VLWYVFGV H+PRLEDWPVMPV+
Sbjct  665  AHDEMYPGGEFPNQNPRVGEGLATWVKQNRSLEEADVVLWYVFGVIHIPRLEDWPVMPVD  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ D + K+N + TKP    ++AKL
Sbjct  725  RIGFMLMPHGFFNCSPAVDVPPSTTDLELKDNDIATKPVQNVIIAKL  771



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   277 bits (708),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
             CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTP
Sbjct  580  ACNPQTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTP  639

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   EMFPGGEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPV
Sbjct  640  YTHGEMFPGGEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPV  699

Query  380  ERIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            ER+GFMLMPHGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  700  ERLGFMLMPHGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  751



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   277 bits (708),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFL HNLWVTPY
Sbjct  603  CNPQTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPY  662

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               EMFPGGEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  663  THGEMFPGGEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVE  722

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ + D K+N      ++KP   G++AKL
Sbjct  723  RIGFMLMPHGFFNCSPAVDVPPSACELDAKDNDAKDNSVSKPLQNGVLAKL  773



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
             CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTP
Sbjct  600  ACNPQTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTP  659

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   EMFPGGEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPV
Sbjct  660  YTHGEMFPGGEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPV  719

Query  380  ERIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            ER+GFMLMPHGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  720  ERLGFMLMPHGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  771



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  615  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  675  SRDEMFPGGEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  735  RIGFMLMPHGFFNASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
             CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL HNLWVTP
Sbjct  603  ACNPQTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLNHNLWVTP  662

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   EMFPGGEFPNQNPRV EGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPV
Sbjct  663  YTHGEMFPGGEFPNQNPRVDEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPV  722

Query  380  ERIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            ER+GFMLMPHGFFNCSPAVDVPPS+ + D K+N V    +TKP   G++AKL
Sbjct  723  ERLGFMLMPHGFFNCSPAVDVPPSTCELDAKDNDVKDNGVTKPLQNGVLAKL  774



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  618  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  677

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  678  SRDEMFPGGEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  737

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  738  RIGFMLMPHGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFL HNLWVTPY
Sbjct  607  CNPQTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLNHNLWVTPY  666

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               EMFPGGEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  667  THGEMFPGGEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGITHVPRLEDWPVMPVE  726

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ + + K+N      + KP   G++AKL
Sbjct  727  RIGFMLMPHGFFNCSPAVDVPPSACELEAKDNDAKDNSVAKPLQNGVLAKL  777



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 154/171 (90%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  618  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  677

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  678  SRDEMFPGGEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  737

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  738  RIGFMLMPHGFFNASPAVDVPPSACELEAKENDVKDSGVAKPIQNGLLAKL  788



>ref|XP_004301007.1| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 155/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  619  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  678

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EM+PGGEFPNQNPRVGEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  679  SRDEMYPGGEFPNQNPRVGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVE  738

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
             +GF+LMPHGFFNC PAVDVPPS+ + + KE+ V    + KP   GL+AKL
Sbjct  739  HLGFVLMPHGFFNCCPAVDVPPSACESEVKEDDVKDNGVAKPIQNGLMAKL  789



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   276 bits (706),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 154/171 (90%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  615  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPR GEGLA+WVK+NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  675  SRDEMFPGGEFPNQNPRAGEGLATWVKKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFN SPAVDVPPS+ + + KEN V    + KP   GL+AKL
Sbjct  735  RIGFMLMPHGFFNASPAVDVPPSACELEAKENDVKDSGVAKPVQNGLLAKL  785



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  606  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSY  665

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A+NEM+PGGEFPNQNPR GEGLA+WVK++R LEE DIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  666  AQNEMYPGGEFPNQNPRSGEGLATWVKKDRSLEEADIVLWYVFGLTHIPRLEDWPVMPVE  725

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKE-NGVITKPCHPGLVAKL  237
             +GFMLMPHGFFNCSPAVDVPP++ + D KE NGV+ KP   GL+AKL
Sbjct  726  HLGFMLMPHGFFNCSPAVDVPPNTHESDSKETNGVVAKPVQNGLIAKL  773



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  609  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R E+FPGGEFPNQNPRVGEGLA+WV+QNR LEET IVLWY+FG+ HVPRLEDWPVMPVE
Sbjct  669  SREEIFPGGEFPNQNPRVGEGLATWVQQNRSLEETQIVLWYIFGLIHVPRLEDWPVMPVE  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCH  258
             IGFML PHGFFNCSPAVDVPPS +D D KENG + K CH
Sbjct  729  HIGFMLQPHGFFNCSPAVDVPPSMSDSDIKENGTVAKSCH  768



>ref|XP_004309984.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI+++TR VNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  614  CNPLSARHWIVRHTRNVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTSY  673

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EM+PGGEFPNQNPRVGEGLA+WV+Q+R LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  674  ARDEMYPGGEFPNQNPRVGEGLATWVQQDRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  733

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGF LMPHGFFNCS AVDVPP++ + D KEN + TKP    LVAKL
Sbjct  734  HIGFTLMPHGFFNCSTAVDVPPNTCENDLKENEMSTKPIQTALVAKL  780



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   281 bits (718),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  620  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  679

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVE
Sbjct  680  ARDEMFPGGEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVE  739

Query  377  RIGFMLMPHGFFNC  336
            RIGFML PHGFFNC
Sbjct  740  RIGFMLQPHGFFNC  753



>gb|AFK48029.1| unknown [Lotus japonicus]
Length=174

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP++ARHWI++NTR+ NRTGQLTGYKLVPGSNCLPLA +EAKFLRRAAFLKHNLWVT Y
Sbjct  4    CNPMTARHWIVRNTRSGNRTGQLTGYKLVPGSNCLPLARSEAKFLRRAAFLKHNLWVTKY  63

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +E+FPGGEFPNQNPRV EGLA+WVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  64   SHDEVFPGGEFPNQNPRVSEGLATWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  123

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP++   D K+N V     +K     L AKL
Sbjct  124  RIGFMLMPHGFFNCSPAVDVPPNTCVGDSKDNDVKDNGASKTIPGALAAKL  174



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT Y
Sbjct  605  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  665  ARDEMFPGGEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVE  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  725  RIGFMLMPHGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   273 bits (698),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT Y
Sbjct  605  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  665  ARDEMFPGGEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVE  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  725  RIGFMLMPHGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   274 bits (700),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 2/162 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  636  CNPLSARHWIVRNTRNVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  695

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A++EM+PGGEFPNQNPRVGEGLA+WV QNR LEE DIVLWYVFGVTH+PRLEDWPVMP +
Sbjct  696  AKDEMYPGGEFPNQNPRVGEGLATWVNQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPAD  755

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKE--NGVITKPCH  258
            RIGFMLMPHGFFNCSPAVDVPPSS+D + K+  NGV  KP H
Sbjct  756  RIGFMLMPHGFFNCSPAVDVPPSSSDLELKDNGNGVTAKPIH  797



>gb|AES71447.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=548

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 6/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y
Sbjct  378  CNPLTARHWIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAY  437

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE
Sbjct  438  SRDEMFPGGEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVE  497

Query  377  RIGFMLMPHGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDV        S D D K+NG  +KP   G+ +KL
Sbjct  498  HIGFMLMPHGFFNCSPAVDVPPNSCEVESKDSDIKDNGA-SKPIQGGIASKL  548



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   271 bits (692),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y
Sbjct  534  CSPLSARHWIVRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+
Sbjct  594  SRDEMFPGGEFPNQNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVD  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
            RIGF L+PHGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  654  RIGFTLLPHGFFNCSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  704



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 156/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y
Sbjct  621  CSPLSARHWIVRNTRTVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQY  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGL++WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPV+
Sbjct  681  SRDEMFPGGEFPNQNPRVGEGLSTWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVD  740

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
            RIGF L+PHGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  741  RIGFTLLPHGFFNCSPAVDVPPSTCELDSKDTDAKETVVTKPIQTPIIAKL  791



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  627  CNPFTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRY  686

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EMFPGGEFPNQNPR GEGLA+WVKQ+RPLEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  687  APDEMFPGGEFPNQNPRAGEGLATWVKQDRPLEETDIVLWYVFGITHVPRLEDWPVMPVE  746

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKEN----GVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPP++ + D K+N     V+ K    GL+AKL
Sbjct  747  HIGFMLMPHGFFNCSPAVDVPPNACELDTKDNEIKENVVPKSTQNGLLAKL  797



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR+VNRTGQLTGYKL+PGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  621  CNPLTARHWIVRNTRSVNRTGQLTGYKLLPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAY  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R+E +PGGEFPNQNPR+ EGLA+WVKQNRPLEE DIVLWYVFGVTH+PRLEDWPVMPV+
Sbjct  681  KRDEKYPGGEFPNQNPRIDEGLATWVKQNRPLEENDIVLWYVFGVTHIPRLEDWPVMPVD  740

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPSS + D KE GV  KP   GLV+KL
Sbjct  741  RIGFMLMPHGFFNCSPAVDVPPSSTETDLKEIGV-PKPLQNGLVSKL  786



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C PL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT Y
Sbjct  605  CKPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  665  ARDEMFPGGEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVE  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  725  RIGFMLMPHGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  775



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWII+NTR+VNR GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  607  CDPLSARHWIIRNTRSVNRNGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  666

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR E FPGGEFPNQNPRVGEGLASWVKQNR LEE DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  667  ARGEDFPGGEFPNQNPRVGEGLASWVKQNRSLEEADIVLWYVFGITHVPRLEDWPVMPVE  726

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
             IGF+L PHGFFNCSPAVDVPP++ D D KEN V    + K    GL+AKL
Sbjct  727  HIGFVLQPHGFFNCSPAVDVPPNACDMDAKENDVKDNGVAKSISSGLIAKL  777



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 153/169 (91%), Gaps = 4/169 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  613  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  672

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A++EMFPGGEFPNQNPRV EGLA+WV +NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  673  AQDEMFPGGEFPNQNPRVSEGLATWVNKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  732

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVA  243
            RIGFMLMPHGFFNCSPAVDVPPS+ + + K+N V    + K    GL+A
Sbjct  733  RIGFMLMPHGFFNCSPAVDVPPSACELEAKDNDVKDNGVAKSIPNGLLA  781



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C PL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT Y
Sbjct  534  CKPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPR+GEGL +WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  594  ARDEMFPGGEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPPS+ + D K+N V    + KP   GL+AK+
Sbjct  654  RIGFMLMPHGFFNCSPAVDVPPSACELDAKDNDVKDNTVPKPIREGLLAKI  704



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  599  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAY  658

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EMFPGGEFPNQNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  659  APDEMFPGGEFPNQNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVE  718

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV  276
            RIGFMLMPHGFFNCSPAVDVPPS+ D D K+N V
Sbjct  719  RIGFMLMPHGFFNCSPAVDVPPSTCDMDAKDNEV  752



>gb|EPS71193.1| hypothetical protein M569_03564, partial [Genlisea aurea]
Length=202

 Score =   254 bits (648),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNR+GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  43   CDPLSARHWIVRNTRAVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  102

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR E FPGGEFPNQNPR GEGLASWVKQNR LEE DIVLWYVFG+THVPR EDWPVMPVE
Sbjct  103  ARGEDFPGGEFPNQNPRAGEGLASWVKQNRSLEEADIVLWYVFGITHVPRPEDWPVMPVE  162

Query  377  RIGFMLMPHGFFNC  336
             IGF+L PHGFFNC
Sbjct  163  HIGFVLQPHGFFNC  176



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   275 bits (703),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  599  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTAY  658

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EMFPGGEFPNQNPRVGEGL++WVK+NRPLEETD+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  659  APDEMFPGGEFPNQNPRVGEGLSTWVKRNRPLEETDVVLWYVFGITHVPRLEDWPVMPVE  718

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  719  RIGFMLMPHGFFNC  732



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   270 bits (690),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 151/175 (86%), Gaps = 8/175 (5%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PL+ARHW+++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVTPY
Sbjct  615  CDPLTARHWVVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTPY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A NEMFPGGEFPNQNPRVGEGLA+WVKQNRPLEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  675  APNEMFPGGEFPNQNPRVGEGLATWVKQNRPLEESDIVLWYVFGITHVPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNCspavdv-------ppssadpdPKENGVITKPCH-PGLVAKL  237
             IGF LMPHGFFNCSPAVDV          + D D KEN V +KP    GL+AKL
Sbjct  735  HIGFTLMPHGFFNCSPAVDVPPSLSPCELDTKDSDVKENVVASKPIQNGGLLAKL  789



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 148/172 (86%), Gaps = 5/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHW+++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRA FLKHNLWVTPY
Sbjct  616  CDPLSARHWVVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRATFLKHNLWVTPY  675

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              NEMFPGGEFPNQNPRVGEGLA+WVKQNR LEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  676  DPNEMFPGGEFPNQNPRVGEGLATWVKQNRSLEESDIVLWYVFGITHVPRLEDWPVMPVE  735

Query  377  RIGFMLMPHGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDV        + D D K+N + +KP   GL+AKL
Sbjct  736  HIGFTLMPHGFFNCSPAVDVPPNPCEFETKDNDVKDNAISSKPIQSGLLAKL  787



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 6/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y
Sbjct  534  CNPLTARHWIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE
Sbjct  594  SRDEMFPGGEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDV        S D D K+NG  +KP   G+ +KL
Sbjct  654  HIGFMLMPHGFFNCSPAVDVPPNSCEVESKDSDIKDNGA-SKPIQGGIASKL  704



