BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF045B23

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006357255.1|  PREDICTED: conserved oligomeric Golgi comple...    347   7e-110   Solanum tuberosum [potatoes]
ref|XP_009786961.1|  PREDICTED: conserved oligomeric Golgi comple...    345   5e-109   Nicotiana sylvestris
ref|XP_004238762.1|  PREDICTED: conserved oligomeric Golgi comple...    343   2e-108   Solanum lycopersicum
gb|KDP22425.1|  hypothetical protein JCGZ_26256                         340   2e-107   Jatropha curcas
ref|XP_009625424.1|  PREDICTED: conserved oligomeric Golgi comple...    339   1e-106   Nicotiana tomentosiformis
ref|XP_008234406.1|  PREDICTED: conserved oligomeric Golgi comple...    339   1e-106   Prunus mume [ume]
gb|AIU51136.1|  embryo yellow protein                                   338   1e-106   Prunus persica
ref|XP_007218916.1|  hypothetical protein PRUPE_ppa001391mg             338   1e-106   Prunus persica
ref|XP_010089680.1|  hypothetical protein L484_001268                   338   2e-106   Morus notabilis
gb|AIU51140.1|  embryo yellow protein                                   338   2e-106   Ricinus communis
ref|XP_002510953.1|  conserved hypothetical protein                     338   2e-106   Ricinus communis
ref|XP_011033997.1|  PREDICTED: conserved oligomeric Golgi comple...    337   7e-106   Populus euphratica
ref|XP_011076371.1|  PREDICTED: conserved oligomeric Golgi comple...    336   9e-106   Sesamum indicum [beniseed]
gb|AIU51131.1|  embryo yellow protein                                   336   9e-106   Manihot esculenta [manioc]
ref|XP_002304412.2|  conserved oligomeric Golgi complex component...    335   4e-105   
ref|XP_002267657.1|  PREDICTED: conserved oligomeric Golgi comple...    335   4e-105   Vitis vinifera
ref|XP_009372929.1|  PREDICTED: conserved oligomeric Golgi comple...    329   9e-105   
gb|KHG21476.1|  Conserved oligomeric Golgi complex subunit 7            321   1e-104   Gossypium arboreum [tree cotton]
ref|XP_007038383.1|  Oligomeric Golgi complex component-related /...    332   3e-104   
gb|AIU51110.1|  embryo yellow protein                                   332   3e-104   Theobroma cacao [chocolate]
ref|XP_004307803.1|  PREDICTED: conserved oligomeric Golgi comple...    332   3e-104   Fragaria vesca subsp. vesca
emb|CDP05334.1|  unnamed protein product                                332   3e-104   Coffea canephora [robusta coffee]
ref|XP_003534367.1|  PREDICTED: conserved oligomeric Golgi comple...    332   4e-104   Glycine max [soybeans]
gb|KHN11738.1|  Conserved oligomeric Golgi complex subunit 7            332   4e-104   Glycine soja [wild soybean]
gb|AIU51119.1|  embryo yellow protein                                   332   4e-104   Glycine max [soybeans]
ref|XP_007131467.1|  hypothetical protein PHAVU_011G016000g             332   6e-104   Phaseolus vulgaris [French bean]
gb|AIU51138.1|  embryo yellow protein                                   332   6e-104   Phaseolus vulgaris [French bean]
ref|XP_008376080.1|  PREDICTED: conserved oligomeric Golgi comple...    330   1e-103   
ref|XP_009340575.1|  PREDICTED: conserved oligomeric Golgi comple...    330   2e-103   Pyrus x bretschneideri [bai li]
gb|AIU51115.1|  embryo yellow protein                                   330   2e-103   Carica papaya [mamon]
gb|AIU51125.1|  embryo yellow protein                                   330   3e-103   Chimonanthus praecox [wintersweet]
gb|KHN46499.1|  Conserved oligomeric Golgi complex subunit 7            329   4e-103   Glycine soja [wild soybean]
ref|XP_009374477.1|  PREDICTED: conserved oligomeric Golgi comple...    328   9e-103   Pyrus x bretschneideri [bai li]
gb|AIU51152.1|  embryo yellow protein                                   328   2e-102   Platanus x hispanica [London plane tree]
gb|EYU24953.1|  hypothetical protein MIMGU_mgv1a001327mg                327   5e-102   Erythranthe guttata [common monkey flower]
gb|AIU51106.1|  embryo yellow protein                                   325   1e-101   Magnolia denudata [haku-mokuren]
ref|XP_006490119.1|  PREDICTED: conserved oligomeric Golgi comple...    324   3e-101   Citrus sinensis [apfelsine]
gb|KDO65493.1|  hypothetical protein CISIN_1g003266mg                   324   3e-101   Citrus sinensis [apfelsine]
gb|AIU51123.1|  embryo yellow protein                                   317   4e-101   Chloranthus japonicus
gb|AIU51111.1|  embryo yellow protein                                   324   4e-101   Acorus calamus [flagroot]
gb|AIU51151.1|  embryo yellow protein                                   324   4e-101   Cinnamomum camphora
gb|AIU51126.1|  embryo yellow protein                                   313   2e-100   Pandanus utilis
gb|AIU51147.1|  embryo yellow protein                                   322   3e-100   Schrenkiella parvula
gb|AIU51114.1|  embryo yellow protein                                   322   3e-100   Gossypium raimondii
ref|XP_006421663.1|  hypothetical protein CICLE_v10004313mg             322   4e-100   Citrus clementina [clementine]
emb|CDY00472.1|  BnaA10g08010D                                          303   5e-100   
gb|AIU51103.1|  embryo yellow protein                                   321   8e-100   Arabidopsis lyrata [lyrate rockcress]
gb|AIU51121.1|  embryo yellow protein                                   321   8e-100   Buxus sinica
gb|KEH17632.1|  oligomeric component-related/COG complex component      320   9e-100   Medicago truncatula
ref|XP_010692941.1|  PREDICTED: conserved oligomeric Golgi comple...    320   1e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU51104.1|  embryo yellow protein                                   320   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062289.1|  PREDICTED: conserved oligomeric Golgi comple...    317   1e-99    Eucalyptus grandis [rose gum]
ref|XP_004506344.1|  PREDICTED: conserved oligomeric Golgi comple...    319   3e-99    Cicer arietinum [garbanzo]
gb|AIU51116.1|  embryo yellow protein                                   319   4e-99    Capsella rubella
gb|AIU51108.1|  embryo yellow protein                                   318   7e-99    Pinellia ternata
ref|XP_010062284.1|  PREDICTED: conserved oligomeric Golgi comple...    318   9e-99    Eucalyptus grandis [rose gum]
ref|XP_006401980.1|  hypothetical protein EUTSA_v10012691mg             317   1e-98    Eutrema salsugineum [saltwater cress]
ref|XP_002865861.1|  hypothetical protein ARALYDRAFT_495214             317   2e-98    
gb|AIU51112.1|  embryo yellow protein                                   317   2e-98    Sarcandra glabra
ref|NP_199956.1|  COG7-like protein EYE                                 317   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AIU51128.1|  embryo yellow protein                                   316   4e-98    Aristolochia tagala
dbj|BAF00649.1|  hypothetical protein                                   316   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008439087.1|  PREDICTED: conserved oligomeric Golgi comple...    316   4e-98    Cucumis melo [Oriental melon]
ref|XP_004165037.1|  PREDICTED: conserved oligomeric Golgi comple...    316   5e-98    
ref|XP_004148143.1|  PREDICTED: conserved oligomeric Golgi comple...    316   5e-98    Cucumis sativus [cucumbers]
ref|XP_006280007.1|  hypothetical protein CARUB_v10025880mg             315   7e-98    Capsella rubella
ref|XP_010443240.1|  PREDICTED: conserved oligomeric Golgi comple...    315   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_010934963.1|  PREDICTED: conserved oligomeric Golgi comple...    315   1e-97    Elaeis guineensis
ref|XP_010482477.1|  PREDICTED: conserved oligomeric Golgi comple...    315   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_003618191.1|  Conserved oligomeric Golgi complex subunit         315   1e-97    Medicago truncatula
gb|AIU51129.1|  embryo yellow protein                                   315   1e-97    Medicago truncatula
ref|XP_006838140.1|  hypothetical protein AMTR_s00106p00086320          314   2e-97    Amborella trichopoda
dbj|BAG15881.1|  conserved oligomeric Golgi complex component 7-r...    314   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001132532.1|  uncharacterized protein LOC100193995               300   3e-97    
ref|XP_008796946.1|  PREDICTED: conserved oligomeric Golgi comple...    313   4e-97    Phoenix dactylifera
gb|AIU51105.1|  embryo yellow protein                                   303   7e-97    Lilium brownii [Hong Kong lily]
ref|XP_010264264.1|  PREDICTED: conserved oligomeric Golgi comple...    312   1e-96    Nelumbo nucifera [Indian lotus]
gb|AIU51143.1|  embryo yellow protein                                   312   1e-96    Yucca filamentosa [Adam's-needle]
gb|KFK26748.1|  hypothetical protein AALP_AA8G288200                    312   2e-96    Arabis alpina [alpine rockcress]
ref|XP_006657236.1|  PREDICTED: conserved oligomeric Golgi comple...    311   2e-96    Oryza brachyantha
ref|XP_010442640.1|  PREDICTED: conserved oligomeric Golgi comple...    308   3e-96    Camelina sativa [gold-of-pleasure]
gb|AIU51154.1|  embryo yellow protein                                   311   4e-96    Houttuynia cordata [chameleon-plant]
gb|AIU51127.1|  embryo yellow protein                                   310   7e-96    Asparagus officinalis
ref|XP_003563389.1|  PREDICTED: conserved oligomeric Golgi comple...    310   8e-96    
gb|EMT03910.1|  hypothetical protein F775_26031                         306   1e-95    
ref|XP_010536539.1|  PREDICTED: conserved oligomeric Golgi comple...    310   1e-95    Tarenaya hassleriana [spider flower]
ref|XP_009127310.1|  PREDICTED: conserved oligomeric Golgi comple...    310   1e-95    Brassica rapa
gb|EMS57916.1|  hypothetical protein TRIUR3_24838                       307   1e-95    Triticum urartu
gb|AIU51109.1|  embryo yellow protein                                   308   2e-95    Brachypodium distachyon [annual false brome]
gb|EEE66191.1|  hypothetical protein OsJ_22310                          308   3e-95    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51142.1|  embryo yellow protein                                   308   3e-95    Dioscorea oppositifolia
gb|AIU51130.1|  embryo yellow protein                                   308   4e-95    Canna indica [canna]
gb|EEC81147.1|  hypothetical protein OsI_24056                          308   6e-95    Oryza sativa Indica Group [Indian rice]
gb|AIU51102.1|  embryo yellow protein                                   307   8e-95    Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_009399332.1|  PREDICTED: conserved oligomeric Golgi comple...    306   1e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU51157.1|  embryo yellow protein                                   306   1e-94    Trachycarpus fortunei
dbj|BAD45448.1|  oligomeric golgi complex 7-like                        307   2e-94    Oryza sativa Japonica Group [Japonica rice]
gb|AIU51107.1|  embryo yellow protein                                   305   4e-94    Musa acuminata [banana]
ref|XP_002438832.1|  hypothetical protein SORBIDRAFT_10g026850          305   5e-94    Sorghum bicolor [broomcorn]
emb|CDX99921.1|  BnaC09g27840D                                          300   9e-94    
gb|AIU51137.1|  embryo yellow protein                                   304   1e-93    Panicum virgatum
ref|XP_009107451.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    304   1e-93    
dbj|BAJ94393.1|  predicted protein                                      303   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95800.1|  predicted protein                                      303   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU51146.1|  embryo yellow protein                                   303   3e-93    Sorghum bicolor [broomcorn]
gb|AIU51153.1|  embryo yellow protein                                   302   7e-93    Ginkgo biloba [ginkgo]
gb|AIU51149.1|  embryo yellow protein                                   302   8e-93    Lactuca sativa [cultivated lettuce]
ref|XP_008658135.1|  PREDICTED: uncharacterized protein LOC100193...    301   2e-92    
ref|XP_004966309.1|  PREDICTED: conserved oligomeric Golgi comple...    301   2e-92    Setaria italica
gb|AIU51155.1|  embryo yellow protein                                   299   8e-92    Zea mays [maize]
gb|AIU51144.1|  embryo yellow protein                                   299   1e-91    Setaria italica
gb|AIU51124.1|  embryo yellow protein                                   295   2e-90    Ceratophyllum demersum [hornwort]
gb|AIU51156.1|  embryo yellow protein                                   292   5e-89    Alisma plantago-aquatica
gb|AIU51150.1|  embryo yellow protein                                   291   6e-89    Ceratophyllum platyacanthum subsp. oryzetorum
ref|XP_003618197.1|  Conserved oligomeric Golgi complex subunit         289   1e-88    
gb|AIU51158.1|  embryo yellow protein                                   286   3e-87    Cabomba caroliniana
gb|EPS73811.1|  hypothetical protein M569_00940                         273   1e-81    Genlisea aurea
ref|XP_002992562.1|  hypothetical protein SELMODRAFT_135591             219   2e-62    
ref|XP_002972505.1|  hypothetical protein SELMODRAFT_148467             219   2e-62    
emb|CDY56655.1|  BnaA02g11250D                                          218   8e-62    Brassica napus [oilseed rape]
emb|CDY00475.1|  BnaA10g07980D                                          217   2e-61    
emb|CDX91578.1|  BnaC02g15820D                                          216   3e-61    
ref|XP_001770876.1|  predicted protein                                  201   1e-55    
gb|AIU51139.1|  embryo yellow protein                                   177   2e-52    Artemisia annua [sweet Annie]
ref|XP_008376425.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...    169   1e-44    
ref|NP_001058323.2|  Os06g0669600                                       150   3e-41    
ref|XP_006491716.1|  PREDICTED: uncharacterized protein LOC102619662    157   9e-40    
ref|XP_001418731.1|  predicted protein                                  131   6e-31    Ostreococcus lucimarinus CCE9901
gb|AIU51120.1|  embryo yellow protein                                   125   9e-29    Illicium henryi
ref|XP_003080398.1|  conserved oligomeric Golgi complex component...    119   8e-28    
emb|CEF98773.1|  Conserved oligomeric Golgi complex subunit 7           119   7e-27    Ostreococcus tauri
emb|CBI21190.3|  unnamed protein product                                103   1e-23    Vitis vinifera
ref|XP_002503576.1|  predicted protein                                  108   3e-23    Micromonas commoda
ref|XP_007513783.1|  predicted protein                                  105   1e-21    Bathycoccus prasinos
ref|XP_003055554.1|  predicted protein                                  103   2e-21    Micromonas pusilla CCMP1545
ref|XP_002731007.1|  PREDICTED: conserved oligomeric Golgi comple...  99.8    3e-21    Saccoglossus kowalevskii
ref|XP_005847546.1|  hypothetical protein CHLNCDRAFT_133750             102   8e-21    Chlorella variabilis
ref|XP_001701937.1|  component of oligomeric golgi complex 7          92.8    1e-17    Chlamydomonas reinhardtii
ref|XP_005643872.1|  hypothetical protein COCSUDRAFT_67854            92.8    1e-17    Coccomyxa subellipsoidea C-169
ref|XP_797564.3|  PREDICTED: conserved oligomeric Golgi complex s...  87.4    1e-16    
gb|EKC24157.1|  Conserved oligomeric Golgi complex subunit 7          89.4    2e-16    Crassostrea gigas
ref|XP_011431811.1|  PREDICTED: conserved oligomeric Golgi comple...  89.4    2e-16    Crassostrea gigas
ref|XP_005105726.1|  PREDICTED: conserved oligomeric Golgi comple...  87.8    4e-16    Aplysia californica
ref|XP_786237.3|  PREDICTED: conserved oligomeric Golgi complex s...  87.8    5e-16    Strongylocentrotus purpuratus [purple urchin]
gb|EFA86654.1|  oligomeric Golgi complex component                    87.0    8e-16    Heterostelium album PN500
ref|XP_011402672.1|  PREDICTED: conserved oligomeric Golgi comple...  86.7    8e-16    
ref|XP_001844946.1|  conserved hypothetical protein                   82.8    2e-14    Culex quinquefasciatus
ref|XP_009062761.1|  hypothetical protein LOTGIDRAFT_194952           81.6    5e-14    Lottia gigantea
ref|XP_004206189.1|  PREDICTED: conserved oligomeric Golgi comple...  77.0    1e-13    
gb|ELT88100.1|  hypothetical protein CAPTEDRAFT_161050                80.1    1e-13    Capitella teleta
ref|XP_002407978.1|  conserved oligomeric golgi complex subunit, ...  79.7    2e-13    Ixodes scapularis [blacklegged tick]
emb|CDS12214.1|  hypothetical protein LRAMOSA04409                    77.8    1e-12    Lichtheimia ramosa
ref|XP_005825555.1|  oligomeric Golgi complex subunit 7               76.3    3e-12    Guillardia theta CCMP2712
ref|XP_004535745.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    4e-12    
ref|XP_003703617.1|  PREDICTED: conserved oligomeric Golgi comple...  75.9    4e-12    
ref|XP_006682175.1|  hypothetical protein BATDEDRAFT_27828            75.9    4e-12    Batrachochytrium dendrobatidis JAM81
ref|XP_011299085.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    7e-12    Fopius arisanus
ref|XP_011299070.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    7e-12    Fopius arisanus
dbj|GAM17697.1|  hypothetical protein SAMD00019534_008720             74.7    8e-12    Acytostelium subglobosum LB1
ref|XP_011299078.1|  PREDICTED: conserved oligomeric Golgi comple...  74.7    8e-12    Fopius arisanus
ref|XP_002109935.1|  hypothetical protein TRIADDRAFT_53345            74.3    9e-12    Trichoplax adhaerens
ref|XP_006872058.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    1e-11    Chrysochloris asiatica
ref|XP_004080382.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    1e-11    Oryzias latipes [Japanese rice fish]
ref|XP_006637161.1|  PREDICTED: conserved oligomeric Golgi comple...  74.3    1e-11    Lepisosteus oculatus
ref|XP_003490215.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11    
ref|XP_007571518.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    2e-11    Poecilia formosa
ref|XP_005810284.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11    Xiphophorus maculatus
ref|XP_003397366.1|  PREDICTED: conserved oligomeric Golgi comple...  73.6    2e-11    Bombus terrestris [large earth bumblebee]
ref|XP_006892752.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004706118.1|  PREDICTED: conserved oligomeric Golgi comple...  73.2    2e-11    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007951381.1|  PREDICTED: conserved oligomeric Golgi comple...  72.4    5e-11    Orycteropus afer afer
ref|XP_006003103.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    5e-11    Latimeria chalumnae
ref|XP_006193181.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    6e-11    Camelus ferus
gb|KDR16116.1|  Conserved oligomeric Golgi complex subunit 7          72.0    6e-11    Zootermopsis nevadensis
ref|XP_010959320.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    6e-11    Camelus bactrianus [camel]
gb|EPY74529.1|  conserved oligomeric Golgi complex subunit 7-like...  72.0    6e-11    Camelus ferus
ref|XP_010985221.1|  PREDICTED: conserved oligomeric Golgi comple...  72.0    6e-11    Camelus dromedarius [camel]
ref|XP_011340196.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    7e-11    
ref|XP_004373515.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    8e-11    Trichechus manatus latirostris
ref|XP_003418948.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    8e-11    Loxodonta africana [African bush elephant]
ref|XP_006125865.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  71.6    8e-11    
gb|EFZ22757.1|  hypothetical protein SINV_01051                       71.6    9e-11    
ref|XP_011340195.1|  PREDICTED: conserved oligomeric Golgi comple...  71.6    9e-11    
ref|XP_008434639.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    1e-10    Poecilia reticulata
ref|XP_011159533.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    1e-10    Solenopsis invicta [imported red fire ant]
ref|XP_007058642.1|  PREDICTED: conserved oligomeric Golgi comple...  71.2    1e-10    Chelonia mydas [green seaturtle]
ref|XP_005288959.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Chrysemys picta bellii
ref|XP_004604166.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Sorex araneus [Eurasian shrew]
ref|XP_003961343.1|  PREDICTED: conserved oligomeric Golgi comple...  70.9    1e-10    Takifugu rubripes [tiger puffer]
gb|ENN72949.1|  hypothetical protein YQE_10420                        68.6    2e-10    Dendroctonus ponderosae
ref|XP_007571524.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    2e-10    Poecilia formosa
ref|XP_007571519.1|  PREDICTED: conserved oligomeric Golgi comple...  70.5    2e-10    Poecilia formosa
ref|XP_001652664.1|  AAEL007307-PA                                    70.1    2e-10    
ref|XP_009194445.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    2e-10    
ref|XP_006201263.1|  PREDICTED: conserved oligomeric Golgi comple...  70.1    3e-10    Vicugna pacos
ref|XP_003691700.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    
ref|XP_006623838.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Apis dorsata [rock honeybee]
ref|XP_006623839.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Apis dorsata [rock honeybee]
ref|XP_008150973.1|  PREDICTED: conserved oligomeric Golgi comple...  69.7    3e-10    Eptesicus fuscus
ref|XP_394713.2|  PREDICTED: conserved oligomeric Golgi complex s...  69.3    4e-10    
ref|XP_003341699.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  69.3    4e-10    Monodelphis domestica
ref|XP_008695386.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  69.3    4e-10    Ursus maritimus [white bear]
ref|XP_004398866.1|  PREDICTED: conserved oligomeric Golgi comple...  69.3    5e-10    Odobenus rosmarus divergens
ref|XP_004360949.1|  oligomeric Golgi complex component               69.3    5e-10    Cavenderia fasciculata
