BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045D09

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004296510.1|  PREDICTED: proton pump-interactor 1              54.3    4e-05   Fragaria vesca subsp. vesca
ref|XP_010272430.1|  PREDICTED: proton pump-interactor 1              53.5    7e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010091118.1|  hypothetical protein L484_011324                 53.5    8e-05   
ref|XP_002533906.1|  DNA double-strand break repair rad50 ATPase,...  52.4    2e-04   
gb|EYU44948.1|  hypothetical protein MIMGU_mgv1a002984mg              52.0    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_007021492.1|  Proton pump interactor 1 isoform 2               51.6    4e-04   
gb|KHN28064.1|  hypothetical protein glysoja_007796                   51.2    5e-04   Glycine soja [wild soybean]
ref|XP_003543239.1|  PREDICTED: proton pump-interactor 1-like iso...  50.4    0.001   Glycine max [soybeans]



>ref|XP_004296510.1| PREDICTED: proton pump-interactor 1 [Fragaria vesca subsp. vesca]
 ref|XP_011462389.1| PREDICTED: proton pump-interactor 1 [Fragaria vesca subsp. vesca]
Length=610

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = -2

Query  764  KLTKKTLEQMRREEEIAKNKQAIERkkklaekaatkaalkaqkeaekklkdrerkakkka  585
            K+ +  L++M+REEEIAK KQA+ERKKK AEKAA KA +KAQKEAEKKLKDRE+KAKKKA
Sbjct  459  KVDEAKLKEMKREEEIAKAKQAMERKKKKAEKAAAKAEIKAQKEAEKKLKDREKKAKKKA  518

Query  584  gaaateEPTDDPSEKTSEDAEPEKPEENVEAVDEPTKPTTKDRKVGTVRQRPRPKGSSDI  405
             +A    P D+ +E  +E AEPEK  EN      P     K +K  T+R R RP+G   +
Sbjct  519  TSATESNP-DEATEPIAEVAEPEKATENAVV---PVPAKEKVQKDKTIRNRGRPRGPDSL  574

Query  404  HKVILKRKKSTNY  366
             KVILKRKKS NY
Sbjct  575  PKVILKRKKSNNY  587



>ref|XP_010272430.1| PREDICTED: proton pump-interactor 1 [Nelumbo nucifera]
Length=614

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = -2

Query  746  LEQMRREEEIAKNKQAIERkkklaekaatkaalkaqkeaekklkdrerkakkkagaaate  567
            L++M+REEEIAK KQA ERKKKLAEKAA KAA++AQKEAEKKLK+RE++AKKKA A    
Sbjct  468  LKEMKREEEIAKAKQAFERKKKLAEKAAVKAAVRAQKEAEKKLKEREKRAKKKAAATQPP  527

Query  566  EPTDDPSEKTSEDAEPEKPEENVEAVDEPTKPTTKDRKVGTVRQRPRPKGSSDIHKVILK  387
               ++ +E   E AEPEK EE+VE    P    +KD+K  TVR R R +G   + KV+ K
Sbjct  528  ISPEEQTEVNGEVAEPEKAEESVEG---PVPSKSKDQKENTVRYRTRARGQDPVPKVMFK  584

Query  386  RKKSTNY  366
            RKKST Y
Sbjct  585  RKKSTPY  591



>ref|XP_010091118.1| hypothetical protein L484_011324 [Morus notabilis]
 gb|EXB42553.1| hypothetical protein L484_011324 [Morus notabilis]
Length=686

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 3/66 (5%)
 Frame = -2

Query  560  TDDPSEKTSEDAEPEKPEENVEA-VDEPTKPTTKDRKVGTVRQRPRPKGSSDIHKVILKR  384
            +++ +E+ SEDAEPEK  ENVEA    P K   K +K  ++R R RP+G   I K ILKR
Sbjct  597  SEELAEQVSEDAEPEKENENVEAPATAPAK--VKVQKETSIRSRGRPRGPDSIPKAILKR  654

Query  383  KKSTNY  366
            KK TNY
Sbjct  655  KKPTNY  660



>ref|XP_002533906.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus 
communis]
 gb|EEF28480.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus 
communis]
Length=616

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 5/65 (8%)
 Frame = -2

Query  557  DDPSEKTSEDAEPEKPEENVEAVDEPTKPT-TKDRKVGTVRQRPRPKGSSDIHKVILKRK  381
            ++P+E+ SE  EPEK    +E  DEP+ P   K RK  +VR R R KG   + K IL+RK
Sbjct  528  EEPAEQVSEAVEPEK----LEVQDEPSAPVKDKIRKENSVRHRTRAKGGDSLPKAILRRK  583