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  
Sbjct  607  CNPLTARHWIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQC  666

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A NEMFPGGEFPNQNPR GEGLA+WVKQ+R LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  667  APNEMFPGGEFPNQNPRAGEGLATWVKQDRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  726

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  727  RIGFMLMPHGFFNCSPAVDVPPNACELDTKDNDIKENVVPKSMQNGLMSKL  777



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 6/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y
Sbjct  504  CNPLTARHWIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAY  563

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE
Sbjct  564  SRDEMFPGGEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVE  623

Query  377  RIGFMLMPHGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDV        S D D K+NG  +KP   G+ +KL
Sbjct  624  HIGFMLMPHGFFNCSPAVDVPPNSCEVESKDSDIKDNGA-SKPIQGGIASKL  674



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y
Sbjct  597  CNPLTARHWIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAY  656

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGLA+W+KQ+R LEET+IVLWYVFG+THVPRLEDWPVMPVE
Sbjct  657  SRDEMFPGGEFPNQNPRVGEGLATWIKQDRSLEETNIVLWYVFGITHVPRLEDWPVMPVE  716

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPSS + + K+N +      KP   GL +KL
Sbjct  717  HIGFMLMPHGFFNCSPAVDVPPSSCEAESKDNDIKDNGAPKPIPSGLASKL  767



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 151/172 (88%), Gaps = 6/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN+WVT Y
Sbjct  599  CNPLTARHWIVRNTRTGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNVWVTAY  658

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGLA+W+KQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE
Sbjct  659  SRDEMFPGGEFPNQNPRVGEGLATWIKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVE  718

Query  377  RIGFMLMPHGFFNCspavdv-----ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDV        S D D K+NG  +KP   G+ +KL
Sbjct  719  HIGFMLMPHGFFNCSPAVDVPPNSCEVESKDSDIKDNGA-SKPIQGGIASKL  769



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 156/171 (91%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTG+KL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y
Sbjct  621  CSPLSARHWIVRNTRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQY  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+
Sbjct  681  SRDEMFPGGEFPNQNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVD  740

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKE----NGVITKPCHPGLVAKL  237
            RIGF L+PHGFFNCSPAVDVPPS+ + D K+      V+TKP    ++AKL
Sbjct  741  RIGFTLLPHGFFNCSPAVDVPPSTCELDSKDADPKENVVTKPIQTPIIAKL  791



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  605  CDPSSARHWIVRNTRTVNRTGQPTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTPY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R+EM+PGGEFPNQNPR  EGLA+WVK+NRPLEETDIVLWY+FGVTH+PRLEDWPVMPVE
Sbjct  665  NRDEMYPGGEFPNQNPRPNEGLATWVKKNRPLEETDIVLWYIFGVTHIPRLEDWPVMPVE  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP  ++ + K+N    K    GL+AKL
Sbjct  725  RIGFMLMPHGFFNCSPAVDVPPGHSEVEVKDNNGTPKLIQNGLLAKL  771



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 149/170 (88%), Gaps = 4/170 (2%)
 Frame = -2

Query  734  NPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYA  555
            +P SARHWII+NTRTVNRTGQLTGYKLVPGSNCLP+AG EAKFLRRAAFLKHNLWVT YA
Sbjct  604  DPFSARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPMAGPEAKFLRRAAFLKHNLWVTQYA  663

Query  554  RNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVER  375
            R E FPGGEFPNQNPRVGEGL SWVKQNR LEETDIVLWYVFG+THVPRLEDWPVMPVER
Sbjct  664  RGEDFPGGEFPNQNPRVGEGLDSWVKQNRSLEETDIVLWYVFGITHVPRLEDWPVMPVER  723

Query  374  IGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            IGF+L PHGFFNCSPAVDVPP + + D K+N V    + KP   GLVAKL
Sbjct  724  IGFLLQPHGFFNCSPAVDVPPGACEMDGKDNDVKESSLAKPIPTGLVAKL  773



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 157/174 (90%), Gaps = 7/174 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTG+KL+PGSNCLPLAG+EAKFLRRA+FLKHNLWVT Y
Sbjct  621  CSPLSARHWIVRNTRTVNRTGQLTGFKLLPGSNCLPLAGSEAKFLRRASFLKHNLWVTQY  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EMFPGGEFPNQNPRVGEGL++WVK++RPLEETDIVLWYVFG+THVPRLEDWPVMPV+
Sbjct  681  SRDEMFPGGEFPNQNPRVGEGLSTWVKKDRPLEETDIVLWYVFGITHVPRLEDWPVMPVD  740

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKEN-------GVITKPCHPGLVAKL  237
            RIGF L+PHGFFNCSPAVDVPPS+ + D K++        V+TKP    ++AKL
Sbjct  741  RIGFTLLPHGFFNCSPAVDVPPSTCELDSKDSKDADPKENVVTKPIQTPIIAKL  794



>gb|KJB19706.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
 gb|KJB19707.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=791

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  
Sbjct  621  CNPLTARHWIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQC  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A NEMFPGGEFPNQNPR GEGLA+WVK++R LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  681  APNEMFPGGEFPNQNPRAGEGLATWVKRDRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  740

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  741  RIGFMLMPHGFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  791



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN L+ARHW+++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y
Sbjct  554  CNSLTARHWVVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTY  613

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+E+FPGGEFPNQNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVE
Sbjct  614  SRDELFPGGEFPNQNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVE  673

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFML PHGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  674  RIGFMLTPHGFFNCSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  724



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   267 bits (682),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 152/171 (89%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN L+ARHW+++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y
Sbjct  604  CNSLTARHWVVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTY  663

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+E+FPGGEFPNQNPRVGEGLA+WVKQNR LEET++VLWY+FG+THVPRLEDWPVMPVE
Sbjct  664  SRDELFPGGEFPNQNPRVGEGLATWVKQNRSLEETNVVLWYIFGITHVPRLEDWPVMPVE  723

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
            RIGFML PHGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  724  RIGFMLTPHGFFNCSPAVDVPPNACEMDSKDNDIKDNGSSKPIQSGLTAKL  774



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG++AKFLRRAAFLKHNLWVT Y
Sbjct  577  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWVTEY  636

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +EMFPGGEFPNQNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  637  ACDEMFPGGEFPNQNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVMPVE  696

Query  377  RIGFMLMPHGFFNC  336
             IGFMLMPHGFFNC
Sbjct  697  HIGFMLMPHGFFNC  710



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 148/172 (86%), Gaps = 5/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWII+NTRTVNR+GQLTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  615  CDPLSARHWIIRNTRTVNRSGQLTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR E FPGGEFPNQNPR GEGL SWVKQNRPLEE DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  675  ARGEDFPGGEFPNQNPRAGEGLVSWVKQNRPLEENDIVLWYVFGITHVPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKP-CHPGLVAKL  237
             IGF+L PHGFFNCSPAVDVPP+  + D KE+ V    + KP     L+AKL
Sbjct  735  HIGFVLQPHGFFNCSPAVDVPPNVCEIDAKESDVKDSSVAKPTSSAALIAKL  786



>ref|XP_004289862.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN LSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  578  CNALSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQY  637

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +EMFPGGEFPNQNPRVGEGLA+WV++NR LEETDIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  638  SPDEMFPGGEFPNQNPRVGEGLATWVQKNRSLEETDIVLWYVFGITHVPRLEDWPVMPVE  697

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGF L+PHGFFNCSPAVDVPPS+ +   KE+ V       GL+AKL
Sbjct  698  HIGFKLVPHGFFNCSPAVDVPPSACESKAKEDDVKDN----GLMAKL  740



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY
Sbjct  539  CNPLAARHWIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPY  598

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + ++MFPGGEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVE
Sbjct  599  SHDQMFPGGEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVE  658

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  659  RIGFMLMPHGFFNC  672



>ref|XP_006411505.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
 gb|ESQ52958.1| hypothetical protein EUTSA_v100163161mg, partial [Eutrema salsugineum]
Length=329

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  158  CDPLAARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  217

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  218  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  277

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  278  HIGFTLMPHGFFNC  291



>gb|ACN27241.1| unknown [Zea mays]
Length=246

 Score =   248 bits (633),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  81   CDPSSARHWIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  140

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R EMFPGGEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  141  KRGEMFPGGEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  200

Query  377  RIGFMLMPHGFFNC  336
             IGFMLMPHGFFNC
Sbjct  201  HIGFMLMPHGFFNC  214



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 149/171 (87%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN L+ARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHN WVT Y
Sbjct  600  CNSLTARHWIVRNTRTCNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNFWVTTY  659

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +RNEMFPGGEFPNQNPR  EGLA+WVKQNR LEET+IVLWYVFG+THVPRLEDWPVMPVE
Sbjct  660  SRNEMFPGGEFPNQNPRDREGLATWVKQNRSLEETNIVLWYVFGITHVPRLEDWPVMPVE  719

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV----ITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDVPP++ + D K+N +     +KP   GL AKL
Sbjct  720  HIGFMLTPHGFFNCSPAVDVPPNACEMDSKDNEIKDNGSSKPIQNGLTAKL  770



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWII+NTRTVNR+G+LTGYKLVPGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  608  CDPLSARHWIIRNTRTVNRSGELTGYKLVPGSNCLPLAGPEAKFLRRAAFLKHNLWVTQY  667

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGL SWVKQNRPLEETD+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  668  APGEDFPGGEFPNQNPRVGEGLVSWVKQNRPLEETDVVLWYVFGITHVPRLEDWPVMPVE  727

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGV  276
             IGF+L PHGFFNCSPAVDVPPS+ + + KEN V
Sbjct  728  HIGFVLQPHGFFNCSPAVDVPPSACELEAKENDV  761



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   261 bits (668),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY
Sbjct  579  CNPLAARHWIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPY  638

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + ++MFPGGEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVE
Sbjct  639  SHDQMFPGGEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVE  698

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  699  RIGFMLMPHGFFNC  712



>gb|KJB19705.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=795

 Score =   262 bits (669),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 8/175 (5%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  
Sbjct  621  CNPLTARHWIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQC  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVL----WYVFGVTHVPRLEDWPV  390
            A NEMFPGGEFPNQNPR GEGLA+WVK++R LEETDIVL    WYVFG+THVPRLEDWPV
Sbjct  681  APNEMFPGGEFPNQNPRAGEGLATWVKRDRSLEETDIVLWLLNWYVFGITHVPRLEDWPV  740

Query  389  MPVERIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
            MPVERIGFMLMPHGFFNCSPAVDVPP++ + D K+N     V+ K    GL++KL
Sbjct  741  MPVERIGFMLMPHGFFNCSPAVDVPPNACELDTKDNDIKENVVAKSIQNGLMSKL  795



>dbj|BAD95322.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=502

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  332  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  391

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  392  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  451

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  452  HIGFTLMPHGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  502



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGYKLVPG+NCLPLAG+EAKFLRRAAFL+HNLWVT Y
Sbjct  624  CNPLSARHWIVRNTRTVNRTGQLTGYKLVPGANCLPLAGSEAKFLRRAAFLQHNLWVTQY  683

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             ++E +PGGEFPNQNPRVGEGL +WVKQNR LEE D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  684  HKDEQYPGGEFPNQNPRVGEGLHTWVKQNRNLEEADVVLWYVFGITHVPRLEDWPVMPVE  743

Query  377  RIGFMLMPHGFFNC  336
            RIGFML PHGFFNC
Sbjct  744  RIGFMLSPHGFFNC  757



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 144/173 (83%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRT NRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  603  CDPLSARHWIVRNTRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQY  662

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  663  APGEDFPGGEFPNQNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVE  722

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDV         S D D  ENG  +KP   GL AKL
Sbjct  723  HIGFMLQPHGFFNCSPAVDVPPPRGCDSESKDSDASENGE-SKPTTTGLTAKL  774



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 148/171 (87%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  605  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  665  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPP+  + + K++     V  KP   GL++KL
Sbjct  725  HIGFTLMPHGFFNCSPAVDVPPNPCELETKDSEVKEVVAPKPLQTGLLSKL  775



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  589  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  648

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  649  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  708

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  709  HIGFTLMPHGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  759



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 144/173 (83%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRT NRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT +
Sbjct  598  CDPLSARHWIVRNTRTSNRTGQLTGYKLVPGQNCLPLAGPEAKFLRRAAFLKHNLWVTQF  657

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVK++R LEE+DIVLWYVFG+THVPRLEDWPVMPVE
Sbjct  658  APGEDFPGGEFPNQNPRVGEGLASWVKEDRSLEESDIVLWYVFGITHVPRLEDWPVMPVE  717

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPA+DV         S D D  ENG  +KP   GL AKL
Sbjct  718  HIGFMLQPHGFFNCSPAIDVPPPRGCDLESKDSDASENGE-SKPTTTGLTAKL  769



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  615  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE
Sbjct  675  APGEEFPGGEFPNQNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNC  336
             IGF+L PHGFFNC
Sbjct  735  HIGFVLQPHGFFNC  748



>ref|NP_001169559.1| uncharacterized protein LOC100383438 [Zea mays]
 gb|ACN34121.1| unknown [Zea mays]
Length=352

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  187  CDPSSARHWIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  246

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R EMFPGGEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  247  KRGEMFPGGEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  306

Query  377  RIGFMLMPHGFFNC  336
             IGFMLMPHGFFNC
Sbjct  307  HIGFMLMPHGFFNC  320



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 128/133 (96%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  593  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  652