ref|XP_004442758.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010903275.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10    Esox lucius
ref|XP_002927171.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10    Ailuropoda melanoleuca
ref|XP_004268622.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    5e-10    Orcinus orca [Orca]
ref|XP_011068677.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    Acromyrmex echinatior
gb|ELK37852.1|  Conserved oligomeric Golgi complex subunit 7          68.9    6e-10    Myotis davidii
ref|XP_007516677.1|  PREDICTED: conserved oligomeric Golgi comple...  68.9    6e-10    
ref|NP_001029061.1|  conserved oligomeric Golgi complex subunit 7     68.9    6e-10    Rattus norvegicus [brown rat]
gb|EGI69206.1|  Conserved oligomeric Golgi complex subunit 7          68.9    7e-10    Acromyrmex echinatior
ref|XP_002953697.1|  component of oligomeric golgi complex 7          68.9    7e-10    Volvox carteri f. nagariensis
ref|XP_007615834.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    7e-10    
ref|XP_004855999.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Heterocephalus glaber [naked mole rat]
gb|ERE78144.1|  conserved oligomeric Golgi complex subunit 7          68.6    8e-10    Cricetulus griseus [Chinese hamsters]
ref|XP_006753680.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    
ref|XP_007105719.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Physeter catodon
ref|XP_007450043.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    Lipotes vexillifer [baiji]
gb|ERL93874.1|  hypothetical protein D910_11160                       68.6    8e-10    Dendroctonus ponderosae
ref|XP_004900783.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    8e-10    
ref|XP_004453849.1|  PREDICTED: conserved oligomeric Golgi comple...  68.6    9e-10    Dasypus novemcinctus
ref|XP_007233023.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    9e-10    
ref|XP_010184345.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    9e-10    Mesitornis unicolor
gb|EPQ17692.1|  Conserved oligomeric Golgi complex subunit 7          68.2    9e-10    Myotis brandtii
ref|XP_004691773.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Condylura cristata
sp|Q3UM29.1|COG7_MOUSE  RecName: Full=Conserved oligomeric Golgi ...  68.2    1e-09    Mus musculus [mouse]
ref|XP_003795773.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Otolemur garnettii
ref|NP_001028490.2|  conserved oligomeric Golgi complex subunit 7     68.2    1e-09    Mus musculus [mouse]
ref|XP_006912615.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_005882395.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_004778381.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Mustela putorius furo [black ferret]
ref|XP_006085923.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_001510180.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
gb|EDL17254.1|  component of oligomeric golgi complex 7               68.2    1e-09    Mus musculus [mouse]
ref|XP_005351192.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Microtus ochrogaster [prairie voles]
ref|XP_006085922.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
ref|XP_004670260.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Jaculus jaculus
ref|XP_006808092.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Neolamprologus brichardi [lyretail cichlid]
ref|XP_005405154.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    
gb|ELK12106.1|  Conserved oligomeric Golgi complex subunit 7          67.8    1e-09    Pteropus alecto
ref|XP_003513853.1|  PREDICTED: conserved oligomeric Golgi comple...  68.2    1e-09    Cricetulus griseus [Chinese hamsters]
gb|AAQ88995.1|  COG7                                                  67.8    1e-09    Homo sapiens [man]
ref|XP_005405156.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_007986068.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Chlorocebus sabaeus
ref|XP_005063464.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_003261698.2|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_005405157.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_011264700.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_005405155.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_006980401.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    Peromyscus maniculatus bairdii
emb|CDQ66102.1|  unnamed protein product                              67.8    1e-09    Oncorhynchus mykiss
ref|XP_011264701.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    1e-09    
ref|XP_006027196.1|  PREDICTED: conserved oligomeric Golgi comple...  67.8    2e-09    Alligator sinensis
ref|XP_536935.3|  PREDICTED: conserved oligomeric Golgi complex s...  67.4    2e-09    Canis lupus familiaris [dogs]
ref|XP_004622945.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Octodon degus
ref|XP_009428772.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Pan troglodytes
ref|XP_005255738.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    
ref|XP_010339086.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Saimiri boliviensis boliviensis
ref|XP_510875.2|  PREDICTED: conserved oligomeric Golgi complex s...  67.4    2e-09    Pan troglodytes
dbj|BAG52793.1|  unnamed protein product                              67.4    2e-09    Homo sapiens [man]
ref|XP_006730882.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Leptonychotes weddellii
ref|XP_010356516.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Rhinopithecus roxellana
ref|XP_009007562.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Callithrix jacchus [common marmoset]
ref|NP_705831.1|  conserved oligomeric Golgi complex subunit 7        67.4    2e-09    Homo sapiens [man]
ref|XP_004057400.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    
ref|XP_005591519.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Macaca fascicularis [crab eating macaque]
gb|ABC86343.1|  IP14069p                                              65.9    2e-09    Drosophila melanogaster
ref|XP_005748533.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Pundamilia nyererei
ref|XP_003813754.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Pan paniscus [bonobo]
ref|XP_004571418.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Maylandia zebra
ref|XP_003930238.1|  PREDICTED: conserved oligomeric Golgi comple...  67.4    2e-09    Saimiri boliviensis boliviensis
ref|XP_002293816.1|  predicted protein                                63.9    2e-09    Thalassiosira pseudonana CCMP1335
ref|XP_005935571.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Haplochromis burtoni
ref|XP_008202375.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Nasonia vitripennis
ref|XP_008299300.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Stegastes partitus
ref|XP_008559723.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    
ref|XP_008202374.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    Nasonia vitripennis
ref|XP_008202376.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    
ref|XP_006148372.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    
ref|XP_008202373.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    2e-09    
gb|ELR49362.1|  Conserved oligomeric Golgi complex subunit 7          67.0    3e-09    
ref|XP_007084222.1|  PREDICTED: conserved oligomeric Golgi comple...  67.0    3e-09    
ref|NP_001124794.1|  conserved oligomeric Golgi complex subunit 7     66.6    3e-09    
emb|CDQ68336.1|  unnamed protein product                              66.6    3e-09    
ref|XP_008504971.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_003998815.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_003438511.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_003478248.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_010835502.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_005697660.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
emb|CBY21571.1|  unnamed protein product                              66.6    3e-09    
ref|XP_005975366.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_009089982.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_005905382.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|NP_001076841.1|  conserved oligomeric Golgi complex subunit 7     66.6    3e-09    
ref|XP_006071244.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    3e-09    
ref|XP_001916280.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-09    
ref|XP_005598907.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-09    
ref|XP_010791235.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-09    
ref|XP_004020887.1|  PREDICTED: conserved oligomeric Golgi comple...  66.6    4e-09    
ref|XP_005323804.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_011154014.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_005523167.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    4e-09    
ref|XP_007198346.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  66.2    4e-09    
ref|XP_008842039.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    5e-09    
ref|XP_008058130.1|  PREDICTED: conserved oligomeric Golgi comple...  66.2    5e-09    
ref|XP_002431030.1|  conserved hypothetical protein                   65.9    5e-09    
ref|XP_008631786.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    5e-09    
ref|XP_008474511.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    5e-09    
gb|KFO58912.1|  Conserved oligomeric Golgi complex subunit 7          65.9    5e-09    
ref|XP_005141261.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    6e-09    
ref|XP_010731364.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09    
ref|XP_010390549.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09    
ref|NP_001264493.1|  conserved oligomeric Golgi complex subunit 7     65.9    6e-09    
ref|XP_008566482.1|  PREDICTED: conserved oligomeric Golgi comple...  65.9    6e-09    
ref|XP_005718297.1|  unnamed protein product                          65.5    6e-09    
ref|XP_010731365.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_005054658.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_011186252.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_005505761.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    7e-09    
ref|XP_011502446.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    8e-09    
ref|XP_009957143.1|  PREDICTED: conserved oligomeric Golgi comple...  65.5    9e-09    
gb|KFQ15936.1|  Conserved oligomeric Golgi complex subunit 7          65.1    9e-09    
ref|XP_005426090.1|  PREDICTED: conserved oligomeric Golgi comple...  65.1    9e-09    
gb|KFQ47789.1|  Conserved oligomeric Golgi complex subunit 7          64.7    1e-08    
ref|XP_009665180.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    1e-08    
gb|KFQ25509.1|  Conserved oligomeric Golgi complex subunit 7          64.7    1e-08    
ref|XP_010010968.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    2e-08    
ref|XP_004586873.1|  PREDICTED: conserved oligomeric Golgi comple...  64.7    2e-08    
gb|KFQ77454.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_009665174.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_008933945.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
gb|KFV72508.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_010621761.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
ref|XP_009072086.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
gb|KFP79541.1|  Conserved oligomeric Golgi complex subunit 7          64.3    2e-08    
ref|XP_009318776.1|  PREDICTED: conserved oligomeric Golgi comple...  64.3    2e-08    
gb|KFM12505.1|  Conserved oligomeric Golgi complex subunit 7          63.9    2e-08    
gb|KFV44518.1|  Conserved oligomeric Golgi complex subunit 7          63.9    2e-08    
gb|KFW64649.1|  Conserved oligomeric Golgi complex subunit 7          63.9    2e-08    
ref|XP_009974505.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|NP_001015714.1|  component of oligomeric golgi complex 7          63.9    2e-08    
ref|XP_009284907.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_005018689.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    2e-08    
ref|XP_002105431.1|  GD17535                                          63.9    3e-08    
ref|NP_001070861.1|  conserved oligomeric Golgi complex subunit 7     63.9    3e-08    
ref|XP_002037280.1|  GM12202                                          63.9    3e-08    
ref|XP_002711891.2|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_009919151.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_003230028.2|  PREDICTED: conserved oligomeric Golgi comple...  63.2    3e-08    
ref|XP_010568816.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_009919150.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_010717801.1|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
gb|KFQ05597.1|  Conserved oligomeric Golgi complex subunit 7          63.9    3e-08    
ref|XP_006507762.2|  PREDICTED: conserved oligomeric Golgi comple...  63.9    3e-08    
ref|XP_009893067.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_006507763.2|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_010144199.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_010171643.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|KFZ48154.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_313727.3|  AGAP004439-PA                                       63.5    3e-08    
gb|ELW66292.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_010568814.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_010299541.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|KFO84349.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_009930601.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_005229099.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
ref|XP_008926490.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    3e-08    
gb|KFQ70547.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
gb|KFW84542.1|  Conserved oligomeric Golgi complex subunit 7          63.5    3e-08    
ref|XP_009696306.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_009815736.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|NP_651750.1|  Cog7                                                63.5    4e-08    
gb|KFP63966.1|  Conserved oligomeric Golgi complex subunit 7          63.5    4e-08    
ref|XP_010295242.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
gb|KFW91579.1|  Conserved oligomeric Golgi complex subunit 7          63.5    4e-08    
ref|XP_009503997.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_005443671.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_011207193.1|  PREDICTED: conserved oligomeric Golgi comple...  63.5    4e-08    
ref|XP_010125973.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
gb|KFQ52210.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|XP_009585506.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
gb|KFR08003.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
gb|KFP45453.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|XP_009482406.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
gb|KFV98617.1|  Conserved oligomeric Golgi complex subunit 7          63.2    4e-08    
ref|XP_007903979.1|  PREDICTED: conserved oligomeric Golgi comple...  63.2    4e-08    
ref|XP_002098511.1|  GE10410                                          63.2    5e-08    
ref|XP_003230252.2|  PREDICTED: conserved oligomeric Golgi comple...  63.2    5e-08    
ref|NP_001085832.1|  component of oligomeric golgi complex 7          63.2    5e-08    
gb|KDO27581.1|  hypothetical protein SPRG_06849                       62.4    7e-08    
ref|XP_009983312.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
gb|KFV17186.1|  Conserved oligomeric Golgi complex subunit 7          62.4    8e-08    
ref|XP_001357618.1|  GA15960                                          62.4    8e-08    
ref|XP_010198342.1|  PREDICTED: conserved oligomeric Golgi comple...  62.4    8e-08    
ref|XP_001993908.1|  GH22206                                          62.4    9e-08    
ref|XP_002001440.1|  GI21972                                          62.0    1e-07    
ref|XP_009466130.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
ref|XP_008488587.1|  PREDICTED: conserved oligomeric Golgi comple...  62.0    1e-07    
gb|KFQ99971.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
gb|KFO95573.1|  Conserved oligomeric Golgi complex subunit 7          62.0    1e-07    
ref|XP_001981279.1|  GG11984                                          62.0    1e-07    
ref|XP_002802472.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07    
ref|XP_009646382.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    1e-07    
ref|XP_010073318.1|  PREDICTED: conserved oligomeric Golgi comple...  61.6    2e-07    
gb|KFP10525.1|  Conserved oligomeric Golgi complex subunit 7          61.6    2e-07    
ref|XP_009906223.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
gb|KFV74312.1|  Conserved oligomeric Golgi complex subunit 7          61.2    2e-07    
gb|KFM79726.1|  Conserved oligomeric Golgi complex subunit 7          58.5    2e-07    
ref|XP_001945391.2|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
ref|XP_010000872.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
ref|XP_007442324.1|  PREDICTED: conserved oligomeric Golgi comple...  61.2    2e-07    
gb|ETN63528.1|  hypothetical protein AND_004755                       61.2    2e-07    
gb|KFU93333.1|  Conserved oligomeric Golgi complex subunit 7          60.8    2e-07    
ref|XP_009248828.1|  PREDICTED: conserved oligomeric Golgi comple...  58.5    2e-07    
ref|XP_002058398.1|  GJ14333                                          60.8    3e-07    
ref|XP_008312851.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    3e-07    
ref|XP_011372750.1|  PREDICTED: conserved oligomeric Golgi comple...  60.5    3e-07    
ref|XP_974190.1|  PREDICTED: conserved oligomeric Golgi complex s...  60.5    4e-07    
gb|KFZ67320.1|  Conserved oligomeric Golgi complex subunit 7          60.5    4e-07    
gb|KFP88492.1|  Conserved oligomeric Golgi complex subunit 7          60.5    4e-07    
ref|XP_009867466.1|  PREDICTED: conserved oligomeric Golgi comple...  60.1    4e-07    
ref|XP_009565762.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  60.1    5e-07    
ref|XP_004176695.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  60.1    5e-07    
ref|XP_009839113.1|  hypothetical protein H257_13328                  59.7    7e-07    
ref|XP_006268482.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  59.7    7e-07    
ref|XP_009839112.1|  hypothetical protein, variant                    59.7    8e-07    
ref|XP_003761800.1|  PREDICTED: conserved oligomeric Golgi comple...  59.3    8e-07    
ref|XP_001955508.1|  GF16218                                          59.3    9e-07    
ref|XP_010214546.1|  PREDICTED: LOW QUALITY PROTEIN: conserved ol...  59.3    9e-07    
gb|KGL78321.1|  Conserved oligomeric Golgi complex subunit 7          58.9    1e-06    
ref|XP_005494576.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06    
ref|XP_005188405.1|  PREDICTED: conserved oligomeric Golgi comple...  58.2    2e-06    
ref|XP_002128341.1|  PREDICTED: conserved oligomeric Golgi comple...  57.8    3e-06    
gb|EHJ78638.1|  putative component of oligomeric golgi complex 7      57.4    4e-06    
ref|XP_008619063.1|  hypothetical protein SDRG_14692                  57.0    6e-06    
ref|XP_002073360.1|  GK14089                                          56.6    7e-06    
ref|XP_005656828.1|  PREDICTED: conserved oligomeric Golgi comple...  56.6    7e-06    
gb|EXX54575.1|  hypothetical protein RirG_233350                      55.8    1e-05    
dbj|BAE37211.1|  unnamed protein product                              55.5    2e-05    
ref|XP_004778380.1|  PREDICTED: conserved oligomeric Golgi comple...  55.5    2e-05    
gb|KIJ18193.1|  hypothetical protein PAXINDRAFT_32237                 55.1    2e-05    
gb|EAW55831.1|  component of oligomeric golgi complex 7, isoform ...  55.1    3e-05    
ref|XP_005591518.1|  PREDICTED: conserved oligomeric Golgi comple...  54.7    3e-05    
ref|XP_005709389.1|  hypothetical protein Gasu_02200                  54.7    3e-05    
gb|KFB52038.1|  AGAP004439-PA-like protein                            54.3    4e-05    
ref|XP_004900784.1|  PREDICTED: conserved oligomeric Golgi comple...  54.3    4e-05    
gb|KFD70340.1|  hypothetical protein M514_06928                       54.3    5e-05    
ref|XP_003737280.1|  PREDICTED: conserved oligomeric Golgi comple...  53.9    6e-05    
ref|XP_005054657.1|  PREDICTED: conserved oligomeric Golgi comple...  53.5    7e-05    
dbj|GAA52089.1|  conserved oligomeric Golgi complex subunit 7         52.4    2e-04    
ref|XP_010145231.1|  PREDICTED: conserved oligomeric Golgi comple...  52.0    2e-04    
gb|ETM01828.1|  hypothetical protein L917_01620                       52.0    3e-04    
gb|ETP53379.1|  hypothetical protein F442_01707                       52.0    3e-04    
ref|XP_009167964.1|  hypothetical protein T265_13613                  52.0    3e-04    
gb|ETO84308.1|  hypothetical protein F444_01769                       52.0    3e-04    
ref|XP_008899170.1|  hypothetical protein PPTG_06874                  52.0    3e-04    
gb|ETP25398.1|  hypothetical protein F441_01729                       51.6    3e-04    
gb|KIK29353.1|  hypothetical protein PISMIDRAFT_27259                 51.6    3e-04    
gb|ETK95383.1|  hypothetical protein L915_01681                       51.2    5e-04    
gb|ETL48771.1|  hypothetical protein L916_01656                       51.2    5e-04    
ref|XP_005782152.1|  component of oligomeric Golgi complex 7          50.4    6e-04    
ref|XP_004351649.1|  hypothetical protein ACA1_397180                 50.1    0.001    
gb|ELU44402.1|  COG7 domain-containing protein                        50.1    0.001    