Query  380  KSTNY  366
            +STNY
Sbjct  584  RSTNY  588



>gb|EYU44948.1| hypothetical protein MIMGU_mgv1a002984mg [Erythranthe guttata]
Length=619

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = -2

Query  554  DPSEKTSEDAEPEKPEENVEAVDEPTKPTTKDRK-VGTVRQRPRPKGSSDIHKVILKRKK  378
            D  E  +E AEP+K EE +E +  PT+   KDRK   TVR R RP+G   I K ILKRKK
Sbjct  535  DSEEAVAEVAEPQKIEEEIE-IPAPTEKV-KDRKGSSTVRARARPRGQDTITKTILKRKK  592

Query  377  STNY  366
             TNY
Sbjct  593  GTNY  596



>ref|XP_007021492.1| Proton pump interactor 1 isoform 2 [Theobroma cacao]
 gb|EOY13017.1| Proton pump interactor 1 isoform 2 [Theobroma cacao]
Length=627

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = -2

Query  746  LEQMRREEEIAKNKQAIERkkklaekaatkaalkaqkeaekklkdrerkakkkagaaate  567
            L++M+REEEIAK KQA+ERKKKLAEKAA KAA++AQKEAEKKLK+RE+KAKKKA A+AT 
Sbjct  477  LKEMKREEEIAKAKQAMERKKKLAEKAAAKAAIRAQKEAEKKLKEREKKAKKKAAASATA  536

Query  566  EPTDDPSEKTSEDAEPEKPEENVEAVDEPTKPTTKDR--KVGTVRQRPRPKGSSDIHKVI  393
               ++ +E  +E +EPEK + N +A   P+ P  KDR  K  TVR R R KG   + + I
Sbjct  537  ANPEEQTEDVAEASEPEKVDVNADAPVPPSVPV-KDRVQKENTVRYRNRAKGPESLPRAI  595

Query  392  LKRKKSTNY  366
            LKRKKSTNY
Sbjct  596  LKRKKSTNY  604



>gb|KHN28064.1| hypothetical protein glysoja_007796 [Glycine soja]
Length=625

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 3/127 (2%)
 Frame = -2

Query  746  LEQMRREEEIAKNKQAIERkkklaekaatkaalkaqkeaekklkdrerkakkkagaaate  567
            L++M+REEEI K KQA+ERKKKLAEKAA KAA++AQKEAEKKLKDRE+KAKKK+G AA  
Sbjct  479  LKEMKREEEIVKAKQALERKKKLAEKAAAKAAIRAQKEAEKKLKDREKKAKKKSGTAAVA  538

Query  566  EPTDDPSEKTSEDAEPEKPEENVEAVDEPTKPTTKDRKVGTVRQRPRPKGSSDIHKVILK  387
             P D+P ++  E  EPEK  ++V+A   P     K +K   +R R R +G   I K I+K
Sbjct  539  NPEDEPKDEVVEATEPEKINDDVQA---PAPVKEKVQKESGIRSRGRARGPDSIPKAIIK  595

Query  386  RKKSTNY  366
            RKKS NY
Sbjct  596  RKKSNNY  602



>ref|XP_003543239.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Glycine 
max]
 ref|XP_006594761.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Glycine 
max]
 gb|KHN36826.1| hypothetical protein glysoja_001557 [Glycine soja]
Length=616

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = -2

Query  746  LEQMRREEEIAKNKQAIERkkklaekaatkaalkaqkeaekklkdrerkakkkagaaate  567
            L++M+REEEIAK KQA+ERKKKLAEKAA KAA++AQKEAEKKLKDRE+KAKKK+GAAA  
Sbjct  470  LKEMKREEEIAKAKQALERKKKLAEKAAAKAAIRAQKEAEKKLKDREKKAKKKSGAAAVA  529

Query  566  EPTDDPSEKTSEDAEPEKPEENVEAVDEPTKPTTKDRKVGTVRQRPRPKGSSDIHKVILK  387
             P D+P ++  E  EPEK  ++V+ +  P K   K +K   +R R R +G   I K I+K
Sbjct  530  NPEDEPKDEVVEATEPEKVNDDVQVL-APVK--EKVQKESGIRSRGRARGPDSIPKAIIK  586

Query  386  RKKSTNY  366
            RKKS NY
Sbjct  587  RKKSNNY  593



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890