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            AR+EMFPGGEFPNQNPRVGEGLA+WVKQNRPLEETDIVLWYVFG+ HVPRLEDWPVMPVE
Sbjct  653  ARDEMFPGGEFPNQNPRVGEGLATWVKQNRPLEETDIVLWYVFGLVHVPRLEDWPVMPVE  712

Query  377  RIGFML-MPHGFF  342
            RIGFML + H  F
Sbjct  713  RIGFMLQILHNLF  725



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 142/173 (82%), Gaps = 6/173 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  614  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQY  673

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE
Sbjct  674  APGEDFPGGEFPNQNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVE  733

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDV         S D +  +N  + K    GL+AKL
Sbjct  734  HIGFMLQPHGFFNCSPAVDVPPPSGCDSESRDSEVTDNSSVAKHTTTGLMAKL  786



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   257 bits (656),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  606  CDPLSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  665

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  666  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  725

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPP+  + + KE+     V  K    GL++KL
Sbjct  726  HIGFTLMPHGFFNCSPAVDVPPNPCELETKESEVKEVVAPKALQTGLLSKL  776



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   256 bits (655),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  619  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFLRRAAFLKHNLWVTQY  678

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+RPLEE+DIVLWY+FG+THVPRLEDWPVMPVE
Sbjct  679  APGEDFPGGEFPNQNPRVGEGLASWVKQDRPLEESDIVLWYIFGITHVPRLEDWPVMPVE  738

Query  377  RIGFMLMPHGFFNC  336
             IGF+L PHG+FNC
Sbjct  739  HIGFVLQPHGYFNC  752



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKL+PG NCLPLAG EAKFLRRAAFLKHNLWVTPY
Sbjct  611  CDPFSARHWIVRNTRTVNRTGQPTGYKLMPGLNCLPLAGPEAKFLRRAAFLKHNLWVTPY  670

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R+EM+PGGEFPNQNPR+ EGL +WVK+NR LEE DIVLWYVFG+TH+PRLEDWPVMPV+
Sbjct  671  SRDEMYPGGEFPNQNPRINEGLVTWVKKNRSLEEADIVLWYVFGITHIPRLEDWPVMPVD  730

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  731  RIGFMLMPHGFFNC  744



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 142/173 (82%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+ LSARHWI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  531  CDTLSARHWIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQY  590

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  591  APGEDFPGGEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  650

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  651  HIGFMLQPHGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  702



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  611  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  670

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  671  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  730

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  731  HIGFTLMPHGFFNCSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  781



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPG NCLPLAG EAKF+RRAAFLKHNLWVT Y
Sbjct  616  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGPNCLPLAGPEAKFMRRAAFLKHNLWVTQY  675

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPR GEGLASWVKQ+RPLEE+D VLWY+FG+THVPRLEDWPVMPVE
Sbjct  676  APGEDFPGGEFPNQNPRAGEGLASWVKQDRPLEESDTVLWYIFGITHVPRLEDWPVMPVE  735

Query  377  RIGFMLMPHGFFNC  336
             IGFML PHGFFNC
Sbjct  736  HIGFMLQPHGFFNC  749



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   254 bits (649),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C PLSARHWI++NTRTVNRTGQ  GYKL+PGSNCLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  607  CQPLSARHWIVRNTRTVNRTGQPAGYKLMPGSNCLPLAGPEAKFLRRAAFLKHNLWVTSY  666

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EM+PGGEFPNQNPR+ EGLA+WV++NR LEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  667  KHDEMYPGGEFPNQNPRINEGLATWVRKNRSLEETDIVLWYVFGITHIPRLEDWPVMPVE  726

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGF+LMPHGFFNC       P S +   KE G   K  H GLVAKL
Sbjct  727  HIGFLLMPHGFFNC-SPAVDVPPSPNEADKECGA-PKLMHNGLVAKL  771



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   254 bits (649),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  609  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  669  SPDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  728

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPA+DVPP+  + D K++     V  KP   GL++KL
Sbjct  729  HIGFTLMPHGFFNCSPAIDVPPNPCELDTKDSEVKEVVAPKPLQTGLLSKL  779



>ref|NP_001053078.1| Os04g0476100 [Oryza sativa Japonica Group]
 dbj|BAF14992.1| Os04g0476100, partial [Oryza sativa Japonica Group]
Length=518

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  353  CDPSSARHWIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  412

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  413  KSDEVFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  472

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  473  RIGFMLMPHGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  518



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  586  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  645

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  646  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  705

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG-----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPP+ A     ++      V  KP   GL++KL
Sbjct  706  HIGFTLMPHGFFNCSPAVDVPPNPACELDTKDSEVKEVVAPKPLQSGLLSKL  757



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 145/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  601  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  660

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPR GEGL++WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  661  APEEKFPGGEFPNQNPRAGEGLSTWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  720

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPAVDVPP+  + D K++     V  KP   GL++KL
Sbjct  721  HIGFTLMPHGFFNCSPAVDVPPNPCELDTKDSEVKEVVAPKPIQTGLLSKL  771



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  611  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  670

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  671  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  730

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  731  HIGFTLMPHGFFNC  744



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  617  CDPSSARHWIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  676

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R+EMFPGGEFPNQNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  677  KRDEMFPGGEFPNQNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  736

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
             IGFMLMPHGFFNCSPAVDVPPSS+D D KE     K    GLV+KL
Sbjct  737  HIGFMLMPHGFFNCSPAVDVPPSSSDADVKE-AESPKAIQNGLVSKL  782



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 142/173 (82%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+ LSARHWI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  595  CDTLSARHWIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQY  654

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  655  APGEDFPGGEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  714

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  715  HIGFMLQPHGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 142/173 (82%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+ LSARHWI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  595  CDTLSARHWIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQY  654

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  655  APGEDFPGGEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  714

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  715  HIGFMLQPHGFFNCSPAVDVPPPRGCDLEIKDSDGSENGV-AKPTPSSLMAKL  766



>dbj|BAJ87935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=527

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TG++LVPGSNCLP A  EAKFLRRA FLKHNLWVTPY
Sbjct  360  CDPSSARHWIVRNTRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPY  419

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FPGGEFPNQNPR+ EGLA+WVKQ+RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  420  KSDEKFPGGEFPNQNPRLHEGLATWVKQDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  479

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  480  RIGFMLMPHGFFNC  493



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 144/172 (84%), Gaps = 5/172 (3%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  596  CDPFTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  655

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  656  APDEKFPGGEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  715

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENG-----VITKPCHPGLVAKL  237
             IGF LMPHGFFNCSPA+DVPP+ A     ++      V  KP   GL++KL
Sbjct  716  HIGFTLMPHGFFNCSPAIDVPPNPACELETKDSEVKEVVTPKPIQAGLLSKL  767



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 142/173 (82%), Gaps = 7/173 (4%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+ LSARHWI++NTRT NRTGQLTGYKLVPG NCLPLAG +AKFLRRAAFLKHNLWVT Y
Sbjct  603  CDTLSARHWIVRNTRTSNRTGQLTGYKLVPGPNCLPLAGPKAKFLRRAAFLKHNLWVTKY  662

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  663  APGEDFPGGEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  722

Query  377  RIGFMLMPHGFFNCspavdv------ppssadpdPKENGVITKPCHPGLVAKL  237
             IGFML PHGFFNCSPAVDV           D D  ENGV  KP    L+AKL
Sbjct  723  HIGFMLQPHGFFNCSPAVDVPPPRGCDMEIKDSDGSENGV-AKPTPSNLMAKL  774



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   252 bits (643),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVTPY
Sbjct  605  CDPSSARHWIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTPY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  665  NSDEKFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  724

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMP GFFNCSPAVDVPP S+D D KE        + GLV+KL
Sbjct  725  RIGFMLMPDGFFNCSPAVDVPPGSSDVDAKEAESPKAIQNGGLVSKL  771



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  534  CDPSSARHWIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  594  KSDEVFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  654  RIGFMLMPHGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTRTVNRTGQLTGY+LVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  571  CNPLSARHWIVRNTRTVNRTGQLTGYRLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  630

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              NEM PGGEFPNQNPRVG+GLA+WVKQNR LEE DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  631  VHNEMHPGGEFPNQNPRVGDGLATWVKQNRSLEEADIVLWYVFGVTHIPRLEDWPVMPVE  690

Query  377  RIGFMLM  357
            RIGFMLM
Sbjct  691  RIGFMLM  697



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN LSARHWI++NTRT NRTGQLTGYKLVPGSNCLPLAG +AKFLRRAAFLKHNLWVT Y
Sbjct  537  CNALSARHWIVRNTRTFNRTGQLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQY  596

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FPGGEFPNQNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  597  NPDECFPGGEFPNQNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVE  656

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  657  HIGFSLMPHGFFNC  670



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP SARHWI++NTRT NRTG LTGYKLVPGSNCLPLAG +AKFLRRAAFLKHNLWVT Y
Sbjct  497  CNPFSARHWIVRNTRTFNRTGHLTGYKLVPGSNCLPLAGPDAKFLRRAAFLKHNLWVTQY  556

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPRVGEGL +WVKQ+R LEETDIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  557  YPDEIFPGGEFPNQNPRVGEGLPTWVKQDRKLEETDIVLWYVFGVTHIPRLEDWPVMPVE  616

Query  377  RIGFMLMPHGFFNC  336
             IGF L+PHGFFNC
Sbjct  617  HIGFSLVPHGFFNC  630



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   249 bits (637),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  534  CDPSSARHWIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  594  KSDEVFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  654  RIGFMLMPHGFFNCSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  699



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   253 bits (647),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  586  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  645

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  646  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  705

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  706  HIGFTLMPHGFFNC  719



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TGY+LVPGSNCLPLA  +AKFLRRA FLKHNLWVT Y
Sbjct  534  CDPSSARHWIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPDAKFLRRAGFLKHNLWVTQY  593

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  594  RSDEVFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  653

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  654  RIGFMLMPHGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  699



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP SARHWI++NTRTVNRTGQ  GYKL+PG NCLPLAG EAKF RRAAFLKHNLWVT Y
Sbjct  603  CNPSSARHWIVRNTRTVNRTGQPAGYKLMPGPNCLPLAGPEAKFFRRAAFLKHNLWVTSY  662

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EM+PGGEFPNQNPR+ EGLA+WVK+NR LEET+IVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  663  KHDEMYPGGEFPNQNPRINEGLATWVKKNRSLEETNIVLWYVFGVTHIPRLEDWPVMPVE  722

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  723  RIGFMLMPHGFFNC  736



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  673  CDPSSARHWIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  732

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  733  KSDEVFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  792

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  793  RIGFMLMPHGFFNCSPAVDVPPGSSDADIKE-AESPKAIQNGLISKL  838



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  622  CDPSSARHWIVRNTRAVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  681

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  682  KSDEVFPGGEFPNQNPRIHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  741

Query  377  RIGFMLMPHGFFNCspavdvppssadpdPKENGVITKPCHPGLVAKL  237
            RIGFMLMPHGFFNCSPAVDVPP S+D D KE     K    GL++KL
Sbjct  742  RIGFMLMPHGFFNCSPAVDVPPGSSDADIKE-AESPKVIQNGLISKL  787



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  615  CDPSSARHWIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R EMFPGGEFPNQNPR+ EGL +WVK +RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  675  KRGEMFPGGEFPNQNPRIHEGLPTWVKNDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNC  336
             IGFMLMPHGFFNC
Sbjct  735  HIGFMLMPHGFFNC  748



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  609  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  669  DPEEKFPGGEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  728

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  729  HIGFTLMPHGFFNC  742



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  606  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  665

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  666  DPEEKFPGGEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  725

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  726  HIGFTLMPHGFFNC  739



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  606  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  665

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLWYVFG+ HVPRLEDWPVMPVE
Sbjct  666  DPEEKFPGGEFPNQNPRSGEGLATWVKQNRSLEESDVVLWYVFGIIHVPRLEDWPVMPVE  725

Query  377  RIGFMLMPHGFFNC  336
             IGF LMPHGFFNC
Sbjct  726  HIGFTLMPHGFFNC  739



>gb|KJB50255.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=757

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY
Sbjct  623  CDPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPY  682

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  683  SREEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  742

Query  377  RIGFMLM  357
            RIGFMLM
Sbjct  743  RIGFMLM  749



>gb|KJB50256.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=751

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY
Sbjct  623  CDPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPY  682

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  683  SREEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  742

Query  377  RIGFMLM  357
            RIGFMLM
Sbjct  743  RIGFMLM  749



>gb|KJB50257.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=775

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRA FLKHNLWVTPY
Sbjct  623  CDPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRATFLKHNLWVTPY  682

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +R EM PGGEFPNQNPRVGEGLA+WVKQNR LEE DIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  683  SREEMHPGGEFPNQNPRVGEGLATWVKQNRSLEEADIVLWYVFGVTHVPRLEDWPVMPVE  742

Query  377  RIGFMLM  357
            RIGFMLM
Sbjct  743  RIGFMLM  749



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTR VNRTGQ TG++LVPGSNCLP A  EAKFLRRA FLKHNLWVTPY
Sbjct  568  CDPSSARHWIVRNTRAVNRTGQPTGFRLVPGSNCLPFALPEAKFLRRAGFLKHNLWVTPY  627

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FPGGEFPNQNPR+ EGLA+WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  628  KSDEKFPGGEFPNQNPRLHEGLATWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  687