>ref|XP_006357255.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Solanum tuberosum]
 gb|AIU51134.1| embryo yellow protein, partial [Solanum tuberosum]
Length=835

 Score =   347 bits (890),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/181 (89%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISK+RQHFNDLSRLPIWSS+EEHS RPLPTFSAYPQSYVT VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKIRQHFNDLSRLPIWSSIEEHSLRPLPTFSAYPQSYVTGVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  715  QLEPLVESISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P  LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMRR+SL
Sbjct  775  EYLSNVLSALSMPIPTCLATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMRRISL  834

Query  204  E  202
            E
Sbjct  835  E  835



>ref|XP_009786961.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
sylvestris]
Length=834

 Score =   345 bits (884),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ F DLSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQQFIDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  714  QLEPLVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  773

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P VLATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMRR+SL
Sbjct  774  EYLSNVLSALSMPIPTVLATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMRRISL  833

Query  204  E  202
            E
Sbjct  834  E  834



>ref|XP_004238762.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solanum 
lycopersicum]
 gb|AIU51145.1| embryo yellow protein, partial [Solanum lycopersicum]
Length=835

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISK+RQ FNDLSRLPIWSSVEEHS RPLPTFS+YPQSYVT VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKIRQQFNDLSRLPIWSSVEEHSLRPLPTFSSYPQSYVTGVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  715  QLEPLVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P  LATF +C STP+ QLK+L+KSDSGNQLDLPTANLVCKMRR+SL
Sbjct  775  EYLSNVLSALSMPIPTCLATFQTCFSTPKDQLKDLIKSDSGNQLDLPTANLVCKMRRISL  834

Query  204  E  202
            E
Sbjct  835  E  835



>gb|KDP22425.1| hypothetical protein JCGZ_26256 [Jatropha curcas]
Length=832

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  652  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQ  711

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQLSVDI
Sbjct  712  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYVTDRGAQQLSVDI  771

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFH+C STPR QLK LVKSD+GNQLD+PTANLVCK+RRVSL
Sbjct  772  EYLSNVLSALSMPIPPILATFHTCFSTPRDQLKHLVKSDAGNQLDIPTANLVCKIRRVSL  831

Query  204  E  202
            +
Sbjct  832  D  832



>ref|XP_009625424.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nicotiana 
tomentosiformis]
Length=835

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            V+ELVYDVLISKVRQ F  LSRLPIWSSVEEHSARPLPTFSAYPQSYVT VGEYLLTLPQ
Sbjct  655  VSELVYDVLISKVRQQFIGLSRLPIWSSVEEHSARPLPTFSAYPQSYVTGVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL E ISNSD NADEAQYFATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  715  QLEPLVENISNSDPNADEAQYFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P VLATF +C STP++QLK+L+K+DSGNQLDLPTANLVCKMRR+SL
Sbjct  775  EYLSNVLSALSMPIPTVLATFQTCFSTPKNQLKDLIKTDSGNQLDLPTANLVCKMRRISL  834

Query  204  E  202
            E
Sbjct  835  E  835



>ref|XP_008234406.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Prunus 
mume]
Length=839

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDI
Sbjct  719  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++L
Sbjct  779  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNL  838

Query  204  E  202
            E
Sbjct  839  E  839



>gb|AIU51136.1| embryo yellow protein, partial [Prunus persica]
Length=838

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDI
Sbjct  718  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++L
Sbjct  778  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNL  837

Query  204  E  202
            E
Sbjct  838  E  838



>ref|XP_007218916.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
 gb|EMJ20115.1| hypothetical protein PRUPE_ppa001391mg [Prunus persica]
Length=839

 Score =   338 bits (868),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG+QQLSVDI
Sbjct  719  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSQQLSVDI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCKMRR++L
Sbjct  779  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKMRRLNL  838

Query  204  E  202
            E
Sbjct  839  E  839



>ref|XP_010089680.1| hypothetical protein L484_001268 [Morus notabilis]
 gb|EXC36303.1| hypothetical protein L484_001268 [Morus notabilis]
Length=833

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+S LPIWS+VEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  653  VNELVYDVLISKVRQRLSDVSHLPIWSAVEEQSAFPLPSFSAYPQAYVTSVGEYLLTLPQ  712

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISN+DAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  713  QLEPLAEGISNNDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLST R +LKELVKSDSGNQLDLPTANLVCKMRRVSL
Sbjct  773  EYLSNVLSALSMPIPPVLATFHTCLSTSRDELKELVKSDSGNQLDLPTANLVCKMRRVSL  832

Query  204  E  202
            +
Sbjct  833  D  833



>gb|AIU51140.1| embryo yellow protein, partial [Ricinus communis]
Length=831

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVR   ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRLRLNDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQLSVDI
Sbjct  711  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQLSVDI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RRVSL
Sbjct  771  EYLSNVLSALSMPIPPILATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIRRVSL  830

Query  204  E  202
            +
Sbjct  831  D  831



>ref|XP_002510953.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51555.1| conserved hypothetical protein [Ricinus communis]
Length=832

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVR   ND+SRLPIWSSVEE SA PLP FSAYPQSYVT+VGEYLLTLPQ
Sbjct  652  VNELVYDVLISKVRLRLNDVSRLPIWSSVEEQSAFPLPIFSAYPQSYVTSVGEYLLTLPQ  711

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITDRGAQQLSVDI
Sbjct  712  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGASALYMEQLRGIQYITDRGAQQLSVDI  771

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RRVSL
Sbjct  772  EYLSNVLSALSMPIPPILATFHTCLSTPRDQLKYLVKSDAGNQLDLPTANLVCKIRRVSL  831

Query  204  E  202
            +
Sbjct  832  D  832



>ref|XP_011033997.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
 ref|XP_011010844.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Populus euphratica]
Length=831

 Score =   337 bits (863),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRQRLSDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLA+GISN+DAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  711  QLEPLADGISNNDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+RRVSL
Sbjct  771  EYLSNVLSALSMPIPPILATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIRRVSL  830

Query  204  E  202
            +
Sbjct  831  D  831



>ref|XP_011076371.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sesamum 
indicum]
Length=838