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  688  RIGFMLMPHGFFNC  701



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGY+LVPGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  615  CDPSSARHWIVRNTRTVNRTGQPTGYRLVPGSNCLPLALPEAKFLRRAGFLKHNLWVTQY  674

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EMFPGGEFPNQNPR+ EGL +WVK++RPLEETDIVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  675  KSDEMFPGGEFPNQNPRIHEGLPTWVKKDRPLEETDIVLWYVFGLTHIPRLEDWPVMPVE  734

Query  377  RIGFMLMPHGFFNC  336
             IGFMLMPHGFFNC
Sbjct  735  HIGFMLMPHGFFNC  748



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   252 bits (644),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR  NR+G+LTGYKLVPGSNCLPLAG+EA FLRRA FL+HNLW+TPY
Sbjct  563  CNPLTARHWIVRNTRRGNRSGELTGYKLVPGSNCLPLAGSEAMFLRRAGFLRHNLWITPY  622

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + ++MFPGGEFPNQNPR+ +GL +WVKQNR LEET IVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  623  SHHQMFPGGEFPNQNPRLNQGLPTWVKQNRSLEETAIVLWYVFGMTHIPRLEDWPVMPVE  682

Query  377  RIGFMLMPHGFFNC  336
            RIGFMLMPHGFFNC
Sbjct  683  RIGFMLMPHGFFNC  696



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   250 bits (639),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 124/136 (91%), Gaps = 2/136 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLA  EAKFLRRAAFLKHNLWVT Y
Sbjct  586  CDPFSARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLARPEAKFLRRAAFLKHNLWVTRY  645

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLW--YVFGVTHVPRLEDWPVMP  384
            A +E FPGGEFPNQNPR GEGLA+WVKQNR LEE+D+VLW  YVFG+THVPRLEDWPVMP
Sbjct  646  APDEKFPGGEFPNQNPRAGEGLATWVKQNRSLEESDVVLWYVYVFGITHVPRLEDWPVMP  705

Query  383  VERIGFMLMPHGFFNC  336
            VE IGF LMPHGFFNC
Sbjct  706  VEHIGFTLMPHGFFNC  721



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 125/137 (91%), Gaps = 1/137 (1%)
 Frame = -2

Query  746  CVTCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWV  567
             V CNP  A + + +NTRTVNRTGQLTGYKLVPGSNCLPLAG++AKFLRRAAFLKHNLWV
Sbjct  528  AVDCNPGEALNQV-RNTRTVNRTGQLTGYKLVPGSNCLPLAGSDAKFLRRAAFLKHNLWV  586

Query  566  TPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVM  387
            T YA +EMFPGGEFPNQNPR GEGLA+WVK+NRPL E+D+VLWYVFG+THVPRLEDWPVM
Sbjct  587  TEYACDEMFPGGEFPNQNPRAGEGLATWVKKNRPLYESDVVLWYVFGLTHVPRLEDWPVM  646

Query  386  PVERIGFMLMPHGFFNC  336
            PVE IGFMLMPHGFFNC
Sbjct  647  PVEHIGFMLMPHGFFNC  663



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTR  NRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFL+HNLWVTPY
Sbjct  579  CNPLAARHWIVRNTRIGNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLRHNLWVTPY  638

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + ++MFPGGEFPNQNPRV +GLA+WVKQNR LEETDIVLWYVFG+T VPRLEDWPVMPVE
Sbjct  639  SHDQMFPGGEFPNQNPRVSQGLATWVKQNRSLEETDIVLWYVFGITQVPRLEDWPVMPVE  698

Query  377  RIGFMLM  357
            RIGFMLM
Sbjct  699  RIGFMLM  705



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN L+ RHWI++NTRT NRTGQLTGYKL+PG NCLPLAG +AKFLRRAAFL HNLWVT Y
Sbjct  542  CNALTHRHWIVRNTRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEY  601

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
             R+E FPGGEFPNQNPRVGEGL +WVKQ+R LEETD+VLWYVFGVTHVPRLEDWPVMPVE
Sbjct  602  KRDECFPGGEFPNQNPRVGEGLPTWVKQDRKLEETDVVLWYVFGVTHVPRLEDWPVMPVE  661

Query  377  RIGFMLMPHGFFNC  336
             +GF L+PHGFFNC
Sbjct  662  HVGFKLLPHGFFNC  675



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN LS RHWI++NTRT NRTGQLTGYKL+PG NCLPLAG +AKFLRRAAFL HNLWVT Y
Sbjct  542  CNALSHRHWIVRNTRTFNRTGQLTGYKLMPGRNCLPLAGPDAKFLRRAAFLNHNLWVTEY  601

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FPGGEFPNQNPR+GEGL +WVKQ+R LEETDIVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  602  KHDECFPGGEFPNQNPRIGEGLPTWVKQDRKLEETDIVLWYVFGVTHVPRLEDWPVMPVE  661

Query  377  RIGFMLMPHGFFNC  336
             +GF L+PHGFFNC
Sbjct  662  HVGFNLLPHGFFNC  675



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   242 bits (617),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKL+PGSNCLP    EAKFLRRA FLKHNLWVT Y
Sbjct  644  CDPSSARHWIVRNTRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSY  703

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  704  KSDEIFPGGEFPNQNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVE  763

Query  377  RIGFMLMPHGFFNC  336
            R GFMLMPHGFFNC
Sbjct  764  RSGFMLMPHGFFNC  777



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKL+PGSNCLP    EAKFLRRA FLKHNLWVT Y
Sbjct  596  CDPSSARHWIVRNTRTVNRTGQPTGYKLIPGSNCLPFCLPEAKFLRRAGFLKHNLWVTSY  655

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E+FPGGEFPNQNPR+ EGLA+WVK++R LEET+IVLWYVFG+TH+PRLEDWPVMPVE
Sbjct  656  KSDEIFPGGEFPNQNPRIHEGLATWVKKDRSLEETNIVLWYVFGITHIPRLEDWPVMPVE  715

Query  377  RIGFMLMPHGFFNC  336
            R GF++MPHGFFNC
Sbjct  716  RSGFIIMPHGFFNC  729



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SAR+WI++NTRTVNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  638  CHPSSARYWIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSY  697

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EM+PGGEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  698  KNDEMYPGGEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVE  757

Query  377  RIGFMLMPHGFFNC  336
             IGFML P GFF+C
Sbjct  758  HIGFMLKPDGFFDC  771



>ref|NP_001173054.1| Os02g0593150 [Oryza sativa Japonica Group]
 dbj|BAH91783.1| Os02g0593150 [Oryza sativa Japonica Group]
Length=311

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNLWVT +
Sbjct  18   CDPSSARHWIVRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNLWVTSF  77

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EMFPGGEFPNQNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWPVMPVE
Sbjct  78   KNDEMFPGGEFPNQNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWPVMPVE  137

Query  377  RIGFMLM  357
            RI FMLM
Sbjct  138  RISFMLM  144



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+ LSARHWI++NTRT NRTGQLTGYKLVPG +CLPLAG EAKFLRRAAFLKHNLWVT Y
Sbjct  595  CDTLSARHWIVRNTRTSNRTGQLTGYKLVPGPSCLPLAGPEAKFLRRAAFLKHNLWVTQY  654

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FPGGEFPNQNPRVGEGLASWVKQ+R LEE+D+VLWYVFG+THVPRLEDWPVMPVE
Sbjct  655  APGEDFPGGEFPNQNPRVGEGLASWVKQDRSLEESDVVLWYVFGITHVPRLEDWPVMPVE  714

Query  377  RIGFMLM  357
             IGFML 
Sbjct  715  HIGFMLQ  721



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SARHWI++NTRTVNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  548  CHPSSARHWIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSY  607

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EM+PGGEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  608  KNDEMYPGGEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVE  667

Query  377  RIGFML  360
             IGFML
Sbjct  668  HIGFML  673



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P SAR+WI++NTRTVNRTGQ TGYKL+PGSNCLPLA  EAKFLRRA FLKHNLWVT Y
Sbjct  638  CHPSSARYWIVRNTRTVNRTGQPTGYKLIPGSNCLPLALPEAKFLRRAGFLKHNLWVTSY  697

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EM+PGGEFPNQNPR+ EGLA+WVKQ+R LEET+IVLWYVFGVTHVPRLEDWPVMPVE
Sbjct  698  KNDEMYPGGEFPNQNPRINEGLATWVKQDRSLEETNIVLWYVFGVTHVPRLEDWPVMPVE  757

Query  377  RIGFML  360
             IGFML
Sbjct  758  HIGFML  763



>ref|XP_002985875.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
 gb|EFJ13052.1| hypothetical protein SELMODRAFT_123165 [Selaginella moellendorffii]
Length=710

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NT+ VNR G  TGYKLVPG+NCL   G +A  LRRA FLKHNLWVT Y
Sbjct  564  CNPLSARHWIVRNTKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSY  623

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +++E++P GEFP QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  624  SKDELYPAGEFPKQNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVE  683

Query  377  RIGFMLMPHGFFNC  336
            RIGF L PHGFF+C
Sbjct  684  RIGFTLTPHGFFDC  697



>ref|XP_002984811.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
 gb|EFJ14061.1| hypothetical protein SELMODRAFT_121227 [Selaginella moellendorffii]
Length=710

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NT+ VNR G  TGYKLVPG+NCL   G +A  LRRA FLKHNLWVT Y
Sbjct  564  CNPLSARHWIVRNTKVVNRAGGNTGYKLVPGANCLGFIGKDAMILRRAEFLKHNLWVTSY  623

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            +++E++P GEFP QNPR+GEGL +WVK++R LE  DIVLWYVFGVTH+PRLEDWPVMPVE
Sbjct  624  SKDELYPAGEFPKQNPRIGEGLPTWVKKDRDLENADIVLWYVFGVTHIPRLEDWPVMPVE  683

Query  377  RIGFMLMPHGFFNC  336
            RIGF L PHGFF+C
Sbjct  684  RIGFTLTPHGFFDC  697



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR+ NR GQLTGYKLVPGSNCLPL G  A  LRRA FL HNLWVT Y
Sbjct  498  CNPLSARHWIVRNTRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSY  557

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +E +PGG+FPNQNPRVGEGL +W K+++ LE+ DIVLWY FGV HVPRLEDWPVMPVE
Sbjct  558  SPDERYPGGDFPNQNPRVGEGLPTWTKRDKNLEQADIVLWYTFGVIHVPRLEDWPVMPVE  617

Query  377  RIGFMLMPHGFFNC  336
             +GF L P GFFNC
Sbjct  618  HLGFSLAPVGFFNC  631



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+PLS RHWI++NTRTVNRT +LTGYKL+PGSNC P+A  EAKFLRRA FLKHNLWVTPY
Sbjct  506  CDPLSKRHWIVRNTRTVNRTRKLTGYKLMPGSNCKPMALPEAKFLRRAGFLKHNLWVTPY  565

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +EMFPGG+FPNQNP + EGL +WVK++R LEETDIVLWYVFG+TH+PRLEDWPVMPV+
Sbjct  566  KSDEMFPGGDFPNQNPHIDEGLPTWVKKDRSLEETDIVLWYVFGLTHIPRLEDWPVMPVD  625

Query  377  RIGFMLMP  354
            R+   ++P
Sbjct  626  RMDSSIVP  633



>gb|EEE57286.1| hypothetical protein OsJ_07344 [Oryza sativa Japonica Group]
Length=681

 Score =   209 bits (532),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 2/132 (2%)
 Frame = -2

Query  746  CVTCNPLSARHWII--KNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNL  573
             V C P  A + ++  +NTRTVNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNL
Sbjct  383  AVDCKPNEAYNQVVEVRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNL  442

Query  572  WVTPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWP  393
            WVT +  +EMFPGGEFPNQNPR+ EGLA+WVK++R LEET++VLWYVFG+TH+PRLEDWP
Sbjct  443  WVTSFKNDEMFPGGEFPNQNPRINEGLATWVKKDRSLEETNLVLWYVFGITHIPRLEDWP  502

Query  392  VMPVERIGFMLM  357
            VMPVERI FMLM
Sbjct  503  VMPVERISFMLM  514



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score =   208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 111/153 (73%), Gaps = 19/153 (12%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CN LSARHWI++NTR+ NR GQLTGYKLVPGSNCLPL G  A  LRRA FL HNLWVT Y
Sbjct  608  CNSLSARHWIVRNTRSFNRMGQLTGYKLVPGSNCLPLVGENAMMLRRAKFLHHNLWVTSY  667

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLW-------------------Y  435
            + +E +PGG+FPNQNPRVGEGL +W K+++ LE+ DIVLW                   Y
Sbjct  668  SPDERYPGGDFPNQNPRVGEGLPTWTKRDKNLEQADIVLWSVAHFGLIRSFMVFSWISRY  727

Query  434  VFGVTHVPRLEDWPVMPVERIGFMLMPHGFFNC  336
             FGV HVPRLEDWPVMPVE +GF L P GFFNC
Sbjct  728  TFGVIHVPRLEDWPVMPVEHLGFSLAPVGFFNC  760



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  613  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  672

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  432
            A++EMFPGGEFPNQNPRVGEGLA+WVK+NR LEETDIVLW V
Sbjct  673  AQDEMFPGGEFPNQNPRVGEGLATWVKKNRSLEETDIVLWSV  714



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWII+NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAK LRRAAFLKHNLWVTPY
Sbjct  609  CNPLTARHWIIRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKVLRRAAFLKHNLWVTPY  668

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  432
            A +EM+PGGEFPNQNPRVGEGLA+WV+QNR LEETDIVLW V
Sbjct  669  AHDEMYPGGEFPNQNPRVGEGLATWVEQNRSLEETDIVLWLV  710



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPLSARHWI++NTR VNRTGQLTG+KLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVTPY
Sbjct  620  CNPLSARHWIVRNTRNVNRTGQLTGFKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTPY  679

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  405
            AR EM+PGGEFPNQNPRVGEGLA+WVK+NR LEE DIVL +   +T   RL
Sbjct  680  AREEMYPGGEFPNQNPRVGEGLATWVKKNRSLEEADIVLCHTVSLTAHQRL  730



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG +A   RRAAFLKHNLWVT Y
Sbjct  605  CNPLTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGPDATVFRRAAFLKHNLWVTAY  664

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  432
            AR+EMFPGGEFPNQNPR+GEGL +WVKQNRPLEE+DIVLW+V
Sbjct  665  ARDEMFPGGEFPNQNPRIGEGLPAWVKQNRPLEESDIVLWFV  706



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNP +ARHWI++NTRTVNRTGQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT Y
Sbjct  627  CNPFTARHWIVRNTRTVNRTGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTRY  686

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRL  405
            A +EMFPGGEFPNQNPR GEGLA+WVKQ+RPLEETDIV ++ +    + RL
Sbjct  687  APDEMFPGGEFPNQNPRAGEGLATWVKQDRPLEETDIVCFWNYPCPSIGRL  737


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  453  RHCSLVCFWSDSCSSAGRLAGNACGAHWFHAHAAWIL  343
                +VCFW+  C S GRLA  A GAHWFHA+AAWIL
Sbjct  719  EETDIVCFWNYPCPSIGRLACYASGAHWFHANAAWIL  755



>gb|KJB19704.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=743

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            CNPL+ARHWI++NTRTVNR+GQLTGYKLVPGSNCLPLAG+EAKFLRRAAFLKHNLWVT  
Sbjct  621  CNPLTARHWIVRNTRTVNRSGQLTGYKLVPGSNCLPLAGSEAKFLRRAAFLKHNLWVTQC  680

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYV  432
            A NEMFPGGEFPNQNPR GEGLA+WVK++R LEETDIVLW +
Sbjct  681  APNEMFPGGEFPNQNPRAGEGLATWVKRDRSLEETDIVLWLL  722



>ref|WP_027094208.1| tyramine oxidase [Cohnella thermotolerans]
Length=647

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR+W I N    N  GQ  GYK+V G NC P A   +  ++RA F++H+LWVTPY  NE
Sbjct  493  TARYWKIVNDNVKNDYGQSVGYKIVTGENCFPFASPNSSLIKRAGFIRHHLWVTPYNENE  552

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
            M+  G +PNQ+   G+GL++WV+Q+RP++ TDIV+WY  G THVPR EDWPVMP   IGF
Sbjct  553  MYAAGNYPNQHIG-GDGLSAWVEQDRPVKNTDIVVWYTMGHTHVPRPEDWPVMPAAYIGF  611

Query  365  MLMPHGFFN  339
            ML P GFFN
Sbjct  612  MLKPVGFFN  620



>ref|WP_025696771.1| tyramine oxidase, partial [Paenibacillus durus]
Length=475

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR+W I N    N  GQ  GYK+V G NC P A   +  L+RA F+KH+LWVTPY  +E
Sbjct  321  TARYWKIVNDNVKNELGQSVGYKIVTGENCFPFASKNSSLLKRAGFIKHHLWVTPYNEDE  380

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
            ++  G++PNQ+   GEGL+SW +Q+RP+  +DIV+WY  G THVPR EDWPVMP   IGF
Sbjct  381  IYASGKYPNQHIG-GEGLSSWAEQDRPVANSDIVVWYTMGHTHVPRPEDWPVMPTAYIGF  439

Query  365  MLMPHGFFN  339
            ML P  FFN
Sbjct  440  MLKPVSFFN  448



>ref|WP_008317043.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=632

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PL  R+W + N +  NR GQ  G+KL+PG N LP A  EA  ++RA FL  +LWVTPY
Sbjct  485  IDPLVGRYWKVVNPQVTNRLGQPVGFKLIPGENILPFAHPEAPIMKRAGFLNQHLWVTPY  544

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E FP G +PNQ+P  GEGL  W   +RPLE TD+VLWYVFG  H+PR EDWPVMPV 
Sbjct  545  QAAENFPAGPYPNQHPG-GEGLPQWTVADRPLENTDVVLWYVFGHHHIPRPEDWPVMPVA  603

Query  377  RIGFMLMPHGFFN  339
              GF L P GFF+
Sbjct  604  YSGFTLKPLGFFD  616



>gb|EEC73513.1| hypothetical protein OsI_07883 [Oryza sativa Indica Group]
Length=529

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = -2

Query  746  CVTCNPLSARHWII--KNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNL  573
             V C P  A + ++  +NTRTVNRTGQ TGYKLVPGS+CLPLA  EAKFLRRA FLKHNL
Sbjct  425  AVDCKPNEAYNQVVEVRNTRTVNRTGQPTGYKLVPGSSCLPLALPEAKFLRRAGFLKHNL  484

Query  572  WVTPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLW  438
            WVT +  +EMFPGGEFPNQNPR+ EGLA+WVK++R LEET++VLW
Sbjct  485  WVTSFKNDEMFPGGEFPNQNPRINEGLATWVKKDRSLEETNLVLW  529



>ref|WP_007920030.1| tyramine oxidase [Ktedonobacter racemifer]
 gb|EFH82153.1| Primary-amine oxidase [Ktedonobacter racemifer DSM 44963]
Length=649

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +P SAR+W + N    NR G+   YKL+PG N LP    E+  ++RA F+K NLWVTP
Sbjct  497  TIDPFSARYWKVANPNVQNRLGEPVAYKLMPGDNALPFLHPESSIMKRAGFIKKNLWVTP  556

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   E++P G++PNQ+   GEGL +W + NR LE TD+VLWYV    HV R EDWPVMP 
Sbjct  557  YHEKELYPAGDYPNQHAG-GEGLPAWTQANRSLENTDVVLWYVMNAHHVTRPEDWPVMPT  615

Query  380  ERIGFMLMPHGFFN  339
              IGFML P GFF+
Sbjct  616  TYIGFMLKPVGFFD  629



>ref|WP_036584415.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX90377.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91103.1| tyramine oxidase [Paenibacillus darwinianus]
 gb|EXX91955.1| tyramine oxidase [Paenibacillus darwinianus]
Length=647

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR+W   N    N  GQ  GYK++ G NC P A   +  ++RA F+KH+LWVTPY  NE
Sbjct  493  TARYWKFVNDNVKNDLGQSVGYKIMTGENCFPFASDSSSLIKRAGFIKHHLWVTPYNENE  552

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
            M+  G++PNQN   G+GL++WV+Q+RP+   DIV+WY  G THVPR EDWPVMP   IGF
Sbjct  553  MYASGKYPNQNIG-GDGLSAWVEQDRPVVNKDIVVWYTMGHTHVPRPEDWPVMPAAYIGF  611

Query  365  MLMPHGFFN  339
             L P GFFN
Sbjct  612  TLKPVGFFN  620



>ref|WP_017299862.1| tyramine oxidase [Nodosilinea nodulosa]
Length=642

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  734  NPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYA  555
            +P+ AR+W I N    N  G  T YKL+PG N LP+A + A   +RA ++  +LWVTPYA
Sbjct  494  DPMKARYWKIVNPTETNAMGYPTAYKLMPGENTLPMARSGASVTKRATYMTQHLWVTPYA  553

Query  554  RNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVER  375
              E FP G +PNQ+P  GEGL  W +++RP+  TD+V+WY F  +HVPR EDWPVMPV  
Sbjct  554  EEEKFPAGNYPNQHPG-GEGLPKWTERDRPIVNTDLVVWYTFAHSHVPRAEDWPVMPVAY  612

Query  374  IGFMLMPHGFFN  339
            IGFML P  FFN
Sbjct  613  IGFMLKPLNFFN  624



>gb|ETX01504.1| hypothetical protein ETSY2_37115, partial [Candidatus Entotheonella 
sp. TSY2]
Length=278

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P +AR+W I N  + N+TG    YKL+PG N LP A  ++   +R A++  +LWVTPY
Sbjct  131  IDPFAARYWQITNPSSTNKTGAPVAYKLLPGENTLPFAQPDSSIAKRGAYMWKHLWVTPY  190

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + NE +P G++PNQ+ + G+GL +W + +R +E TD+V+WYV    H+ RLEDWPVMPV 
Sbjct  191  SPNERYPAGDYPNQH-QGGDGLPAWTQADRSVENTDLVVWYVMNGNHIARLEDWPVMPVT  249

Query  377  RIGFMLMPHGFFN  339
             IGF L P GFF+
Sbjct  250  NIGFKLKPSGFFD  262



>ref|WP_035986372.1| tyramine oxidase [Leptolyngbya sp. KIOST-1]
Length=643

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  734  NPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYA  555
            +P+ AR+W I N    N  G  T YKL+PG N LPLA   A  + RA ++  +LWVTPYA
Sbjct  495  DPMKARYWKIVNPNETNAAGYPTAYKLMPGENTLPLARPHASVINRATYMTKHLWVTPYA  554

Query  554  RNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVER  375
             +E FP G++PNQ+P  GEGL  W + +RP++ TD+V+WY F  TH+PR EDWPVMP   
Sbjct  555  PDEKFPAGDYPNQSPG-GEGLPKWTEGDRPVDNTDLVVWYTFAHTHIPRAEDWPVMPTAY  613

Query  374  IGFMLMPHGFFN  339
            IGFML P  +F+
Sbjct  614  IGFMLKPLNYFD  625



>ref|WP_012627324.1| tyramine oxidase [Cyanothece sp. PCC 7425]
 gb|ACL44238.1| Amine oxidase (copper-containing) [Cyanothece sp. PCC 7425]
Length=641

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PLSAR+W+I N    N  GQ   YKL+PG N LP A  ++  ++RA F+  +LWVTPY
Sbjct  490  IDPLSARYWVIANPTVNNSLGQPVAYKLIPGENALPFAHPDSAIIKRATFMTKHLWVTPY  549

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E +P G++PNQ+P  G+GL  W   NR ++ TD+V+WY FG  H+PR EDWPVMPV 
Sbjct  550  HPKENYPAGDYPNQHPG-GDGLPRWTAANRSIDNTDLVVWYNFGHHHIPRPEDWPVMPVA  608

Query  377  RIGFMLMPHGFFN  339
             IGF L P GFF+
Sbjct  609  YIGFYLKPSGFFD  621



>gb|ABD03718.1| putative copper methylamine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=641

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +PL  R+W I N    NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TP
Sbjct  483  TVDPLRGRYWKIVNPNRHNRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATP  542

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   E FP G++PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP 
Sbjct  543  YHPGEKFPAGDYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPA  601

Query  380  ERIGFMLMPHGFFNC  336
              IGFML P GFF C
Sbjct  602  SYIGFMLKPLGFFEC  616



>ref|WP_041436864.1| tyramine oxidase [Synechococcus sp. JA-2-3B'a(2-13)]
Length=647

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +PL  R+W I N    NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TP
Sbjct  489  TVDPLRGRYWKIVNPNRHNRLGQPVAYKLMPGDNVQLLAHPDSWLYRRAGYLAHHLWATP  548

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   E FP G++PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMP 
Sbjct  549  YHPGEKFPAGDYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPA  607

Query  380  ERIGFMLMPHGFFNC  336
              IGFML P GFF C
Sbjct  608  SYIGFMLKPLGFFEC  622



>ref|WP_011430198.1| tyramine oxidase [Synechococcus sp. JA-3-3Ab]
 gb|ABC99520.1| copper amine oxidase [Synechococcus sp. JA-3-3Ab]
Length=672

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +PL  R+W I N    NR GQ   YKL+PG N   LA  ++   RRA +L H+LW TP
Sbjct  514  TVDPLRGRYWKIVNPNRHNRLGQPVAYKLMPGENVQLLAHPDSWLYRRAGYLAHHLWATP  573

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   E FP G +PNQ+P  GEGL  W + NR LE T +VLWY FG  H PR EDWPVMPV
Sbjct  574  YHPGEKFPAGNYPNQHPG-GEGLVQWTQANRSLENTRLVLWYSFGCNHFPRTEDWPVMPV  632

Query  380  ERIGFMLMPHGFFNC  336
              IGFML P GFF C
Sbjct  633  SYIGFMLKPLGFFEC  647



>ref|WP_036002001.1| tyramine oxidase [Leptolyngbya sp. JSC-1]
Length=652

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PL AR+W + N    NR GQ  G+KLVPG N LP A  +A  L+RA F+  +LWVTPY
Sbjct  495  VDPLKARYWKVVNPNQHNRLGQPVGFKLVPGENVLPFAHPDAPILKRAGFMTKHLWVTPY  554

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +E +P G +PNQ+P  GEGL  W + NR +E TD+V+WY+FG  H+PR ED+P+MPV 
Sbjct  555  SPSERYPTGNYPNQHPG-GEGLPQWTQANRSIENTDLVVWYMFGHHHIPRPEDFPIMPVA  613