 Score =   336 bits (862),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/181 (88%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLI KVRQHF+DLSRLPIWSSVEE SA P+P+FSAYPQSYVTNVGEYLLTLPQ
Sbjct  658  VNELVYDVLILKVRQHFSDLSRLPIWSSVEEPSAFPVPSFSAYPQSYVTNVGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDANA+EAQ+FATEWMFKVAEGATALY++QLRGI  ITDRGAQQLSVDI
Sbjct  718  QLEPLAEGISNSDANAEEAQFFATEWMFKVAEGATALYIEQLRGIHKITDRGAQQLSVDI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVL+TFH+C STP  QLK+LVKSDSGNQLDLPTANLVCKMR V L
Sbjct  778  EYLSNVLSALSMPIPPVLSTFHTCFSTPTDQLKDLVKSDSGNQLDLPTANLVCKMRGVRL  837

Query  204  E  202
            +
Sbjct  838  D  838



>gb|AIU51131.1| embryo yellow protein, partial [Manihot esculenta]
Length=833

 Score =   336 bits (862),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSS+EE  A PLPTFSAYPQSYV++VGEYLLTLPQ
Sbjct  653  VNELVYDVLISKVRQRLSDVSRLPIWSSIEEQGAFPLPTFSAYPQSYVSSVGEYLLTLPQ  712

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SD N DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQL+VDI
Sbjct  713  QLEPLAEGISSSDVNNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLAVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK LVKSD+GNQLDLPTANLVCK+RR+SL
Sbjct  773  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKHLVKSDAGNQLDLPTANLVCKIRRISL  832

Query  204  E  202
            +
Sbjct  833  D  833



>ref|XP_002304412.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|EEE79391.2| conserved oligomeric Golgi complex component-related family protein 
[Populus trichocarpa]
 gb|AIU51135.1| embryo yellow protein, partial [Populus trichocarpa]
Length=831

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 174/181 (96%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWS+V+EHS+  LPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRQRLSDVSRLPIWSAVDEHSSFRLPTFSAYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLA+GISN+DAN +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  711  QLEPLADGISNNDANNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFH+CLSTPR QLK+LVKSDSGNQLDL TANLVCK+RRVSL
Sbjct  771  EYLSNVLSALSMPIPPILATFHTCLSTPRDQLKQLVKSDSGNQLDLSTANLVCKIRRVSL  830

Query  204  E  202
            +
Sbjct  831  D  831



>ref|XP_002267657.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vitis 
vinifera]
 emb|CBI24597.3| unnamed protein product [Vitis vinifera]
 gb|AIU51148.1| embryo yellow protein, partial [Vitis vinifera]
Length=838

 Score =   335 bits (858),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWS+VEE SA PLP+F+AYPQ+YVT+VGEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLSDVSRLPIWSAVEEPSAFPLPSFNAYPQAYVTSVGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SD NADEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DI
Sbjct  718  QLEPLAEGISSSDPNADEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFHSCLSTPR QLK+ VKSD+GNQLDLPTANLVCK+RRV L
Sbjct  778  EYLSNVLSALSMPIPPILATFHSCLSTPRDQLKDFVKSDAGNQLDLPTANLVCKIRRVGL  837

Query  204  E  202
            E
Sbjct  838  E  838



>ref|XP_009372929.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=651

 Score =   329 bits (843),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 1/178 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ F+D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  471  VNELVYDVLISKVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYLLTLPQ  530

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL EGISNSDAN DEAQ FATEWMFKVAEGATALY +QLRGIQYITDRGAQQLSVDI
Sbjct  531  QLEPLVEGISNSDANNDEAQIFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLSVDI  590

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCKMRR+
Sbjct  591  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKMRRL  647



>gb|KHG21476.1| Conserved oligomeric Golgi complex subunit 7 [Gossypium arboreum]
Length=420

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLLTLPQ
Sbjct  240  VNELVYDVLISKVRQRLSEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLLTLPQ  299

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDI
Sbjct  300  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQLSVDI  359

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+RR++L
Sbjct  360  EYLSNVLSALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIRRLNL  419

Query  204  E  202
            +
Sbjct  420  D  420



>ref|XP_007038383.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
 gb|EOY22884.1| Oligomeric Golgi complex component-related / COG complex component-related 
[Theobroma cacao]
Length=832

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRQRLSDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDA+ +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  711  QLEPLAEGISNSDASNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+RRV+L
Sbjct  771  EYLSNVLSALSMPIPPVLATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVNL  830

Query  204  E  202
            +
Sbjct  831  D  831



>gb|AIU51110.1| embryo yellow protein, partial [Theobroma cacao]
Length=831

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRQRLSDVSRLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDA+ +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  711  QLEPLAEGISNSDASNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +C  TPR QLK+L+KSDSGNQLDLPTANLVCK+RRV+L
Sbjct  771  EYLSNVLSALSMPIPPVLATFQTCFGTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVNL  830

Query  204  E  202
            +
Sbjct  831  D  831



>ref|XP_004307803.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Fragaria 
vesca subsp. vesca]
Length=832

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S   LPTFSA PQSYVTNVGEYLLTLPQ
Sbjct  652  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSVYHLPTFSASPQSYVTNVGEYLLTLPQ  711

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI+NSDAN +EAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  712  QLEPLAEGIANSDANNEEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  771

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVL+TFH+CLSTPR QL++L+KSDSGNQLDLPTANL+CKMRRV +
Sbjct  772  EYLSNVLSALSMPIPPVLSTFHTCLSTPRDQLRDLIKSDSGNQLDLPTANLICKMRRVII  831

Query  204  E  202
            +
Sbjct  832  D  832



>emb|CDP05334.1| unnamed protein product [Coffea canephora]
Length=845

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 173/182 (95%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ FNDLSRLP+WSSV+E SA PLP+FS+YPQSYVTNVGEYLLTLPQ
Sbjct  664  VNELVYDVLISKVRQQFNDLSRLPVWSSVDEPSAFPLPSFSSYPQSYVTNVGEYLLTLPQ  723

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SD NADEAQ+FATEWMFKVAEGA+ LY++QLRGIQY+TDRGAQQL+ DI
Sbjct  724  QLEPLAEGISSSDTNADEAQFFATEWMFKVAEGASTLYMEQLRGIQYVTDRGAQQLAADI  783

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK-SDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PPVLATF +CLSTPR QLK+LVK SDSGNQLDLPTANLVCKMRR+S
Sbjct  784  EYLSNVLSALSMPIPPVLATFQTCLSTPREQLKDLVKSSDSGNQLDLPTANLVCKMRRLS  843

Query  207  LE  202
            L+
Sbjct  844  LD  845



>ref|XP_003534367.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Glycine max]
Length=834

 Score =   332 bits (851),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDI
Sbjct  714  QLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L
Sbjct  773  EYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>gb|KHN11738.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   332 bits (851),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDI
Sbjct  714  QLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L
Sbjct  773  EYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>gb|AIU51119.1| embryo yellow protein, partial [Glycine max]
Length=833

 Score =   332 bits (851),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDI
Sbjct  714  QLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLDLPTANLVCKMRRV+L
Sbjct  773  EYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDLPTANLVCKMRRVNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>ref|XP_007131467.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
 gb|ESW03461.1| hypothetical protein PHAVU_011G016000g [Phaseolus vulgaris]
Length=834

 Score =   332 bits (850),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS+AN DEAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDI
Sbjct  714  QLEPLAEGISNSEAN-DEAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L
Sbjct  773  EYLSNVLSALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>gb|AIU51138.1| embryo yellow protein, partial [Phaseolus vulgaris]
Length=833

 Score =   332 bits (850),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSEVSRLPIWSSVEEQGGYPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS+AN DEAQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDI
Sbjct  714  QLEPLAEGISNSEAN-DEAQFFATEWMFKVAEGATALYIDQLRGIQYISDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF SCLS+PR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L
Sbjct  773  EYLSNVLSALSMPIPPVLATFQSCLSSPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>ref|XP_008376080.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Malus domestica]
Length=838

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  719  QLEPLAEGISNSDANNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+RR+SL
Sbjct  779  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIRRLSL  837

Query  204  E  202
            +
Sbjct  838  D  838



>ref|XP_009340575.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   330 bits (847),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  718  QLEPLAEGISNSDANNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLK+LVKSD+GN LDLPTANLVCK+RR+SL
Sbjct  778  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKDLVKSDAGN-LDLPTANLVCKIRRLSL  836

Query  204  E  202
            +
Sbjct  837  D  837



>gb|AIU51115.1| embryo yellow protein, partial [Carica papaya]
Length=839

 Score =   330 bits (847),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D++ LPIWS+VEE SA PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVAHLPIWSAVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSD N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDI
Sbjct  719  QLEPLAEGISNSDINSDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDHGAQQLSVDI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMPVPPVLATF +CLST R QLK+L+K+DSGNQLDLPTANLVCK+RRVSL
Sbjct  779  EYLSNVLSALSMPVPPVLATFQTCLSTQRDQLKDLIKADSGNQLDLPTANLVCKIRRVSL  838

Query  204  E  202
            +
Sbjct  839  D  839



>gb|AIU51125.1| embryo yellow protein, partial [Chimonanthus praecox]
Length=828

 Score =   330 bits (845),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVR   +D+SRLPIWSSVEE SA  LP+FSAYPQSYVT+VGEYLLTLPQ
Sbjct  650  VNELVYDVLISKVRHRLSDVSRLPIWSSVEEASAFHLPSFSAYPQSYVTSVGEYLLTLPQ  709

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQLS DI
Sbjct  710  QLEPLAEGISNSDANTDEAQFFATEWMFKVAEGATALYIEQLRGIQYMTDRGAQQLSADI  769

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QL++L+KSD GNQLDLPTANLVCK+RRV+
Sbjct  770  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLRDLLKSDGGNQLDLPTANLVCKIRRVN  828



>gb|KHN46499.1| Conserved oligomeric Golgi complex subunit 7 [Glycine soja]
Length=834

 Score =   329 bits (844),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  + PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGSFPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISN++ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVDI
Sbjct  714  QLEPLAEGISNNEVN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYISDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF SCLSTPR+QLK+L+K+DSGNQLD+PTANLVCKMRRV+L
Sbjct  773  EYLSNVLSALSMPIPPVLATFQSCLSTPRNQLKDLLKTDSGNQLDMPTANLVCKMRRVNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>ref|XP_009374477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Pyrus x bretschneideri]
Length=837

 Score =   328 bits (842),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAYHLPTFSAYPQAYVTSIGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSD N DEAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  718  QLEPLAEGISNSDVNNDEAQIFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSVDI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+CLSTPR QLKELV+SD+GN LDLPTANLVCK+RR+SL
Sbjct  778  EYLSNVLSALSMPIPPVLATFHTCLSTPRDQLKELVQSDAGN-LDLPTANLVCKIRRLSL  836

Query  204  E  202
            +
Sbjct  837  D  837



>gb|AIU51152.1| embryo yellow protein, partial [Platanus x acerifolia]
Length=839

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEPSAFPLPSFSAYPQSYVTSVGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGA QLS DI
Sbjct  719  QLEPLAEGISSSDANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGALQLSADI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P VLATFH+CLSTPR QL++L+KSD+GNQLDLPTA+LVCK+RRV+L
Sbjct  779  EYLSNVLSALSMPIPQVLATFHTCLSTPRDQLRDLLKSDAGNQLDLPTAHLVCKIRRVTL  838

Query  204  E  202
            +
Sbjct  839  D  839



>gb|EYU24953.1| hypothetical protein MIMGU_mgv1a001327mg [Erythranthe guttata]
 gb|AIU51132.1| embryo yellow protein, partial [Erythranthe guttata]
Length=839

 Score =   327 bits (837),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLI KVRQHFN+LSRLP+WSSVEE SA P+P+FSAYPQ YVTNVGEYLLTLPQ
Sbjct  659  VNELVYDVLILKVRQHFNELSRLPVWSSVEETSAHPVPSFSAYPQPYVTNVGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS+ANA+EAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQLSVDI
Sbjct  719  QLEPLAEGISNSEANAEEAQFFATEWMFKVAEGATALYIEQLRGIQKITDRGAQQLSVDI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP P VL+TFH+C STP  QLKE+VKSDSGNQLD+PTANLVCKMR + L
Sbjct  779  EYLSNVLSALSMPTPLVLSTFHTCSSTPTDQLKEIVKSDSGNQLDIPTANLVCKMRGLRL  838

Query  204  E  202
            +
Sbjct  839  D  839



>gb|AIU51106.1| embryo yellow protein, partial [Magnolia denudata]
Length=829

 Score =   325 bits (833),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SR+PIWSSVEE +A PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRQRLSDVSRMPIWSSVEEPTAFPLPSFSAYPQAYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SD N DEAQ+FATEWMFKVAEGAT LY++QLRGIQYITDRGAQQLS DI
Sbjct  711  QLEPLAEGISSSDPNTDEAQFFATEWMFKVAEGATTLYMEQLRGIQYITDRGAQQLSADI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP+LATFH+CLSTPR QL++LVKSD+GNQLDLPTA+LVCK+RRV+
Sbjct  771  EYLSNVLSALSMPIPPILATFHTCLSTPRDQLRDLVKSDAGNQLDLPTAHLVCKIRRVT  829



>ref|XP_006490119.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Citrus sinensis]
Length=835

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQ
Sbjct  656  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQ  715

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDI
Sbjct  716  QLEPLAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALS+P+PP LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+RRVSL
Sbjct  775  EYLSNVLSALSVPIPPALATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVSL  834

Query  204  E  202
            +
Sbjct  835  D  835



>gb|KDO65493.1| hypothetical protein CISIN_1g003266mg [Citrus sinensis]
 gb|AIU51117.1| embryo yellow protein, partial [Citrus sinensis]
Length=835

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQ
Sbjct  656  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQ  715

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDI
Sbjct  716  QLEPLAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALS+P+PP LATFH+CLSTPR QLK+L+KSDSGNQLDLPTANLVCK+RRVSL
Sbjct  775  EYLSNVLSALSVPIPPALATFHTCLSTPRDQLKDLLKSDSGNQLDLPTANLVCKIRRVSL  834

Query  204  E  202
            +
Sbjct  835  D  835



>gb|AIU51123.1| embryo yellow protein, partial [Chloranthus japonicus]
Length=567

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND+SRLPIWSS +E SA PLP+FSAYPQ YVT+VGEYLLTLPQ
Sbjct  390  VNELVYDVLISKVRQRLNDVSRLPIWSSFDEPSAFPLPSFSAYPQPYVTSVGEYLLTLPQ  449

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYIT+RGAQQLS DI
Sbjct  450  QLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITERGAQQLSADI  509

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYLSNVLSALSMP+PP+LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+RRV
Sbjct  510  EYLSNVLSALSMPMPPILATFHTCLSTQRDQLHDLVKSDGGNQLDLPTAHLVCKIRRV  567



>gb|AIU51111.1| embryo yellow protein, partial [Acorus calamus]
Length=827

 Score =   324 bits (830),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE +ARPLP+FSAYPQ YVT+VGEYLLTLPQ
Sbjct  649  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEPTARPLPSFSAYPQPYVTSVGEYLLTLPQ  708

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQLS DI
Sbjct  709  QLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLSTDI  768

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+P +LATF +CLSTP  QL+EL+KSDS NQLDLPTANLVCK+RRVS
Sbjct  769  EYLSNVLSALSMPIPQILATFQTCLSTPNDQLRELLKSDSANQLDLPTANLVCKIRRVS  827