Query  377  RIGFMLMPHGFFNC  336
              GF+L P GFF+ 
Sbjct  614  YAGFLLKPVGFFDA  627



>ref|WP_039728302.1| MULTISPECIES: tyramine oxidase [Oscillatoriophycideae]
 gb|KIF15990.1| tyramine oxidase [Aphanocapsa montana BDHKU210001]
 gb|KIF40915.1| tyramine oxidase [Lyngbya confervoides BDU141951]
Length=638

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PL  R+W + N    NR GQ  G+KL+PG N LP A  +A  ++RA F+  +LWVTPY
Sbjct  490  IDPLVGRYWKVVNPNIHNRLGQPVGFKLIPGENVLPFAHPDAPIVKRAGFITRHLWVTPY  549

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FP G +PNQ+P  GEGL  W +++R L+ TD+V+WYVFG  H+PR EDWPVMPV 
Sbjct  550  HPDENFPAGPYPNQHPG-GEGLLKWTQRDRALDNTDVVVWYVFGHHHIPRPEDWPVMPVA  608

Query  377  RIGFMLMPHGFFN  339
              GF L P GFF+
Sbjct  609  YSGFTLKPLGFFD  621



>ref|WP_012873420.1| tyramine oxidase [Sphaerobacter thermophilus]
 gb|ACZ40385.1| Primary-amine oxidase [Sphaerobacter thermophilus DSM 20745]
Length=646

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
              +PLSAR+W I N  ++N+ G+   Y+L+P  N LP+A   A  ++RA F+  ++WVTP
Sbjct  490  VVDPLSARYWKIVNHNSLNKVGEPVAYRLMPHGNVLPMAHPTASVMQRAGFMTKHVWVTP  549

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y   E +  G++PNQ+P  G GL +W  QNRP+ +TD+V+WY  G  HV RLEDWPVMPV
Sbjct  550  YRPEEKYAAGDYPNQHPG-GAGLPAWTAQNRPIVDTDVVVWYTLGSHHVVRLEDWPVMPV  608

Query  380  ERIGFMLMPHGFFNC  336
            + +GF+L P GFF+ 
Sbjct  609  QYVGFLLQPFGFFDA  623



>ref|WP_008314860.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 6406]
Length=643

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P+  R+W I N    N  G  T YKL+PG N LPLA   A  ++RA ++  +LWVTPY
Sbjct  493  IDPMKGRYWKIVNPTKTNAMGYPTAYKLMPGENTLPLARPNASVIKRATYMTQHLWVTPY  552

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +E FP G +PNQ+P  GEGL  W + +RP+E TD+V+W+ F  +H PR EDWPVMPV 
Sbjct  553  SPDEKFPAGNYPNQSPG-GEGLPQWTQADRPVENTDLVVWHTFAHSHSPRAEDWPVMPVS  611

Query  377  RIGFMLMPHGFFN  339
             IGFML P  FF+
Sbjct  612  TIGFMLKPLNFFD  624



>ref|WP_015845121.1| tyramine oxidase [Paenibacillus sp. JDR-2]
 gb|ACT02179.1| Primary-amine oxidase [Paenibacillus sp. JDR-2]
Length=647

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR+W   N    N  GQ  G+K+V G NC P A   +  ++RA F+KH+LWVTPY  +E
Sbjct  493  TARYWKFVNDNVKNELGQSVGFKIVTGENCFPFALDNSSLIKRAGFIKHHLWVTPYDEDE  552

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
            M+  G++PNQ+   G+GL++W +++R ++ TD+V+WY  G THVPR EDWPVMP   IGF
Sbjct  553  MYASGKYPNQH-LGGDGLSAWAEKDRDIKNTDVVVWYTMGHTHVPRPEDWPVMPAAYIGF  611

Query  365  MLMPHGFFN  339
            ML P  FFN
Sbjct  612  MLKPVSFFN  620



>ref|WP_015186652.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ28775.1| Copper amine oxidase domain-containing protein [Gloeocapsa sp. 
PCC 7428]
Length=646

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P + R+W I N    N  GQ   YKL+PG N LP A  E+  ++RA F+  +LWVTPY
Sbjct  497  IDPFTGRYWKIVNPAVRNSLGQPVSYKLMPGENILPFAHPESSVIKRAGFMTKHLWVTPY  556

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E++  G++PNQ+P    GL +W K NR +E TD+V+WY FG  HV R EDWPVMPV 
Sbjct  557  DPDELYAAGDYPNQHPG-DAGLPAWTKANREIENTDVVVWYTFGHNHVTRPEDWPVMPVS  615

Query  377  RIGFMLMPHGFFNC  336
             IGFML P GFF+ 
Sbjct  616  HIGFMLKPVGFFDA  629



>ref|WP_036531589.1| tyramine oxidase [Neosynechococcus sphagnicola]
 gb|KGF73303.1| tyramine oxidase [Neosynechococcus sphagnicola sy1]
Length=641

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 89/131 (68%), Gaps = 1/131 (1%)
 Frame = -2

Query  734  NPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYA  555
            +PL+ R+W I N   +NR G+   YKL PG N LP A  +A  L+RA F+  +LWVTPY 
Sbjct  495  DPLAGRYWKIVNPTVLNRLGKPVSYKLQPGENILPFADPQAWILKRAGFMTRHLWVTPYH  554

Query  554  RNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVER  375
              E +P G++PNQ+P  G GL +W + +R L+ TD+V+WY FG  H+PR EDWPVMPV  
Sbjct  555  PQENYPAGDYPNQHPG-GAGLPAWTEADRSLDNTDLVVWYNFGHHHIPRPEDWPVMPVAY  613

Query  374  IGFMLMPHGFF  342
            IGFML P GFF
Sbjct  614  IGFMLKPVGFF  624



>ref|WP_015124381.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
 gb|AFY60837.1| Cu2+-containing amine oxidase [Synechococcus sp. PCC 6312]
Length=650

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P  AR W+I N    N  GQ   YKL+P   CLP A  +A  ++RA FL  + W TPY
Sbjct  495  VDPFIARSWLITNPNLKNYLGQPVAYKLIPSETCLPFANDQAWVMKRAGFLNTHFWATPY  554

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FP G+ PNQ+P  GEGL  W + NRP+E TD+V+WY FG  H+PR EDWP+MP  
Sbjct  555  HPDENFPAGDHPNQHPG-GEGLQKWTQANRPIENTDVVVWYNFGHHHIPRPEDWPIMPTA  613

Query  377  RIGFMLMPHGFFN  339
             IGF L P GFF+
Sbjct  614  YIGFHLKPFGFFD  626



>ref|WP_006520181.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
 gb|EKU99059.1| Cu2+-containing amine oxidase [Leptolyngbya sp. PCC 7375]
Length=647

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 90/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +P+  R+W I N    N  G  T YKL+PG N LPLA  +A  +RRA ++  +LWVTP
Sbjct  493  TIDPMKGRYWKIVNPAKTNAMGYPTAYKLMPGENTLPLARPDASVIRRATYMTKHLWVTP  552

Query  560  YARNEMFPGGEFPNQNPRVGE-GLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMP  384
            Y+ +E +P G +PNQ+P  G+ GL  W + +R +E+TD+V+WY F  +H PR EDWPVMP
Sbjct  553  YSPDEKYPAGNYPNQHP--GDVGLPEWTQADRSVEDTDVVVWYTFAHSHSPRAEDWPVMP  610

Query  383  VERIGFMLMPHGFFN  339
            V  IGFML P  FF+
Sbjct  611  VATIGFMLKPLNFFD  625



>ref|WP_036480875.1| tyramine oxidase [Myxosarcina sp. GI1]
Length=634

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 1/134 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP S R+W I N  ++N  GQ  GYKL+PG N LP A  E+  ++RA F+  +LWVTPY
Sbjct  485  INPFSGRYWKIVNPSSLNSLGQPVGYKLMPGDNILPFAHPESSVIKRAGFMNKHLWVTPY  544

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E++  G++PNQ+P   EGL  W + +R ++ TD+V+WY FG  HV R EDWPVMPV 
Sbjct  545  QPDELYGAGDYPNQHPG-NEGLTKWTQSDRSVDNTDVVVWYTFGQHHVTRPEDWPVMPVA  603

Query  377  RIGFMLMPHGFFNC  336
             I F L P GFF+ 
Sbjct  604  YIDFKLKPIGFFDA  617



>ref|WP_006456034.1| tyramine oxidase [Synechococcus sp. PCC 7335]
 gb|EDX86269.1| Copper amine oxidase, enzyme domain protein [Synechococcus sp. 
PCC 7335]
Length=646

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P+  R+W I N    N  G  T YKL+PG N LP+A   A   +RAA++  +LWVTP+
Sbjct  498  IDPMKGRYWKIVNPSKTNAMGYPTAYKLMPGENTLPMARPSASVSKRAAYMSQHLWVTPF  557

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E +P G++PNQNP  G GL  W + +R +E+TD+V+WY F  +H PR EDWPVMPV 
Sbjct  558  HEDEKYPAGDYPNQNPG-GAGLPHWTQSDRVVEDTDLVVWYTFAHSHSPRAEDWPVMPVA  616

Query  377  RIGFMLMPHGFFN  339
             IGFML P  FF+
Sbjct  617  TIGFMLKPLNFFD  629



>ref|WP_009633550.1| Cu2+-containing amine oxidase [Synechocystis sp. PCC 7509]
Length=645

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 86/135 (64%), Gaps = 1/135 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
              NP+S R+W + N    N  GQ   YK++PG N LP    E+  ++RA +L  +LWVTP
Sbjct  496  VINPMSGRYWKVVNPDVHNSLGQPVAYKIMPGENILPFLHPESFVIKRAGYLNKHLWVTP  555

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y + E +P G +PNQ+   G+GL  W K +R +E TD+V+WY FG  H+PR EDWPVMP 
Sbjct  556  YNKAENYPAGAYPNQHAG-GDGLPEWTKADRHIENTDVVVWYTFGHNHIPRPEDWPVMPT  614

Query  380  ERIGFMLMPHGFFNC  336
              IGFML P GFF+ 
Sbjct  615  SYIGFMLKPVGFFDA  629



>ref|WP_012935344.1| tyramine oxidase [Conexibacter woesei]
 gb|ADB52293.1| Primary-amine oxidase [Conexibacter woesei DSM 14684]
Length=643

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 88/138 (64%), Gaps = 1/138 (1%)
 Frame = -2

Query  752  KPCVTCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNL  573
            + C    P  AR W++ N    N  G+   YKLVPG N +P A   +  LRRA F++H+L
Sbjct  486  EACRRLAPERARGWLVTNPAVRNAVGEAVAYKLVPGDNTVPFAAPGSALLRRAGFVEHHL  545

Query  572  WVTPYARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWP  393
            WVT +A  E +P GE+P Q+   GEGL +WV+ +RPL + D+VLWY     HVPR EDWP
Sbjct  546  WVTRHAAAERYPAGEYPYQH-SGGEGLPAWVQADRPLVDRDVVLWYTMNHHHVPRPEDWP  604

Query  392  VMPVERIGFMLMPHGFFN  339
            VMPV RIGF L P GFF+
Sbjct  605  VMPVARIGFELKPWGFFD  622



>gb|AIA11119.1| Copper amine oxidase, enzyme domain protein, partial [uncultured 
bacterium]
Length=158

 Score =   136 bits (342),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = -2

Query  734  NPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYA  555
            NP +AR W I N    N  G+  GYK +PG N  P A   A + +RA F+ +++WVTP+ 
Sbjct  1    NPATARVWKIINPVVKNHVGEPVGYKFLPGDNSFPYASPNAWWRKRAGFVNYHVWVTPFD  60

Query  554  RNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVER  375
             +E +  G++PNQ+   G+GL  W + +RP+ +TD+VLWY FG TH+PR ED+PVMP   
Sbjct  61   ESEKYAAGDYPNQS-GGGDGLIRWTEADRPVADTDVVLWYTFGHTHIPRPEDYPVMPAAY  119

Query  374  IGFMLMPHGFFN  339
            IGF+L P GFF+
Sbjct  120  IGFLLKPVGFFD  131



>ref|WP_029635581.1| hypothetical protein [actinobacterium SCGC AAA041-L13]
Length=629

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P+ +R W + N    N  G   GYKL+PG    PLA  E+   +RA F+  +LWVTP+
Sbjct  479  VDPIKSRFWKVINPNKKNHVGHSIGYKLIPGHTTYPLAHKESVLGKRAGFMYSHLWVTPH  538

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E +P G++P Q+   G GL  W K +R +E TD+VLW+VFG  H+PR EDWPVMPVE
Sbjct  539  VESERYPAGDYPFQH-EGGAGLPEWTKNDRSIENTDVVLWHVFGTNHIPRTEDWPVMPVE  597

Query  377  RIGFMLMPHGFF  342
            R GF L P GFF
Sbjct  598  RTGFHLKPTGFF  609



>ref|WP_026159538.1| hypothetical protein [actinobacterium SCGC AAA023-J06]
Length=637

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P+ +R W I N    N  G   GYKL+PG    PLA  ++   +RA F+  +LWVTP 
Sbjct  487  VDPIKSRFWKIINPNKKNHVGHSIGYKLIPGHTTYPLAHRDSVLGKRAGFMYSHLWVTPN  546

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E +P G++P Q+   G GL  W K NR LE TDIVLW+VFG  H+PR EDWPVMPVE
Sbjct  547  VESERYPAGDYPFQH-EGGAGLPEWTKNNRSLENTDIVLWHVFGTNHIPRTEDWPVMPVE  605

Query  377  RIGFMLMPHGFF  342
            R GF L P GFF
Sbjct  606  RTGFHLKPTGFF  617



>ref|WP_037709969.1| tyramine oxidase [Streptomyces mirabilis]
Length=666

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PL AR+W I+N + ++  G+  GY L+PG N +P+   EA F  RA F   +LWVT Y
Sbjct  511  IDPLKARYWRIENPQKLSGLGEPVGYTLMPGGNTVPMYPPEALFAPRAGFTASHLWVTAY  570

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E +  G++PNQ+P  GEGL ++   +RPLE+TD+V+WY FG  HV R EDWPVMPV 
Sbjct  571  DPAERYAAGDYPNQHPG-GEGLPAYAAADRPLEDTDVVVWYTFGAHHVVRPEDWPVMPVS  629

Query  377  RIGFMLMPHGFFN  339
             IGFML P GFF+
Sbjct  630  TIGFMLKPSGFFD  642



>ref|WP_029018078.1| hypothetical protein [actinobacterium SCGC AAA028-N15]
Length=632

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P S R+W + N    N      GYKL+PG    PLA  E+   ++AAF+  +LWVT  
Sbjct  486  IDPFSGRYWKVVNQEVKNHMDHPVGYKLIPGHTTFPLALPESTIGKKAAFMYKHLWVTKN  545

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E +P G++P Q+P  G GL  W K NR +E+ D+VLWYVFG  H+PR EDWPVMPVE
Sbjct  546  NESEKYPAGDYPFQHPG-GAGLPEWTKANRNIEDEDVVLWYVFGTNHIPRTEDWPVMPVE  604

Query  377  RIGFMLMPHGFF  342
            R GF L P GFF
Sbjct  605  RTGFHLKPSGFF  616



>ref|WP_041858942.1| hypothetical protein, partial [Candidatus Solibacter usitatus]
Length=616

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            S+R WI+ N    N  G  TGY L+PG N +P A  ++   RRAAFL  ++WVTPY  +E
Sbjct  479  SSRKWIVTNPHERNALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASE  538

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
            M+ GG++PNQ+ R G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF
Sbjct  539  MYAGGDYPNQS-RGGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGF  597

Query  365  MLMPHGFF  342
             L+P GFF
Sbjct  598  RLVPWGFF  605



>gb|ABJ81915.1| Amine oxidase (copper-containing) [Candidatus Solibacter usitatus 
Ellin6076]
Length=634

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            S+R WI+ N    N  G  TGY L+PG N +P A  ++   RRAAFL  ++WVTPY  +E
Sbjct  497  SSRKWIVTNPHERNALGHATGYALLPGENAVPFAQPDSWVRRRAAFLDSHIWVTPYRASE  556

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
            M+ GG++PNQ+ R G+GL  W   NR +   D+VLWY  G+TH PR EDWPVMPV   GF
Sbjct  557  MYAGGDYPNQS-RGGDGLRQWTAANRDIHNHDVVLWYTLGITHNPRPEDWPVMPVHAAGF  615

Query  365  MLMPHGFF  342
             L+P GFF
Sbjct  616  RLVPWGFF  623



>emb|CEG30995.1| Primary amine oxidase precursor [Bacillus simplex]
Length=650

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR W I N    NR G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+  +E
Sbjct  497  TARFWKIVNPSKKNRLGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPDE  556

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             F  G +PNQ+   GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F
Sbjct  557  QFASGRYPNQHAG-GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISF  615

Query  365  MLMPHGFFN  339
            +L P GFFN
Sbjct  616  ILKPTGFFN  624



>ref|WP_028063099.1| tyramine oxidase [Solirubrobacter soli]
Length=643

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PL  R W I+N   V+  G    YKLVPG N  P+   +++F  RA F + ++WVT Y
Sbjct  493  IDPLRGRFWRIENPNEVSALGDPVAYKLVPGENVAPMYAPDSRFANRAGFTREHVWVTAY  552

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E F  G++PNQ+P  G+G+A +V+ +RP E TD+VLWY FG  HV R EDWPVMPV 
Sbjct  553  DPAERFAAGDYPNQHPG-GDGVARYVEADRPTENTDVVLWYTFGAHHVVRPEDWPVMPVT  611

Query  377  RIGFMLMPHGFF  342
             IGF L P GFF
Sbjct  612  HIGFKLKPAGFF  623



>ref|WP_042206338.1| tyramine oxidase [Paenibacillus durus]
 gb|AIQ12487.1| tyramine oxidase [Paenibacillus durus]
Length=648

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            S+R+W I N    N  G   GYKL PG N  P A   +  ++RA FLKH+LW TPY   E
Sbjct  491  SSRYWKIVNPAKKNPVGDPVGYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPKE  550

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             +  G++PNQ+   G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF
Sbjct  551  KYASGDYPNQHAG-GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGF  609

Query  365  MLMPHGFFN  339
             L P GFF+
Sbjct  610  SLKPVGFFD  618



>ref|WP_041339143.1| tyramine oxidase [Rubrobacter radiotolerans]
Length=634

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +  SARHW +++T+T N+ G+   Y+L+P +N LP    E+   RRA F K + W TP
Sbjct  487  TTDSTSARHWRVESTQTKNKVGEPCAYRLIPQTNVLPFFTEESAISRRAGFAKKHFWATP  546

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            YA +E    G +PNQ+P  G+GL ++ + +R L+  D+V+WY  G  HV R+EDWPVMPV
Sbjct  547  YAPDERHAAGAYPNQSP--GDGLPNYTRDDRSLDGEDVVVWYTLGAHHVVRVEDWPVMPV  604

Query  380  ERIGFMLMPHGFFN  339
            +  GF L P GFF+
Sbjct  605  QHAGFKLEPAGFFD  618



>gb|AHY48354.1| Cu2+-containing amine oxidase [Rubrobacter radiotolerans]
Length=636

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 2/134 (1%)
 Frame = -2

Query  740  TCNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTP  561
            T +  SARHW +++T+T N+ G+   Y+L+P +N LP    E+   RRA F K + W TP
Sbjct  489  TTDSTSARHWRVESTQTKNKVGEPCAYRLIPQTNVLPFFTEESAISRRAGFAKKHFWATP  548

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            YA +E    G +PNQ+P  G+GL ++ + +R L+  D+V+WY  G  HV R+EDWPVMPV
Sbjct  549  YAPDERHAAGAYPNQSP--GDGLPNYTRDDRSLDGEDVVVWYTLGAHHVVRVEDWPVMPV  606

Query  380  ERIGFMLMPHGFFN  339
            +  GF L P GFF+
Sbjct  607  QHAGFKLEPAGFFD  620



>ref|WP_043457655.1| tyramine oxidase [Arthrobacter sp. 31Y]
Length=644

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = -2

Query  725  SARH--WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYAR  552
            SA+H  W I N    N   +   Y+L+P +     AG E+   +RA F ++NLWVT Y R
Sbjct  487  SAKHRFWKIANHDKTNLVNEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYNR  546

Query  551  NEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERI  372
             E F  GE+PNQ     +GL  W +QNR + +TD+V+WY FG+ HV RLEDWPVMP + I
Sbjct  547  TERFAAGEYPNQATGADDGLHIWTEQNRNIVDTDLVIWYTFGMHHVVRLEDWPVMPRQNI  606

Query  371  GFMLMPHGFFN  339
            GFML PHGFFN
Sbjct  607  GFMLEPHGFFN  617



>ref|WP_024819190.1| tyramine oxidase [Arthrobacter sp. 31Y]
Length=648

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 83/131 (63%), Gaps = 2/131 (2%)
 Frame = -2

Query  725  SARH--WIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYAR  552
            SA+H  W I N    N   +   Y+L+P +     AG E+   +RA F ++NLWVT Y R
Sbjct  491  SAKHRFWKIANHDKTNLVNEPVAYRLIPTNGIQLAAGDESYVSKRAQFARNNLWVTAYNR  550

Query  551  NEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERI  372
             E F  GE+PNQ     +GL  W +QNR + +TD+V+WY FG+ HV RLEDWPVMP + I
Sbjct  551  TERFAAGEYPNQATGADDGLHIWTEQNRNIVDTDLVIWYTFGMHHVVRLEDWPVMPRQNI  610

Query  371  GFMLMPHGFFN  339
            GFML PHGFFN
Sbjct  611  GFMLEPHGFFN  621



>ref|WP_009075996.1| tyramine oxidase [Streptomyces sp. AA4]
 gb|EFL06694.1| tyramine oxidase [Streptomyces sp. AA4]
Length=636

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +PL+ R W + N    + TG+  GY+L+PG+N LPLA + ++  RRA F   +LWVT Y
Sbjct  491  VDPLAGRVWTVVNPSVRHHTGRPVGYQLMPGTNILPLAQSGSQTSRRAGFAYRHLWVTAY  550

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              ++ +  G++PNQ P   +GLA +V+ +RPL +TD+V+WY FG  HVPR EDWPVMPV 
Sbjct  551  DPDQRYASGDYPNQRPG-DDGLAEYVRADRPLVDTDVVVWYTFGANHVPRPEDWPVMPVS  609

Query  377  RIGFMLMPHGFF  342
            + GF L P  FF
Sbjct  610  KAGFHLRPVAFF  621



>ref|WP_035742293.1| tyramine oxidase, partial [Arthrobacter sp. MA-N2]
Length=280

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = -2

Query  719  RHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMF  540
            R W I N  + N   +   Y+L+P       AG E+   +RA F ++NLWVT Y R E F
Sbjct  129  RFWKIVNHXSRNIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERF  188

Query  539  PGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  360
              GEFPNQ+    +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML
Sbjct  189  AAGEFPNQSTGADDGLHIWTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFML  248

Query  359  MPHGFFN  339
             PHGFFN
Sbjct  249  EPHGFFN  255



>ref|WP_043836428.1| tyramine oxidase [Amycolatopsis orientalis]
Length=623

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP +AR W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPY
Sbjct  475  ANPATARVWEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPY  534

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FP G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+
Sbjct  535  APDERFPAGDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVD  593

Query  377  RIGFMLMPHGF  345
              GFM+ P+GF
Sbjct  594  YSGFMVRPYGF  604



>ref|WP_026844103.1| tyramine oxidase [Geodermatophilaceae bacterium URHA0031]
Length=678

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP  AR W I N  +VN  GQ  GYKL+PG N LPL    ++   RA F   +LWVT Y
Sbjct  504  INPFVARTWQIVNPSSVNELGQPAGYKLMPGDNVLPLQQEGSQAWDRAQFAYKHLWVTRY  563

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E+F  G++PNQ+ R G GL  +VK +R LE+TD+V+WY FG  HV R EDWPVMPV 
Sbjct  564  EPGELFAAGDYPNQSQRPG-GLPEYVKADRSLEDTDVVVWYSFGAHHVVRPEDWPVMPVS  622

Query  377  RIGFMLMPHGFFN  339
              GF L P GFF+
Sbjct  623  YAGFHLKPVGFFD  635



>gb|EHN12772.1| Monoamine oxidase [Patulibacter medicamentivorans]
Length=632

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR W + N    N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E
Sbjct  478  TARGWTVVNPDVRNAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAE  537

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             +P GE+P Q+P  G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GF
Sbjct  538  RYPAGEYPYQHPG-GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGF  596

Query  365  MLMPHGFFN  339
            ML P GFF+
Sbjct  597  MLKPWGFFD  605



>ref|WP_037817779.1| tyramine oxidase [Streptomyces sp. NRRL F-3213]
Length=623

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP +AR W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPY
Sbjct  475  ANPATARVWEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPY  534

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FP G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+
Sbjct  535  APDERFPAGDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVD  593

Query  377  RIGFMLMPHGF  345
              GFM+ P+GF
Sbjct  594  YSGFMVRPYGF  604



>ref|WP_040597665.1| tyramine oxidase [Patulibacter medicamentivorans]
Length=641

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR W + N    N  GQ  GY+LV G N +P +   +   RRAAF+ H+LWVT +   E
Sbjct  487  TARGWTVVNPDVRNAVGQPVGYRLVTGENTVPFSAPGSSARRRAAFMDHHLWVTRHDPAE  546

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             +P GE+P Q+P  G+GL  WV+ +RPLE  D+V+WY     HVPR EDWPVMPV R+GF
Sbjct  547  RYPAGEYPYQHPG-GDGLPRWVQADRPLEREDLVVWYTMNHHHVPRPEDWPVMPVARLGF  605

Query  365  MLMPHGFFN  339
            ML P GFF+
Sbjct  606  MLKPWGFFD  614



>ref|WP_037715216.1| tyramine oxidase [Streptomyces sp. AA4]
Length=623

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP +AR W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPY
Sbjct  475  ANPATARVWEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPY  534

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FP G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+
Sbjct  535  APDERFPAGDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVD  593

Query  377  RIGFMLMPHGF  345
              GFM+ P+GF
Sbjct  594  YSGFMVRPYGF  604



>ref|WP_036725089.1| tyramine oxidase [Paenibacillus forsythiae]
Length=648

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            S+R+W I N    N  G    YKL PG N  P A   +  ++RA FLKH+LW TPY   E
Sbjct  491  SSRYWKIVNPNKKNHVGDPVSYKLFPGENAFPFASDNSSLIKRAGFLKHHLWCTPYNPEE  550