>gb|AIU51151.1| embryo yellow protein, partial [Cinnamomum camphora]
Length=838

 Score =   324 bits (831),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 171/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D++RLPIWSSVEE SA  LP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLSDVARLPIWSSVEEASAFHLPSFSAYPQAYVTSVGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGI YITDRGAQQLS DI
Sbjct  718  QLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIHYITDRGAQQLSTDI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPV+ATFH+CLSTPR QL++LVKSDSG+QLDLP ANLVCK+RRV+L
Sbjct  778  EYLSNVLSALSMPIPPVMATFHTCLSTPRDQLRDLVKSDSGSQLDLPIANLVCKIRRVNL  837

Query  204  E  202
            +
Sbjct  838  D  838



>gb|AIU51126.1| embryo yellow protein, partial [Pandanus utilis]
Length=477

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLLTLPQ
Sbjct  299  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLLTLPQ  358

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+A +DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DI
Sbjct  359  QLEPLAEGISSSEAGSDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADI  418

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP L+T+H+CLSTPR QL++L+KSD   QLDLPTA+LVCK+RR++
Sbjct  419  EYLSNVLSALSMPIPPFLSTYHTCLSTPRDQLRDLLKSDGATQLDLPTAHLVCKIRRIA  477



>gb|AIU51147.1| embryo yellow protein, partial [Schrenkiella parvula]
Length=831

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ   D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDILISKVRQRLGDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISN D+N ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQLSVDI
Sbjct  711  QLEPLAEGISNGDSNNEDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQLSVDI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S 
Sbjct  771  EYLSNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRISF  830

Query  204  E  202
            +
Sbjct  831  D  831



>gb|AIU51114.1| embryo yellow protein, partial [Gossypium raimondii]
 gb|KJB51433.1| hypothetical protein B456_008G216000 [Gossypium raimondii]
Length=830

 Score =   322 bits (824),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SR+PIWS+ EE SA  LPTFSAYPQ YVT+VGEYLLTLPQ
Sbjct  650  VNELVYDVLISKVRQRLSEVSRMPIWSAAEEQSAFRLPTFSAYPQPYVTSVGEYLLTLPQ  709

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNSDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITD GAQQLSVDI
Sbjct  710  QLEPLAEGISNSDANNDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDGGAQQLSVDI  769

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +CL TPR QLK+L+KSD+GNQLDLPTANLVCK+RR++L
Sbjct  770  EYLSNVLSALSMPIPPVLATFQTCLGTPRDQLKDLLKSDNGNQLDLPTANLVCKIRRLNL  829

Query  204  E  202
            +
Sbjct  830  D  830



>ref|XP_006421663.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|ESR34903.1| hypothetical protein CICLE_v10004313mg [Citrus clementina]
 gb|AIU51113.1| embryo yellow protein, partial [Citrus clementina]
Length=835

 Score =   322 bits (824),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQ
Sbjct  656  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQ  715

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS SD N DEAQ+FATEWMFKVAEGA+ALY++QLRGIQYITD GAQQLSVDI
Sbjct  716  QLEPLAEGISTSDNN-DEAQFFATEWMFKVAEGASALYMEQLRGIQYITDHGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALS+P+PP LATFH+CLSTPR QLK+ +KSDSGNQLDLPTANLVCK+RRVSL
Sbjct  775  EYLSNVLSALSVPIPPALATFHTCLSTPRDQLKDQLKSDSGNQLDLPTANLVCKIRRVSL  834

Query  204  E  202
            +
Sbjct  835  D  835



>emb|CDY00472.1| BnaA10g08010D [Brassica napus]
Length=234

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 166/182 (91%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLLTLPQ
Sbjct  53   VNELVYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLLTLPQ  112

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VD
Sbjct  113  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVD  172

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G +LD PTANLVCKMRR+S
Sbjct  173  IEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGRELDFPTANLVCKMRRIS  232

Query  207  LE  202
             +
Sbjct  233  FD  234



>gb|AIU51103.1| embryo yellow protein, partial [Arabidopsis lyrata]
Length=835

 Score =   321 bits (822),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDI
Sbjct  715  QLEPLAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMRR+S 
Sbjct  775  EYLSNVLSALSMPIPPVLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMRRISF  834

Query  204  E  202
            +
Sbjct  835  D  835



>gb|AIU51121.1| embryo yellow protein, partial [Buxus sinica]
Length=839

 Score =   321 bits (822),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 170/181 (94%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWS VEE SA PLP+FSAYPQSYVT+VGEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVSRLPIWSLVEEPSAFPLPSFSAYPQSYVTSVGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SDAN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRG++QLS DI
Sbjct  719  QLEPLAEGISSSDANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGSKQLSADI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P  LATFH+CLSTPR QL++LVKSD G+QLDLPTA+LVCK+RR++L
Sbjct  779  EYLSNVLSALSMPIPSTLATFHTCLSTPRDQLRDLVKSDQGSQLDLPTAHLVCKIRRINL  838

Query  204  E  202
            +
Sbjct  839  D  839



>gb|KEH17632.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=834

 Score =   320 bits (821),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE  A  LPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQGAFHLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  714  QLEPLAEGISSSEAN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            +YLSNVLSALSMP+P VLATFHSCLST R QLK+L+K+DS NQLDLPTANLVCKMR+++L
Sbjct  773  DYLSNVLSALSMPIPAVLATFHSCLSTSRDQLKDLLKTDSANQLDLPTANLVCKMRQLNL  832

Query  204  E  202
            +
Sbjct  833  D  833



>ref|XP_010692941.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Beta 
vulgaris subsp. vulgaris]
Length=836

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +DLSR+PIWSS EE SA  LP+FSAYPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLSDLSRMPIWSSAEETSAFHLPSFSAYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+ DAN DEAQ+FATEWMFKVAEGATA+Y++QLRGIQYITDRGAQQLSVDI
Sbjct  715  QLEPLAEGISSDDANTDEAQFFATEWMFKVAEGATAIYIEQLRGIQYITDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALS+P+PP+L+TF +CLSTPR QL++L+KSDSG QLDL TANL+CKMRR++L
Sbjct  775  EYLANVLSALSVPIPPILSTFQTCLSTPRDQLRDLIKSDSGTQLDLSTANLICKMRRLNL  834

Query  204  E  202
            +
Sbjct  835  D  835



>gb|AIU51104.1| embryo yellow protein, partial [Arabidopsis thaliana]
Length=835

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDI
Sbjct  715  QLEPLAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S 
Sbjct  775  EYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRISF  834

Query  204  E  202
            +
Sbjct  835  D  835



>ref|XP_010062289.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Eucalyptus grandis]
Length=722

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLLTLPQ
Sbjct  542  VNELVYDVLISKVRQRLYDVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLLTLPQ  601

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+ DA+ DEAQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQLSVDI
Sbjct  602  QLEPLAEGISSGDASNDEAQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQLSVDI  661

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMPVP VLATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMRRVSL
Sbjct  662  EYLSNVLSALSMPVPAVLATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMRRVSL  721

Query  204  E  202
            +
Sbjct  722  D  722



>ref|XP_004506344.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cicer arietinum]
Length=835

 Score =   319 bits (818),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 170/182 (93%), Gaps = 2/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLPTFSAYPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFPLPTFSAYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+ N DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLSVDI
Sbjct  714  QLEPLAEGISSSETN-DEAQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSVDI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS-DSGNQLDLPTANLVCKMRRVS  208
            +YLSNVLSALSMP+P VLATF SCLST R QLK+L+K+ DS NQLDLPTANLVCKMRRV+
Sbjct  773  DYLSNVLSALSMPIPAVLATFQSCLSTSRDQLKDLLKTPDSANQLDLPTANLVCKMRRVN  832

Query  207  LE  202
            L+
Sbjct  833  LD  834



>gb|AIU51116.1| embryo yellow protein, partial [Capsella rubella]
Length=835

 Score =   319 bits (817),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI+N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVDI
Sbjct  715  QLEPLAEGITNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVDI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATF +CL+TPR QLK+++KS++G++LD PTANLVCKMRR+S 
Sbjct  775  EYLSNVLSALSMPIPPVLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMRRISF  834

Query  204  E  202
            +
Sbjct  835  D  835



>gb|AIU51108.1| embryo yellow protein, partial [Pinellia ternata]
Length=829

 Score =   318 bits (815),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND++RLPIWSSVEE SA PLPTFSAYPQSYVT++GEYLLTLPQ
Sbjct  651  VNELVYDVLISKVRQRLNDVARLPIWSSVEEQSAHPLPTFSAYPQSYVTSIGEYLLTLPQ  710

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+  A+EAQ FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DI
Sbjct  711  QLEPLAEGISSSEPGAEEAQLFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADI  770

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP LATFH+C+STPR QL E +KSD G+QLDLPTA+LVC++RR++
Sbjct  771  EYLSNVLSALSMPIPPFLATFHTCVSTPRDQLPEQIKSDGGSQLDLPTAHLVCRIRRIT  829



>ref|XP_010062284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Eucalyptus grandis]
 gb|KCW90838.1| hypothetical protein EUGRSUZ_A02893 [Eucalyptus grandis]
 gb|AIU51118.1| embryo yellow protein, partial [Eucalyptus grandis]
Length=838

 Score =   318 bits (815),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   D+SRLP+WSSVEE SA  LPTFS+YPQ YVT++GEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLYDVSRLPVWSSVEEPSAFHLPTFSSYPQPYVTSIGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+ DA+ DEAQ+FATEWMFKVAEGATAL+++QLRGIQY+TDRGAQQLSVDI
Sbjct  718  QLEPLAEGISSGDASNDEAQFFATEWMFKVAEGATALFMEQLRGIQYMTDRGAQQLSVDI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMPVP VLATF +C STPR QLK+LVKSD+ NQLDLPTANLVCKMRRVSL
Sbjct  778  EYLSNVLSALSMPVPAVLATFQTCFSTPRDQLKDLVKSDAANQLDLPTANLVCKMRRVSL  837

Query  204  E  202
            +
Sbjct  838  D  838



>ref|XP_006401980.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
 gb|ESQ43433.1| hypothetical protein EUTSA_v10012691mg [Eutrema salsugineum]
Length=832

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ   D+SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  651  VNELVYDILISKVRQRLGDVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  710

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYVDQLRGIQYI+DRGAQQLSVD
Sbjct  711  QLEPLAEGISSNGDSNNEDAQFFATEWMFKVAEGATALYVDQLRGIQYISDRGAQQLSVD  770

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  771  IEYLSNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  830

Query  207  LE  202
             +
Sbjct  831  FD  832



>ref|XP_002865861.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42120.1| hypothetical protein ARALYDRAFT_495214 [Arabidopsis lyrata subsp. 
lyrata]
Length=836

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR  LK+L+KS++GN+LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPIPPVLATFQTCLATPRDDLKDLMKSEAGNELDFPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>gb|AIU51112.1| embryo yellow protein, partial [Sarcandra glabra]
Length=836

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSS++E SA PLP+FSAYPQ YVT+VGEYLLTLPQ
Sbjct  659  VNELVYDVLISKVRQRLSDVSRLPIWSSIDEPSAFPLPSFSAYPQPYVTSVGEYLLTLPQ  718

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+AN DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DI
Sbjct  719  QLEPLAEGISSSEANTDEAQFFATEWMFKVAEGATALYMEQLRGIQYITDRGAQQLSADI  778

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYLSNVLSALSMP+PP+LATFH+CLST R QL++LVKS+  NQLDLPTA+LVCK+RRV
Sbjct  779  EYLSNVLSALSMPIPPILATFHTCLSTQRDQLRDLVKSEGSNQLDLPTAHLVCKIRRV  836



>ref|NP_199956.1| COG7-like protein EYE [Arabidopsis thaliana]
 dbj|BAB09754.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96080.1| COG complex component-related protein [Arabidopsis thaliana]
Length=836

 Score =   317 bits (811),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>gb|AIU51128.1| embryo yellow protein, partial [Aristolochia tagala]
Length=834

 Score =   316 bits (810),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQSYVT+VGEYLLTLPQ
Sbjct  656  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEPSAHPLPSFSAYPQSYVTSVGEYLLTLPQ  715

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI++ ++N DEAQ+FATEWMFKVAEGATALY +QLRGIQYITDRGAQQL+ DI
Sbjct  716  QLEPLAEGIASRESNTDEAQFFATEWMFKVAEGATALYTEQLRGIQYITDRGAQQLAADI  775

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALS+P+P VLATF +CLSTPR QL++LVKSD GNQLDLPTANL+CK+RR++
Sbjct  776  EYLSNVLSALSVPIPQVLATFLTCLSTPREQLRDLVKSDGGNQLDLPTANLICKIRRIA  834



>dbj|BAF00649.1| hypothetical protein [Arabidopsis thaliana]
Length=836

 Score =   316 bits (810),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>ref|XP_008439087.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cucumis 
melo]
Length=834

 Score =   316 bits (810),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDI
Sbjct  714  QLEPLAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDI  773

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSM +PP L+TF +C STPR QLK+L+KSDSG +LDLPTANLVCKMRRV+L
Sbjct  774  EYLTNVLSALSMEIPPALSTFLTCFSTPREQLKDLLKSDSGRELDLPTANLVCKMRRVNL  833

Query  204  E  202
            +
Sbjct  834  D  834



>ref|XP_004165037.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
Length=834

 Score =   316 bits (809),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDI
Sbjct  714  QLEPLAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDI  773

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSM +PP LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMRRV+L
Sbjct  774  EYLTNVLSALSMEIPPALATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMRRVNL  833

Query  204  E  202
            +
Sbjct  834  D  834



>ref|XP_004148143.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Cucumis sativus]
 gb|KGN57266.1| hypothetical protein Csa_3G175670 [Cucumis sativus]
Length=834

 Score =   316 bits (809),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEEHSA PLPTFS+YPQSYVT+VGEYLLTLPQ
Sbjct  654  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEHSALPLPTFSSYPQSYVTSVGEYLLTLPQ  713

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS+AN DEAQ+FA EWM KVAEG  ALY +QLRGIQ++TDRGAQQLSVDI
Sbjct  714  QLEPLAEGISNSNANNDEAQFFAAEWMCKVAEGTAALYTEQLRGIQHVTDRGAQQLSVDI  773

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSM +PP LATF +CLST R QLK+L+KSDSG +LDLPTANLVCKMRRV+L
Sbjct  774  EYLTNVLSALSMEIPPALATFLTCLSTSREQLKDLLKSDSGRELDLPTANLVCKMRRVNL  833

Query  204  E  202
            +
Sbjct  834  D  834



>ref|XP_006280007.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
 gb|EOA12905.1| hypothetical protein CARUB_v10025880mg [Capsella rubella]
Length=836

 Score =   315 bits (808),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR QLK+++KS++G++LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPIPPVLATFQTCLATPRDQLKDVMKSEAGSELDFPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>ref|XP_010443240.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   315 bits (807),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>ref|XP_010934963.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elaeis 
guineensis]
Length=824

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT++GEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLNDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSIGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+A  +EAQ+FA+EWMFKVAEGATAL+++QLRGIQYITDRGAQQLS DI
Sbjct  704  QLEPLAEGISSSEAGTEEAQFFASEWMFKVAEGATALFMEQLRGIQYITDRGAQQLSADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++L
Sbjct  764  EYLSNVLSALSMPIPPFLTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIAL  822

Query  204  E  202
            +
Sbjct  823  D  823



>ref|XP_010482477.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=836

 Score =   315 bits (807),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>ref|XP_003618191.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74409.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=828

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLLTLPQ
Sbjct  648  VNELVYDVLISKVRQCLSDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLLTLPQ  707

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS  +AN DEAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQLSVDI
Sbjct  708  QLEPLAEGISTGEAN-DEAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQLSVDI  766

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            +YLSNVLSALSMP+P VL TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMRRV+L
Sbjct  767  DYLSNVLSALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNL  826

Query  204  E  202
            +
Sbjct  827  D  827



>gb|AIU51129.1| embryo yellow protein, partial [Medicago truncatula]
Length=827

 Score =   315 bits (806),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 165/181 (91%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LP FSAYPQSYVT+VGEYLLTLPQ
Sbjct  648  VNELVYDVLISKVRQCLSDVSRLPIWSSVEEQSAFHLPAFSAYPQSYVTSVGEYLLTLPQ  707

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS  +AN DEAQ+FATEWMFK+AEGAT LY++QLRGIQYITDRGAQQLSVDI
Sbjct  708  QLEPLAEGISTGEAN-DEAQFFATEWMFKIAEGATTLYIEQLRGIQYITDRGAQQLSVDI  766

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            +YLSNVLSALSMP+P VL TFHSCLST R QLK+L+K+DS N LDLPTANLVCKMRRV+L
Sbjct  767  DYLSNVLSALSMPIPAVLTTFHSCLSTSRDQLKDLLKTDSANHLDLPTANLVCKMRRVNL  826

Query  204  E  202
            +
Sbjct  827  D  827



>ref|XP_006838140.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
 gb|ERN00709.1| hypothetical protein AMTR_s00106p00086320 [Amborella trichopoda]
Length=827

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+++LP+WSSVEE  +  +P+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  647  VNELVYDVLISKVRQRLSDVAKLPVWSSVEETVSHKMPSFSAYPQAYVTSVGEYLLTLPQ  706

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGISNS++NADE+Q+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DI
Sbjct  707  QLEPLAEGISNSESNADESQFFATEWMFKVAEGATALYIEQLRGIQYITDRGAQQLSADI  766

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMPV P L+TFH+CL T R QL++LVKSD GNQLDLPTA L+CKMRRVSL
Sbjct  767  EYLSNVLSALSMPVAPFLSTFHTCLLTQRDQLRDLVKSDGGNQLDLPTARLLCKMRRVSL  826

Query  204  E  202
            +
Sbjct  827  D  827



>dbj|BAG15881.1| conserved oligomeric Golgi complex component 7-related [Arabidopsis 
thaliana]
Length=836

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++GN+LD PTA+LVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPIPPVLATFQTCLATPRGELKDVMKSEAGNELDCPTASLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>ref|NP_001132532.1| uncharacterized protein LOC100193995 [Zea mays]
 gb|ACF81411.1| unknown [Zea mays]
Length=344

 Score =   300 bits (768),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  164  VNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  223

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DI
Sbjct  224  QLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADI  283

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++L
Sbjct  284  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRITL  343

Query  204  E  202
            +
Sbjct  344  D  344



>ref|XP_008796946.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Phoenix 
dactylifera]
Length=824

 Score =   313 bits (802),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLNDVSRMPIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+A  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGAQQLS DI
Sbjct  704  QLEPLAEGISSSEAGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGAQQLSADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+P  L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++L
Sbjct  764  EYLSNVLSALSMPIPAFLTTFHTCLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIAL  822

Query  204  E  202
            +
Sbjct  823  D  823



>gb|AIU51105.1| embryo yellow protein, partial [Lilium brownii]
Length=450

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  273  VNELVYDVLISKVRQRLSEVSRLPIWSSVEEPSSLPLPSFSAYPQAYVTSVGEYLLTLPQ  332

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+ NA+EAQ+FATEWMFKVAEGAT L+++QLRGI YIT+RGAQQLS DI
Sbjct  333  QLEPLAEGISSSENNAEEAQFFATEWMFKVAEGATDLFMEQLRGIHYITERGAQQLSADI  392

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYL+NVLSALSMP+PP L TFH+CLSTPR Q +EL+K+D G+QLD PTA+LVCK+RR+
Sbjct  393  EYLTNVLSALSMPIPPFLTTFHTCLSTPRDQFRELLKADGGSQLDQPTAHLVCKIRRL  450



>ref|XP_010264264.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nelumbo 
nucifera]
Length=839

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  658  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEPSAFPLPSFSAYPQTYVTSVGEYLLTLPQ  717

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SDANADEAQ+FATEWMFKVAEGA A+Y +QLRGIQYITDRGAQQLS DI
Sbjct  718  QLEPLAEGISSSDANADEAQFFATEWMFKVAEGAVAIYTEQLRGIQYITDRGAQQLSADI  777

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMPVP VL+TFH+ LST R ++++L+KSD+ +QLDLPTA+LVCKMRRV+L
Sbjct  778  EYLSNVLSALSMPVPQVLSTFHTFLSTSRDKIQDLLKSDAVSQLDLPTAHLVCKMRRVTL  837

Query  204  E  202
            +
Sbjct  838  D  838



>gb|AIU51143.1| embryo yellow protein, partial [Yucca filamentosa]
Length=822

 Score =   312 bits (799),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SR+P+WSSVEE SA PLP+FSAYPQ+Y+T+VGEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLSDVSRMPVWSSVEEPSALPLPSFSAYPQAYITSVGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+SD   DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DI
Sbjct  704  QLEPLAEGISSSDGGTDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP L+T+H+CLSTPR QL++L+KS++G+QLD+PTA+LVCK+RR++
Sbjct  764  EYLSNVLSALSMPIPPFLSTYHTCLSTPRDQLQDLIKSEAGSQLDIPTAHLVCKIRRIA  822



>gb|KFK26748.1| hypothetical protein AALP_AA8G288200 [Arabis alpina]
Length=836

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   D+S LPIWSSVEE +A PLP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRQRLGDVSHLPIWSSVEEQTAFPLPNFSSYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQLSVD
Sbjct  715  QLEPLAEGISSNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLSVD  774

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  775  IEYLSNVLSALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  834

Query  207  LE  202
             +
Sbjct  835  FD  836



>ref|XP_006657236.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Oryza brachyantha]
Length=824

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLNEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS S+A  +EAQ+FATEW+FKVAEGATAL+ +QLRGI YITDRGAQQL+ DI
Sbjct  704  QLEPLAEGISGSEAGNEEAQFFATEWIFKVAEGATALFTEQLRGIHYITDRGAQQLAADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP LATFH+C+STPR Q++EL+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  764  EYLSNVLSALSMPIPPFLATFHTCISTPRDQVRELIKSDGGSQLDLPTAHLVCKIRRIS  822



>ref|XP_010442640.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Camelina sativa]
Length=681

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQSYVT+VGEYLLTLPQ
Sbjct  500  VNELVYDVLISKVRQRLGEVSRLPIWSSVEEQTAFSLPNFSSYPQSYVTSVGEYLLTLPQ  559

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY+DQLRGIQYI+DRGAQQLSVD
Sbjct  560  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMDQLRGIQYISDRGAQQLSVD  619

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMPVPPVLATF +CL+TPR +LK+++KS++G++LD  TANLVCKMRR+S
Sbjct  620  IEYLSNVLSALSMPVPPVLATFQTCLATPRDELKDVMKSEAGSELDFHTANLVCKMRRIS  679

Query  207  LE  202
             +
Sbjct  680  FD  681



>gb|AIU51154.1| embryo yellow protein, partial [Houttuynia cordata]
Length=833

 Score =   311 bits (796),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVR   ND+S+LPIWS+VEE SA PLP+FSAYPQ YVT++GEYLLTLPQ
Sbjct  655  VNELVYDVLISKVRHRLNDVSQLPIWSAVEEPSAFPLPSFSAYPQLYVTSIGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS++D+N+DEAQ+FATEWMFKVAEGATALY++QLRGIQYITDRGAQQLS DI
Sbjct  715  QLEPLAEGISSNDSNSDEAQFFATEWMFKVAEGATALYLEQLRGIQYITDRGAQQLSADI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALS P+P  LATFH+CLST R QL +LVKSD GNQLDLPTA+LVCK+RR++
Sbjct  775  EYLSNVLSALSTPIPLALATFHTCLSTARDQLHDLVKSDGGNQLDLPTAHLVCKIRRIT  833



>gb|AIU51127.1| embryo yellow protein, partial [Asparagus officinalis]
Length=822

 Score =   310 bits (794),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND+SR+PIWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLNDVSRMPIWSSVEEQSALPLPSFSAYPQAYVTSVGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS++D   DEAQ+FATEWMFKVAEGATAL+++QLRGI YITDRGAQQLS DI
Sbjct  704  QLEPLAEGISSNDGGTDEAQFFATEWMFKVAEGATALFMEQLRGIHYITDRGAQQLSADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVL ALSMP+PP L+T+H+CLS PR QL++L+KS+ G+QLD+PTA+LVCK+RR++
Sbjct  764  EYLSNVLFALSMPIPPFLSTYHTCLSKPRDQLRDLIKSEPGSQLDVPTAHLVCKIRRIA  822



>ref|XP_003563389.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Brachypodium 
distachyon]
Length=825

 Score =   310 bits (794),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  645  VNELVYDVLISKVRQRLSEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  704

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  705  QLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  764

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+RR+ L
Sbjct  765  EYLNNVLSALSMPIPPFLSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIRRIPL  824

Query  204  E  202
            E
Sbjct  825  E  825



>gb|EMT03910.1| hypothetical protein F775_26031 [Aegilops tauschii]
Length=697

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  517  VNELVYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  576

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  577  QLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  636

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+RR+SL
Sbjct  637  EYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSDGGAQLDLPTAHLVSKIRRISL  696

Query  204  E  202
            E
Sbjct  697  E  697



>ref|XP_010536539.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Tarenaya 
hassleriana]
Length=837

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   D+S +PIWS+ EE +A PLPTFS+YPQSYVT+VGEYLLTLPQ
Sbjct  656  VNELVYDVLISKVRQRLGDVSHMPIWSAAEEQTAFPLPTFSSYPQSYVTSVGEYLLTLPQ  715

Query  564  QLEPLAEGISN-SDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGISN SDAN ++AQ+FATEWMFKVAEGATALY++QLRGIQ+ +DRGAQQLSVD
Sbjct  716  QLEPLAEGISNNSDANNEDAQFFATEWMFKVAEGATALYMEQLRGIQHASDRGAQQLSVD  775

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVLSALSMP+PPVLATF +CL+T R QLK+L++S++ NQLDLPTANLVCKMRRVS
Sbjct  776  IEYLSNVLSALSMPIPPVLATFQTCLATSREQLKDLMRSEAANQLDLPTANLVCKMRRVS  835

Query  207  LE  202
             +
Sbjct  836  FD  837



>ref|XP_009127310.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Brassica rapa]
Length=829

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVYD+LISKVRQ   ++SRLPIWSS EE SA PLP+FS+YPQSYVT+VGEYLLTLPQ
Sbjct  648  VNKLVYDILISKVRQRLGEVSRLPIWSSSEEQSAFPLPSFSSYPQSYVTSVGEYLLTLPQ  707

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQLSVD
Sbjct  708  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQLSVD  767

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  768  IEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  827

Query  207  LE  202
             +
Sbjct  828  FD  829



>gb|EMS57916.1| hypothetical protein TRIUR3_24838 [Triticum urartu]
Length=706

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ   +++RLPIWSSVEE    PLP+FSAYPQSYVT+VGEYLLTLPQ
Sbjct  526  VNELVYDVLISKVRQRLCEIARLPIWSSVEEQGGLPLPSFSAYPQSYVTSVGEYLLTLPQ  585

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  586  QLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  645

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G QLDLPTA+LV K+RR+SL
Sbjct  646  EYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSDGGTQLDLPTAHLVSKIRRISL  705

Query  204  E  202
            E
Sbjct  706  E  706



>gb|AIU51109.1| embryo yellow protein, partial [Brachypodium distachyon]
Length=784

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +++SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  607  VNELVYDVLISKVRQRLSEISRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  666

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  667  QLEPLAEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  726

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTANLVCK+RR+
Sbjct  727  EYLNNVLSALSMPIPPFLSTFHTCISTPRDQVRGLIKSDGGSQLDLPTANLVCKIRRI  784



>gb|EEE66191.1| hypothetical protein OsJ_22310 [Oryza sativa Japonica Group]
Length=790

 Score =   308 bits (788),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  609  VNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  668

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  669  QLEPLAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  728

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  729  EYLSNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  787



>gb|AIU51142.1| embryo yellow protein, partial [Dioscorea oppositifolia]
Length=831

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +DLSRLPIWSSVEE SA PLP+FSAYPQ YVT+VGEYLLTLPQ
Sbjct  653  VNELVYDVLISKVRQRLSDLSRLPIWSSVEEQSALPLPSFSAYPQPYVTSVGEYLLTLPQ  712

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQLS DI
Sbjct  713  QLEPLAEGISSSETGTDEAQFFATEWVFKVAEGATALFMEQLRGIHYITDRGAQQLSADI  772

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP L+TFH+CLSTPR Q+++L+K D+ +QLDLPTA+LVCK+RR++
Sbjct  773  EYLSNVLSALSMPIPPFLSTFHTCLSTPRDQVRDLLKLDAASQLDLPTAHLVCKIRRIA  831



>gb|AIU51130.1| embryo yellow protein, partial [Canna indica]
Length=815

 Score =   308 bits (788),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  637  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQ  696

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS S+A  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYITDRGA QLS DI
Sbjct  697  QLEPLAEGISGSEAGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYITDRGALQLSADI  756

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYL+NVLSALSM +PP L TFH+C+STPR QL +L+KSD GNQLD+PTA+LVCK+RR++
Sbjct  757  EYLNNVLSALSMTIPPFLMTFHTCISTPREQLPDLIKSDGGNQLDIPTAHLVCKIRRIT  815



>gb|EEC81147.1| hypothetical protein OsI_24056 [Oryza sativa Indica Group]
Length=825

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  704  QLEPLAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  764  EYLSNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  822



>gb|AIU51102.1| embryo yellow protein, partial [Aquilegia coerulea]
Length=835

 Score =   307 bits (787),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVYDVLISKVRQ  +D++RLPIWS +EE S   LP+FS YPQSYVT+VGEYLLTLPQ
Sbjct  655  VNDLVYDVLISKVRQRLSDVARLPIWSKIEEPSTFALPSFSVYPQSYVTSVGEYLLTLPQ  714

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            Q EPLAEGIS  D+N DEAQ+ ATEWMFKVAEGA  LY +QLRGI YIT+RGAQQLS DI
Sbjct  715  QFEPLAEGISGGDSNTDEAQFLATEWMFKVAEGAAVLYTEQLRGIHYITERGAQQLSADI  774

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PPVLATFH+C STPR QL ELVKSD GN+LDLPTANLVCK+RRV+L
Sbjct  775  EYLSNVLSALSMPIPPVLATFHTCFSTPREQLPELVKSDGGNELDLPTANLVCKIRRVAL  834