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             +  G +PNQ+   G GL+SWV+Q+R L+ TD+V+WY  G  HV R EDWPVMP   IGF
Sbjct  551  KYASGSYPNQHAG-GAGLSSWVQQDRSLDNTDVVVWYTMGHHHVTRPEDWPVMPTAYIGF  609

Query  365  MLMPHGFFN  339
             L P GFF+
Sbjct  610  SLKPVGFFD  618



>gb|EFL10175.1| tyramine oxidase [Streptomyces sp. AA4]
Length=656

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP +AR W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPY
Sbjct  508  ANPATARVWEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESTVYQRATFATNHLWVTPY  567

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FP G+ PN +P  G GL +W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+
Sbjct  568  APDERFPAGDRPNAHPG-GAGLPAWTAADRSVSDTDVVLWHVFGPTHIPRPEDWPVMPVD  626

Query  377  RIGFMLMPHGF  345
              GFM+ P+GF
Sbjct  627  YSGFMVRPYGF  637



>ref|WP_019310622.1| tyramine oxidase [Kocuria rhizophila]
 gb|KIC69986.1| histamine oxidase [Kocuria rhizophila]
Length=644

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 83/128 (65%), Gaps = 1/128 (1%)
 Frame = -2

Query  722  ARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEM  543
            AR W++ +T   NR G   GYKL P      LA  ++   RRAAF    LWVTPY  +E 
Sbjct  490  ARTWVVSSTEHTNRLGHPVGYKLHPEGLPTMLASEDSSIHRRAAFATKALWVTPYEESER  549

Query  542  FPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFM  363
            +P G+FPNQ+   G GL  W  Q+R ++ TDIV+W+ FG+TH PR+EDWP+MPV+ +GF 
Sbjct  550  YPTGDFPNQHAGNG-GLPEWTAQDRSVDGTDIVVWHTFGLTHFPRVEDWPIMPVDTVGFK  608

Query  362  LMPHGFFN  339
            L P GFF+
Sbjct  609  LRPEGFFD  616



>ref|WP_035741463.1| tyramine oxidase, partial [Arthrobacter sp. MA-N2]
Length=345

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 0/127 (0%)
 Frame = -2

Query  719  RHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEMF  540
            R W I N  + N   +   Y+L+P       AG E+   +RA F ++NLWVT Y R E F
Sbjct  194  RFWKIVNHESRNIVDEPVAYRLIPTDGIQLAAGDESYVSKRAQFARNNLWVTAYDRTERF  253

Query  539  PGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFML  360
              GEFPNQ+    +GL  W +++R + + D+V+WY FG+ HV RLEDWPVMP + IGFML
Sbjct  254  AAGEFPNQSTGADDGLHIWTEKDRNIVDEDLVVWYTFGMHHVVRLEDWPVMPRQNIGFML  313

Query  359  MPHGFFN  339
             PHGFFN
Sbjct  314  EPHGFFN  320



>gb|EMP12147.1| primary amine oxidase [Gordonia sp. NB4-1Y]
Length=644

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFL-RRAAFLKHNLWVTP  561
             NP +AR W + N    N+ G   GYKL+PG     L   E   + +RA F   N+WVTP
Sbjct  480  TNPQTARSWTVVNPNKANKWGMPVGYKLIPGWASDTLIAQEPSLMVKRAGFATKNMWVTP  539

Query  560  YARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPV  381
            Y  +EM   G+ PNQ+ R G GL +W + NRP+E TD+VLW+  GVTH+PR EDWPVMP 
Sbjct  540  YQPDEMHSAGDHPNQD-RSGAGLPTWTEANRPVENTDVVLWHTVGVTHIPRSEDWPVMPT  598

Query  380  ERIGFMLMPHGFFN  339
            E   FML+P+ FF+
Sbjct  599  EVASFMLVPNNFFD  612



>ref|WP_028074137.1| tyramine oxidase [Solirubrobacterales bacterium URHD0059]
Length=655

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P  AR W I+N   +N  G    YKL+PG N LP+A  E++   R+ F   ++WVT Y
Sbjct  504  IDPFKARSWRIENPNKLNHVGDPVAYKLIPGDNVLPMAHAESQQAPRSGFAHKHVWVTAY  563

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E F  G++PNQ+P  G GL  W K +RP+  TDIVLWY FG  HV R EDWPVMPV 
Sbjct  564  DPAEKFAAGDYPNQHPG-GVGLPEWTKADRPVANTDIVLWYNFGAHHVVRPEDWPVMPVT  622

Query  377  RIGFMLMPHGFF  342
             IGF L P GFF
Sbjct  623  HIGFKLKPAGFF  634



>ref|WP_015320499.1| Cu2+-containing amine oxidase [Natronococcus occultus]
 ref|YP_007308838.1| Cu2+-containing amine oxidase [Natronococcus occultus SP4]
 gb|AGB37048.1| Cu2+-containing amine oxidase [Natronococcus occultus SP4]
Length=681

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             N L  R+W +++    NR  Q  GYKLVPG N    A  ++  + RA ++ ++LW TP+
Sbjct  512  INSLKGRYWQVEHVENTNRLDQPVGYKLVPGENVEAAAQQQSSVMERAGYIAYHLWATPH  571

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
              +E FP GE+PNQNP  G+GL  W +Q+R L+  DIVLWY  GV HV R EDWPV+PV 
Sbjct  572  RDDERFPAGEYPNQNPG-GDGLPKWTQQDRSLDGEDIVLWYTLGVNHVDRPEDWPVLPVH  630

Query  377  RIGFMLMPHGFFN  339
               F L P  FF+
Sbjct  631  PASFKLEPVNFFS  643



>ref|WP_028930454.1| tyramine oxidase [Pseudonocardia asaccharolytica]
Length=644

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = -2

Query  722  ARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEM  543
            AR W I N    N  G+  GY L P  N +PL   EA  +RRA F+ H+LWVTP+A  E 
Sbjct  502  ARCWKIVNPHERNAVGEPPGYALKPRDNVVPLVQPEASVMRRAGFMAHHLWVTPHAERER  561

Query  542  FPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFM  363
               GE+PNQ+ + GEGL  W   +RP+ +TD+V+WY FG  HV RLEDWPVMP +  GF 
Sbjct  562  HAAGEYPNQH-QGGEGLLRWTAADRPVADTDLVVWYTFGSHHVARLEDWPVMPAQYAGFS  620

Query  362  LMPHGFFN  339
            L P GFF+
Sbjct  621  LQPTGFFD  628



>ref|WP_020471082.1| hypothetical protein [Zavarzinella formosa]
Length=631

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR W I N    N  G+  GYK +PG N  PLA   A + +RA F+ +++WV+PY   E
Sbjct  485  TARTWKIVNPNVKNHVGEPAGYKFLPGDNSFPLASPNAWWRKRARFVDYHVWVSPYDETE  544

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             F  G++PNQ+   G+GL  +  Q+RP+E TD+V WY FG TH+PR ED+PVMP   IGF
Sbjct  545  NFAAGDYPNQSSG-GDGLLKYTDQDRPIENTDVVFWYTFGHTHIPRPEDYPVMPTAYIGF  603

Query  365  MLMPHGFF  342
            +L P+GFF
Sbjct  604  LLKPNGFF  611



>ref|WP_033318483.1| hypothetical protein [Streptomyces yerevanensis]
Length=655

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 86/133 (65%), Gaps = 2/133 (2%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
            C+P +AR W I N    NR  +   YKLVP      LA  E+   RRA F + +LWVT Y
Sbjct  495  CDPFAARTWKITNPGVRNRFDEPVAYKLVPFVGPTLLAAPESDLARRAEFARAHLWVTRY  554

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            + +E+   G++PNQ+P  G+G+  W++Q R L +TD+VLW+ FG +H+PR EDWP+MP E
Sbjct  555  SPDELHAAGDYPNQHP--GDGIGKWIEQERDLADTDVVLWHTFGTSHLPRPEDWPIMPCE  612

Query  377  RIGFMLMPHGFFN  339
             +GF L P GFF+
Sbjct  613  YVGFALKPVGFFD  625



>ref|WP_033288818.1| tyramine oxidase [Amycolatopsis jejuensis]
Length=623

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
              P +AR W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPY
Sbjct  475  AKPATARVWEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESSVHKRATFATNHLWVTPY  534

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A +E FP G+ P  +P  G GL++W   +R + +TD+VLW+VFG TH+PR EDWPVMPV+
Sbjct  535  APDERFPAGDRPGAHPG-GAGLSAWTAGDRSISDTDVVLWHVFGPTHIPRPEDWPVMPVD  593

Query  377  RIGFMLMPHGFFN  339
              GF L P+GFF+
Sbjct  594  YSGFTLRPYGFFD  606



>ref|WP_037362055.1| tyramine oxidase [Amycolatopsis orientalis]
Length=623

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 86/131 (66%), Gaps = 1/131 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             NP +AR W +++T   NR G  T Y+LVP  +   +A  E+   +RA F  ++LWVTPY
Sbjct  475  ANPATARVWEVRSTEHTNRLGAPTAYQLVPRPSATLMAQPESSVYQRATFATNHLWVTPY  534

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
            A  E FP G+ PN +P  G GL +W   +R +  TDIVLW+VFG TH+PR EDWPVMPV+
Sbjct  535  APGERFPAGDRPNAHPG-GAGLPAWTAADRSVRHTDIVLWHVFGPTHIPRPEDWPVMPVD  593

Query  377  RIGFMLMPHGF  345
              GFM+ P+GF
Sbjct  594  YSGFMVRPYGF  604



>ref|WP_034299865.1| hypothetical protein [Bacillus sp. 37MA]
Length=152

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  734  NPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYA  555
            N  +AR W I N    N  G+  G++LVPG N       E+  ++RA F+K++L VT + 
Sbjct  2    NQETARAWKIINPNKKNFVGEPVGFELVPGENARIFLHDESSIVKRAGFIKNHLHVTKFD  61

Query  554  RNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVER  375
            R++M+  G++PNQ    G  L +WVK+NR +E  DIV+WY   V HV R EDWPVMP   
Sbjct  62   RDQMYASGKYPNQGEWNGSTLNNWVKENRNIENEDIVVWYNMAVHHVVRPEDWPVMPTHY  121

Query  374  IGFMLMPHGFFN  339
            IGFML PHGF++
Sbjct  122  IGFMLKPHGFYD  133



>ref|WP_018685630.1| hypothetical protein [Actinokineospora enzanensis]
Length=649

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 84/126 (67%), Gaps = 1/126 (1%)
 Frame = -2

Query  722  ARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNEM  543
            AR WI+++  +VNR G+   Y+L+P      +A  EA    RAAF   +LWVT +   ++
Sbjct  497  ARSWIVRSGDSVNRLGKPRAYQLMPHVGPTLMAQPEATVSARAAFATKHLWVTKHDDEQL  556

Query  542  FPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGFM  363
            +P G FPNQ+P  G GL  W K +R +E+ DIVLW+VFG THVPR EDWPVMPV+  GFM
Sbjct  557  YPAGNFPNQHPG-GSGLPEWTKADRKIEDEDIVLWHVFGPTHVPRPEDWPVMPVDYSGFM  615

Query  362  LMPHGF  345
            L PHGF
Sbjct  616  LRPHGF  621



>ref|WP_034315126.1| tyramine oxidase [Bacillus simplex]
Length=650

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -2

Query  725  SARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPYARNE  546
            +AR W I N    N  G+  GYKL  G NC P A  ++  L+RA FLKH+ WVTP+   E
Sbjct  497  TARFWKIVNPSKKNILGEPVGYKLFAGENCFPFAHDDSPLLKRAGFLKHHFWVTPFDPEE  556

Query  545  MFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVERIGF  366
             F  G +PNQ+   GEGL  WVK +R +E  D+V+WY  G  H+ R EDWPVMP   I F
Sbjct  557  QFASGRYPNQHAG-GEGLEDWVKADRSIENEDVVVWYNMGHHHITRPEDWPVMPTAYISF  615

Query  365  MLMPHGFFN  339
            +L P GFFN
Sbjct  616  ILKPTGFFN  624



>ref|WP_014740127.1| tyramine oxidase [Modestobacter marinus]
 emb|CCH87532.1| Primary amine oxidase [Modestobacter marinus]
Length=678

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 85/133 (64%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  CNPLSARHWIIKNTRTVNRTGQLTGYKLVPGSNCLPLAGTEAKFLRRAAFLKHNLWVTPY  558
             +P +AR W + N  +VN  GQ  GYKL+PG N LP+    ++   RA F   +LWVT  
Sbjct  504  IDPFAARTWQVVNPSSVNELGQPVGYKLMPGDNVLPMQQEGSQAYDRAQFAYKHLWVTRN  563

Query  557  ARNEMFPGGEFPNQNPRVGEGLASWVKQNRPLEETDIVLWYVFGVTHVPRLEDWPVMPVE  378
               E+F  G++PNQ+ R G GL  +VK +R LE+TD+V+WY FG  H+ R EDWPVMPV 
Sbjct  564  TPGELFAAGDYPNQSQRPG-GLPEFVKADRSLEDTDVVVWYSFGAHHIVRPEDWPVMPVS  622

Query  377  RIGFMLMPHGFFN  339
             IGF L P GFF+
Sbjct  623  TIGFHLKPVGFFD  635



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730