Query  204  E  202
            +
Sbjct  835  D  835



>ref|XP_009399332.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Musa 
acuminata subsp. malaccensis]
Length=818

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  637  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQ  696

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S++  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQLS DI
Sbjct  697  QLEPLAEGISSSESGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQLSADI  756

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSM +PP LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+RR+ L
Sbjct  757  EYLSNVLSALSMAIPPFLATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIRRIPL  816

Query  204  E  202
            +
Sbjct  817  D  817



>gb|AIU51157.1| embryo yellow protein, partial [Trachycarpus fortunei]
Length=821

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND+SR+ IWSSVEE SA PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  644  VNELVYDVLISKVRQRLNDVSRMSIWSSVEEPSALPLPSFSAYPQAYVTSVGEYLLTLPQ  703

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S+A  +EAQ+FATEWMFKV EGATAL+++QLRGIQYITDRGA QLS DI
Sbjct  704  QLEPLAEGISSSEAGTEEAQFFATEWMFKVVEGATALFMEQLRGIQYITDRGALQLSADI  763

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP L TFH+CLSTPR Q+++L+KSD GNQLDLPTA+LVCK+RR++
Sbjct  764  EYLSNVLSALSMPIPPFLTTFHACLSTPRDQIRDLLKSD-GNQLDLPTAHLVCKIRRIA  821



>dbj|BAD45448.1| oligomeric golgi complex 7-like [Oryza sativa Japonica Group]
Length=873

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  692  VNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  751

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS  +A  +EAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  752  QLEPLAEGISGGEAGNEEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  811

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMP+PP LATFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  812  EYLSNVLSALSMPIPPFLATFHTCISTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIS  870



>gb|AIU51107.1| embryo yellow protein, partial [Musa acuminata]
Length=814

 Score =   305 bits (782),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/178 (79%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE S+ PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  637  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSSLPLPSFSAYPQAYVTSVGEYLLTLPQ  696

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS+S++  +EAQ+FATEWMFKVAEGATAL+++QLRGIQYI+DRGAQQLS DI
Sbjct  697  QLEPLAEGISSSESGTEEAQFFATEWMFKVAEGATALFMEQLRGIQYISDRGAQQLSADI  756

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYLSNVLSALSM +PP LATFH+CL+TPR QL   +KSD G+QLD+PTA+LVCK+RR+
Sbjct  757  EYLSNVLSALSMAIPPFLATFHTCLATPRDQLPAFLKSDGGSQLDIPTAHLVCKIRRI  814



>ref|XP_002438832.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
 gb|EER90199.1| hypothetical protein SORBIDRAFT_10g026850 [Sorghum bicolor]
Length=820

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DI
Sbjct  700  QLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR++L
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRITL  819

Query  204  E  202
            +
Sbjct  820  D  820



>emb|CDX99921.1| BnaC09g27840D [Brassica napus]
Length=641

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 166/182 (91%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VGEYLLTLPQ
Sbjct  460  VNELVYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGEYLLTLPQ  519

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VD
Sbjct  520  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVD  579

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD  TANLVCKMRR+S
Sbjct  580  IEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFLTANLVCKMRRIS  639

Query  207  LE  202
             +
Sbjct  640  FD  641



>gb|AIU51137.1| embryo yellow protein, partial [Panicum virgatum]
Length=818

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  700  QLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRIS  818



>ref|XP_009107451.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7-like [Brassica rapa]
Length=831

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 166/182 (91%), Gaps = 1/182 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ   ++SRLPIWSSVEE +A  LP FS+YPQ+YVT+VG YLLTLPQ
Sbjct  650  VNELVYDILISKVRQRLGEVSRLPIWSSVEEQTAFALPNFSSYPQAYVTSVGXYLLTLPQ  709

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            QLEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VD
Sbjct  710  QLEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVD  769

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKMRR+S
Sbjct  770  IEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKMRRIS  829

Query  207  LE  202
             +
Sbjct  830  FD  831



>dbj|BAJ94393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  643  VNELVYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  702

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL EGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  703  QLEPLTEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  762

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+RR+SL
Sbjct  763  EYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIRRISL  822

Query  204  E  202
            E
Sbjct  823  E  823



>dbj|BAJ95800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=823

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  643  VNELVYDVLISKVRQRLSEIARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  702

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL EGIS S+A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  703  QLEPLTEGISGSEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  762

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KS+ G QLDLPTA+LV K+RR+SL
Sbjct  763  EYLNNVLSALSMPIPPFLSTFHACISTPRDQVRDLIKSEGGTQLDLPTAHLVSKIRRISL  822

Query  204  E  202
            E
Sbjct  823  E  823



>gb|AIU51146.1| embryo yellow protein, partial [Sorghum bicolor]
Length=818

 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DI
Sbjct  700  QLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD G+QLDLPTA+LVCK+RR++
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGGSQLDLPTAHLVCKIRRIT  818



>gb|AIU51153.1| embryo yellow protein, partial [Ginkgo biloba]
Length=816

 Score =   302 bits (773),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVY+VLI K+R   +D+SR+ IW+SVEE +A  LP+FSAYPQ YVT++GEYLLTLPQ
Sbjct  636  VNELVYEVLILKIRHRLSDVSRMAIWTSVEEDNAFSLPSFSAYPQPYVTSIGEYLLTLPQ  695

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL  G+SN+DA ADEAQ+FATEWMFKVAEGATALY++QLRGIQ ITDRGAQQLS DI
Sbjct  696  QLEPLTTGLSNADATADEAQFFATEWMFKVAEGATALYIEQLRGIQSITDRGAQQLSADI  755

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL NVLSALSMP PPVLATFHSCL+T R QL+ELVKSD+G+QLDLPTA LVCK+R V+L
Sbjct  756  EYLCNVLSALSMPTPPVLATFHSCLATSREQLRELVKSDAGSQLDLPTARLVCKIRHVTL  815

Query  204  E  202
            E
Sbjct  816  E  816



>gb|AIU51149.1| embryo yellow protein, partial [Lactuca sativa]
Length=827

 Score =   302 bits (773),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVR+  N +S LPIWSSVEE +   LP+FSAY QSY+T VGEYLLTLPQ
Sbjct  648  VNELVYDVLISKVRKQLNGVSNLPIWSSVEEQTTFHLPSFSAYAQSYITTVGEYLLTLPQ  707

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAE ISN+DANA+EAQ+FATEWMFKVAEGA  L+++QLRGIQYIT+RGAQQLSVDI
Sbjct  708  QLEPLAETISNNDANAEEAQFFATEWMFKVAEGAAGLFMEQLRGIQYITERGAQQLSVDI  767

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+LATFH+CLSTPR QLK+++K+D    LD+PTANLVCKMRRVSL
Sbjct  768  EYLSNVLSALSMPIPPILATFHTCLSTPRDQLKDVMKNDL-ESLDVPTANLVCKMRRVSL  826

Query  204  E  202
            E
Sbjct  827  E  827



>ref|XP_008658135.1| PREDICTED: uncharacterized protein LOC100193995 isoform X1 [Zea 
mays]
 gb|AFW87715.1| hypothetical protein ZEAMMB73_766806 [Zea mays]
Length=820

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DI
Sbjct  700  QLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++L
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRITL  819

Query  204  E  202
            +
Sbjct  820  D  820



>ref|XP_004966309.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Setaria italica]
Length=820

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVYDVLISKVR   ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNDLVYDVLISKVRMRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  700  QLEPLAEGISGNETGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+SL
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRISL  819

Query  204  E  202
            +
Sbjct  820  D  820



>gb|AIU51155.1| embryo yellow protein, partial [Zea mays]
Length=818

 Score =   299 bits (766),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNELVYDVLISKVRQRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++A  DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRG+QQL+ DI
Sbjct  700  QLEPLAEGISGNEAGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGSQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q+++L+KSD  +QLDLPT +LVCK+RR++
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRDLIKSDGASQLDLPTTHLVCKIRRIT  818



>gb|AIU51144.1| embryo yellow protein, partial [Setaria italica]
Length=818

 Score =   299 bits (765),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVYDVLISKVR   ++++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  640  VNDLVYDVLISKVRMRLSEVARLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  699

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS ++   DEAQ+FATEW+FKVAEGATAL+++QLRGI YITDRGAQQL+ DI
Sbjct  700  QLEPLAEGISGNETGNDEAQFFATEWIFKVAEGATALFMEQLRGIHYITDRGAQQLAADI  759

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYL+NVLSALSMP+PP L+TFH+C+STPR Q++ L+KSD G+QLDLPTA+LVCK+RR+S
Sbjct  760  EYLNNVLSALSMPIPPFLSTFHACVSTPRDQVRGLIKSDGGSQLDLPTAHLVCKIRRIS  818



>gb|AIU51124.1| embryo yellow protein, partial [Ceratophyllum demersum]
Length=813

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVY VLISKVRQ   ++SRLPIWSSVEE +A PLPTFS+YPQ YVT+VGEYLLTLPQ
Sbjct  635  VNDLVYAVLISKVRQRLKEVSRLPIWSSVEEPTAFPLPTFSSYPQPYVTSVGEYLLTLPQ  694

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI  ++ NADE+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQLSVDI
Sbjct  695  QLEPLAEGILTNETNADESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQLSVDI  754

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMPVP  LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R+V+
Sbjct  755  EYLSNVLSALSMPVPQPLATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIRQVT  813



>gb|AIU51156.1| embryo yellow protein, partial [Alisma plantago-aquatica]
Length=823

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVYDVLI+KVRQ  +D+SRLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  647  VNDLVYDVLIAKVRQRLSDVSRLPIWSSVEEQGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  706

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGIS +D   ++AQ+FATEWMFKVAEGATALY++QLRGIQY+TDRGAQQL+ DI
Sbjct  707  QLEPLAEGISGADTATEDAQFFATEWMFKVAEGATALYMEQLRGIQYLTDRGAQQLAADI  766

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            EYLSNVLSALSMP+PP L T+H+C++TPR +L++L+KS++ +QLDLPTA+LVCK+RR+
Sbjct  767  EYLSNVLSALSMPIPPFLVTYHNCVATPRDELRDLLKSEN-HQLDLPTAHLVCKIRRL  823



>gb|AIU51150.1| embryo yellow protein, partial [Ceratophyllum platyacanthum subsp. 
oryzetorum]
Length=813

 Score =   291 bits (746),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVY VLISKVRQ   ++SRL IW+SVEE +A PLPTFS+YPQ YVT+VGEYLLTLPQ
Sbjct  635  VNDLVYAVLISKVRQRLKEVSRLSIWTSVEEPTAFPLPTFSSYPQPYVTSVGEYLLTLPQ  694

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPLAEGI  ++ NADE+QYFATEWMFKVAEGAT LY++QLRGIQ+ITD GAQQLSVDI
Sbjct  695  QLEPLAEGILTNETNADESQYFATEWMFKVAEGATNLYLEQLRGIQHITDHGAQQLSVDI  754

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            EYLSNVLSALSMPVP  LATFH C+ST R +L++L+KSDSGNQLD+PTA+L+CK+R+V+
Sbjct  755  EYLSNVLSALSMPVPQPLATFHICMSTSRDKLRDLIKSDSGNQLDIPTAHLICKIRQVT  813



>ref|XP_003618197.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES74415.1| oligomeric component-related/COG complex component [Medicago 
truncatula]
Length=755

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 1/163 (1%)
 Frame = -1

Query  690  DLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADE  511
            D+SRL IWSSVEE +A  LPTFSAYPQSYVT+VGEYLLTLPQQLEPLAEG+S+S+AN DE
Sbjct  593  DVSRLSIWSSVEEQTAFRLPTFSAYPQSYVTSVGEYLLTLPQQLEPLAEGVSSSEAN-DE  651

Query  510  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  331
            AQ+FATEWMFKVAEGAT LY++QLRG+QYITDRGAQQLSVDI+YLSNVLSALSMP+P VL
Sbjct  652  AQFFATEWMFKVAEGATTLYIEQLRGVQYITDRGAQQLSVDIDYLSNVLSALSMPIPAVL  711

Query  330  ATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  202
            ATFHSCLST R QLK+LVK+DS NQLDLPTANLVCKMRRV+L+
Sbjct  712  ATFHSCLSTSRDQLKDLVKTDSANQLDLPTANLVCKMRRVNLD  754



>gb|AIU51158.1| embryo yellow protein, partial [Cabomba caroliniana]
Length=804

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVY+VLISKVRQ  ++++++PIWSS+EE S  P+P+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  624  VNELVYEVLISKVRQRLSNVAQMPIWSSIEEQSGFPIPSFSAYPQAYVTSVGEYLLTLPQ  683

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLEPL   +S+ ++N DEAQ+FA EWMFKVAEGATALY++QLR IQ ITDRGAQQL+ DI
Sbjct  684  QLEPLGGTVSSGESNNDEAQFFAAEWMFKVAEGATALYIEQLRSIQSITDRGAQQLATDI  743

Query  384  EYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSL  205
            EYLSNVLSALSMP+PP+L TF +CLSTP  QL ELVKSD+G+QLDLP A LVCK+ RV+L
Sbjct  744  EYLSNVLSALSMPIPPILYTFQACLSTPADQLPELVKSDAGSQLDLPAARLVCKILRVNL  803

Query  204  E  202
            E
Sbjct  804  E  804



>gb|EPS73811.1| hypothetical protein M569_00940, partial [Genlisea aurea]
Length=838

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 157/189 (83%), Gaps = 10/189 (5%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSS--------VEEHSARPLPTFSAYPQSYVTNVG  589
            VN+LVYDVLI KVRQHF+DLSR P WSS         +E SA P+P+FSAYPQ YVTNVG
Sbjct  652  VNDLVYDVLILKVRQHFHDLSRQPTWSSSSSSSSSSTDEPSAHPVPSFSAYPQPYVTNVG  711

Query  588  EYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRG  409
            EYLLTLPQQLEPLAEGI+NS AN++EAQ+FATEWMFKVAEGATALYV+QLR IQ +TDRG
Sbjct  712  EYLLTLPQQLEPLAEGIANSHANSEEAQFFATEWMFKVAEGATALYVEQLRAIQKVTDRG  771

Query  408  AQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLV  229
            A+QLSVDIEYLSNVLSALSMP+P VL+TFH+C S    +L++LVK  S + LD+  ANLV
Sbjct  772  AEQLSVDIEYLSNVLSALSMPIPQVLSTFHACFSGSMDELRDLVK--SRDDLDVVAANLV  829

Query  228  CKMRRVSLE  202
            CKMR V L+
Sbjct  830  CKMRGVRLD  838



>ref|XP_002992562.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
 gb|EFJ06368.1| hypothetical protein SELMODRAFT_135591 [Selaginella moellendorffii]
Length=779

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            NELVY+VLISKVR    D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLLTLPQQ
Sbjct  598  NELVYEVLISKVRVRLADVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLLTLPQQ  657

Query  561  LEPLAEGISNSDANA---DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  391
            LEPL   ++ SD +    +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGAQQLS 
Sbjct  658  LEPLTSSMTTSDTSDDIDEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGAQQLSA  717

Query  390  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            DI+YL NVL+ALSM VP VL+TF  C+   R QL E  K   G  LD PT  LVCKMR+V
Sbjct  718  DIDYLCNVLTALSMNVPAVLSTFQQCVGATRDQLAEFAKG-VGPDLDGPTVRLVCKMRQV  776

Query  210  SLE  202
             +E
Sbjct  777  PVE  779



>ref|XP_002972505.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
 gb|EFJ26591.1| hypothetical protein SELMODRAFT_148467 [Selaginella moellendorffii]
Length=779

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            NELVY+VLISKVR    D++ +P+WS+ +E +   LP+FSAYP  YVT++GEYLLTLPQQ
Sbjct  598  NELVYEVLISKVRVRLADVASMPVWSAPQEDNPYALPSFSAYPLPYVTSIGEYLLTLPQQ  657

Query  561  LEPLAEGISNSDANA---DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  391
            LEPL   ++ SD +    +E QYFATEWMFKVAEGATALYVDQ+RGI+ + +RGAQQLS 
Sbjct  658  LEPLTSSMTTSDTSDDINEEGQYFATEWMFKVAEGATALYVDQIRGIRNLNERGAQQLSA  717

Query  390  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
            DI+YL NVL+ALSM VP VL+TF  C+   R QL E  K   G  LD PT  LVCKMR+V
Sbjct  718  DIDYLCNVLTALSMNVPAVLSTFQQCVGATREQLAEFTKG-VGPDLDGPTVRLVCKMRQV  776

Query  210  SLE  202
             +E
Sbjct  777  LVE  779



>emb|CDY56655.1| BnaA02g11250D [Brassica napus]
Length=788

 Score =   218 bits (555),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 129/182 (71%), Gaps = 43/182 (24%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ                                             
Sbjct  649  VNELVYDILISKVRQRLG------------------------------------------  666

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGIQYITDRGAQQLSVD
Sbjct  667  ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIQYITDRGAQQLSVD  726

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  727  IEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  786

Query  207  LE  202
             +
Sbjct  787  FD  788



>emb|CDY00475.1| BnaA10g07980D [Brassica napus]
Length=788

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 129/182 (71%), Gaps = 43/182 (24%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ                                             
Sbjct  649  VNELVYDILISKVRQRLG------------------------------------------  666

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALY++QLRGIQYI+DRGAQQL VD
Sbjct  667  ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYMEQLRGIQYISDRGAQQLCVD  726

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL+ALSMP+PPVLATF +CL+TPR +LK+++KSD+G++LD PTANLVCKMRR+S
Sbjct  727  IEYLSNVLAALSMPIPPVLATFQTCLATPRDELKDVMKSDAGSELDFPTANLVCKMRRIS  786

Query  207  LE  202
             +
Sbjct  787  FD  788



>emb|CDX91578.1| BnaC02g15820D [Brassica napus]
Length=801

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 129/182 (71%), Gaps = 43/182 (24%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYD+LISKVRQ                                             
Sbjct  649  VNELVYDILISKVRQRLG------------------------------------------  666

Query  564  QLEPLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVD  388
            +LEPLAEGIS N D+N ++AQ+FATEWMFKVAEGATALYV+QLRGI+YITDRGAQQLSVD
Sbjct  667  ELEPLAEGISTNGDSNNEDAQFFATEWMFKVAEGATALYVEQLRGIEYITDRGAQQLSVD  726

Query  387  IEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVS  208
            IEYLSNVL ALSMP+PPVLATF +CL+TPR +LK+++KS++G++LD PTANLVCKMRR+S
Sbjct  727  IEYLSNVLLALSMPIPPVLATFQTCLATPRDELKDVMKSEAGSELDFPTANLVCKMRRIS  786

Query  207  LE  202
             +
Sbjct  787  FD  788



>ref|XP_001770876.1| predicted protein [Physcomitrella patens]
 gb|EDQ64400.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 138/184 (75%), Gaps = 7/184 (4%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VN+LVY+VL+SKVR    D++R  +W+  EE +   LP FSAY   Y+T++GEYLLTLPQ
Sbjct  668  VNDLVYEVLMSKVRAKLADMAREAVWNQQEEQNLFSLPNFSAYASEYITSIGEYLLTLPQ  727

Query  564  QLEPLAEGISNSDA---NADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLS  394
            QL PLA G  N +     +D+AQYFATEWMFKVAEGATA Y +Q+RGIQ +++RGAQQLS
Sbjct  728  QLLPLA-GSGNPEGVEEGSDDAQYFATEWMFKVAEGATAAYTEQIRGIQALSERGAQQLS  786

Query  393  VDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRR  214
             DIEYL NVL+ALSM  PPVL TFH C+STPR++L E+V+ D    +D  T  LVCKMR+
Sbjct  787  ADIEYLCNVLNALSMSTPPVLHTFHVCVSTPRNKLFEVVEQDG---IDNATFRLVCKMRQ  843

Query  213  VSLE  202
            V LE
Sbjct  844  VKLE  847



>gb|AIU51139.1| embryo yellow protein, partial [Artemisia annua]
Length=98

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = -1

Query  498  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  319
            +TEWMFKVAEGA AL+++QLRGIQYITDRGAQQLSVDIEYLSNVLS LSMP+PP+LATFH
Sbjct  1    STEWMFKVAEGAAALFMEQLRGIQYITDRGAQQLSVDIEYLSNVLSVLSMPIPPILATFH  60

Query  318  SCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRVSLE  202
            +CLSTPR QLK+++K+DS   LDLPTANLVCKMRRVSLE
Sbjct  61   TCLSTPRDQLKDVIKTDS-ESLDLPTANLVCKMRRVSLE  98



>ref|XP_008376425.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Malus domestica]
Length=648

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ F+D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT++GEY+LTLPQ
Sbjct  530  VNELVYDVLISKVRQCFSDVSRLPIWSSVEEQSAYNLPTFSAYPQAYVTSIGEYILTLPQ  589

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEG  466
            QLEPL EG+SNSD N DEAQ FATEWMFKVAEG
Sbjct  590  QLEPLTEGVSNSDTNNDEAQIFATEWMFKVAEG  622



>ref|NP_001058323.2| Os06g0669600 [Oryza sativa Japonica Group]
 dbj|BAF20237.2| Os06g0669600, partial [Oryza sativa Japonica Group]
Length=160

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  N+++RLPIWSSVEE    PLP+FSAYPQ+YVT+VGEYLLTLPQ
Sbjct  32   VNELVYDVLISKVRQRLNEVARLPIWSSVEEPGGLPLPSFSAYPQAYVTSVGEYLLTLPQ  91

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKV  475
            QLEPLAEGIS  +A  +EAQ+FATEW+FKV
Sbjct  92   QLEPLAEGISGGEAGNEEAQFFATEWIFKV  121



>ref|XP_006491716.1| PREDICTED: uncharacterized protein LOC102619662 [Citrus sinensis]
Length=870

 Score =   157 bits (396),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 5/98 (5%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  +D+SRLPIWSSVEE SA  LPTFSAYPQ+YVT+VGEYLLTLPQ
Sbjct  362  VNELVYDVLISKVRQRLSDVSRLPIWSSVEEQSAFHLPTFSAYPQTYVTSVGEYLLTLPQ  421

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALY  451
            QLEPLAEGIS SD N DEAQ+FATEWMFKV    T+LY
Sbjct  422  QLEPLAEGISTSD-NNDEAQFFATEWMFKV----TSLY  454



>ref|XP_001418731.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97024.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=816

 Score =   131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 105/186 (56%), Gaps = 6/186 (3%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            + + VYD L+ +V      +S   +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ
Sbjct  627  LEKFVYDTLLGRVSLELKGISTSEVWSAKPAESAYKLPTFSAYPQERMTNAGEYLLSLPQ  686

Query  564  QLE-----PLAEGIS-NSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQ  403
             L+      LA   S + D+NA +    +  W+ K+AE +  L + ++R I  +TD+GA 
Sbjct  687  HLDNMHDDDLARATSLSGDSNAAQEPATSEAWIAKIAEASAELLLKEVRAIASLTDQGAA  746

Query  402  QLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCK  223
            QLS D+EY SN+++ALS+  P  L  ++ C S PR + ++  ++ +   +D+        
Sbjct  747  QLSADLEYFSNIVAALSLAPPSALIAWYKCASAPRDEYEDFARAATSEGIDVRVVRAAAA  806

Query  222  MRRVSL  205
             R + L
Sbjct  807  TRGIKL  812



>gb|AIU51120.1| embryo yellow protein, partial [Illicium henryi]
Length=720

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            VNELVYDVLISKVRQ  ND+SR+PIWSSVEE S  PLP+FSAYPQ YVT+VGEYLLTLPQ
Sbjct  652  VNELVYDVLISKVRQRLNDVSRMPIWSSVEETSGLPLPSFSAYPQPYVTSVGEYLLTLPQ  711

Query  564  QLEPLAEGI  538
            QLEPL+EGI
Sbjct  712  QLEPLSEGI  720



>ref|XP_003080398.1| conserved oligomeric Golgi complex component-related / COG complex 
component-related (ISS) [Ostreococcus tauri]
Length=396

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 103/184 (56%), Gaps = 6/184 (3%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            + + V+D L+ +V      +    +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ
Sbjct  211  LEKFVHDTLLGRVSLELKGIGASDVWSAKPTESAYKLPTFSAYPQERMTNAGEYLLSLPQ  270

Query  564  QLE-----PLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  400
             L+      +   +S SD +    Q  + +W+ K+AE +  L + +++ I  +T++GA Q
Sbjct  271  HLDGANDDDIPRTVSLSD-DVRSGQDTSEDWIAKIAEASAELLLKEVQSIGSLTEQGAAQ  329

Query  399  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  220
            L+VD+EY SN+++ALS   P  L+ ++ C+S PR +     +S +   +D      V   
Sbjct  330  LAVDLEYFSNIVAALSFDPPSALSAWYRCVSVPREEYDAFARSANAEGIDARIVRAVAAT  389

Query  219  RRVS  208
            R ++
Sbjct  390  RGIA  393



>emb|CEF98773.1| Conserved oligomeric Golgi complex subunit 7 [Ostreococcus tauri]
Length=786

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 103/184 (56%), Gaps = 6/184 (3%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            + + V+D L+ +V      +    +WS+    SA  LPTFSAYPQ  +TN GEYLL+LPQ
Sbjct  601  LEKFVHDTLLGRVSLELKGIGASDVWSAKPTESAYKLPTFSAYPQERMTNAGEYLLSLPQ  660

Query  564  QLE-----PLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQ  400
             L+      +   +S SD +    Q  + +W+ K+AE +  L + +++ I  +T++GA Q
Sbjct  661  HLDGANDDDIPRTVSLSD-DVRSGQDTSEDWIAKIAEASAELLLKEVQSIGSLTEQGAAQ  719

Query  399  LSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVCKM  220
            L+VD+EY SN+++ALS   P  L+ ++ C+S PR +     +S +   +D      V   
Sbjct  720  LAVDLEYFSNIVAALSFDPPSALSAWYRCVSVPREEYDAFARSANAEGIDARIVRAVAAT  779

Query  219  RRVS  208
            R ++
Sbjct  780  RGIA  783



>emb|CBI21190.3| unnamed protein product [Vitis vinifera]
Length=135

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  636  LPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATA  457
            LP+F+AYPQ+YVT+VGEYLLTLPQQLEPLAEGI +SD NADEAQ+FATEWMFKV     +
Sbjct  55   LPSFNAYPQAYVTSVGEYLLTLPQQLEPLAEGICSSDPNADEAQFFATEWMFKVTNLYCS  114

Query  456  LY  451
            L+
Sbjct  115  LH  116



>ref|XP_002503576.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64834.1| predicted protein [Micromonas sp. RCC299]
Length=770

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 102/191 (53%), Gaps = 13/191 (7%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
              + V DVL+SKVR  F  L++   WS+  E S   LPTFSAYPQ YVT  GEYLL+LPQ
Sbjct  581  ARDFVLDVLLSKVRSEFRGLAKRAEWSTSAESSDFDLPTFSAYPQGYVTTAGEYLLSLPQ  640

Query  564  QLEPLAEGISNSDANADE----------AQYF-ATEWMFKVAEGATALYVDQLRGIQYIT  418
             LE +A+      A A            A++F + EWM +VAE A  L + ++R I  + 
Sbjct  641  HLESIADAAEEERAAAAAAGEMGRAATAAEHFDSGEWMTRVAEAAAGLLLAEVRAITTLG  700

Query  417  DRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTA  238
            + GA QL+ D+EY +N++SAL    P  L T+  C +  R      V+   G   D+  A
Sbjct  701  EPGAAQLAADLEYFNNIISALFSEPPSALRTYAVCAAAARDSYAISVRDVEGMDEDVIRA  760

Query  237  NLVCKMRRVSL  205
              V K R + L
Sbjct  761  --VAKARGIKL  769



>ref|XP_007513783.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16308.1| predicted protein [Bathycoccus prasinos]
Length=978

 Score =   105 bits (261),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 55/154 (36%), Positives = 89/154 (58%), Gaps = 11/154 (7%)
 Frame = -1

Query  735  LVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  556
            LV D L+ +VR+   ++    IW+ +   +A  LPTFSAYPQ   TN GEYLL+LP +LE
Sbjct  775  LVRDFLLHRVRRELENIENEQIWTKMAAQTAHDLPTFSAYPQEKATNSGEYLLSLPTRLE  834

Query  555  PLAEGISNSDANA-----------DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRG  409
             L   + +   +A           DE +  A+ WM +VAE +  +++++++ I+ +++ G
Sbjct  835  ALVNVVGDDVGSAASASAGIFGNDDEDEDLASIWMERVAEASATIFLERVKSIRRLSEPG  894

Query  408  AQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLS  307
            A QL+ D+EY SNV++AL+      L  +  C S
Sbjct  895  AAQLAADLEYFSNVVTALTSRPQRGLLAYMQCAS  928



>ref|XP_003055554.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60806.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 68/187 (36%), Positives = 97/187 (52%), Gaps = 10/187 (5%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            N+ V DVL SKVR     +     W          LPTFSAYPQ Y+TN GEYLL+LP  
Sbjct  608  NQFVLDVLASKVRNELRGMRGRAEWGETRASGGLNLPTFSAYPQEYMTNAGEYLLSLPTT  667

Query  561  LEPLAEGISNSDANA-----DEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  397
            L+ +A   + + A       D  +  A EWM KVA  A +L + ++RGI  +TD GA QL
Sbjct  668  LDAIAGAGAVAGAAGPGGADDVPELDAGEWMAKVAAAAASLLLTEVRGISALTDLGAAQL  727

Query  396  SVDIEYLSNVLSALSM---PVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  226
            + D++Y  NV++ALS+   P    L  F +C +  R     ++ +  G+ +D     +V 
Sbjct  728  AADLDYFVNVIAALSLDDVPDAKKLRCFATCCAAARDAY--VMSTRDGDAVDEDIVKIVA  785

Query  225  KMRRVSL  205
              R + L
Sbjct  786  AARGIKL  792



>ref|XP_002731007.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Saccoglossus kowalevskii]
Length=259

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 97/193 (50%), Gaps = 21/193 (11%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHS--ARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++  +D++   ++    DLS + +WSSV   +  +  LP+FS  P  Y+T +G+YL+TLP
Sbjct  71   HKFAFDIVFCPLKVQLADLSTMEVWSSVGSGAVLSVDLPSFSLSPMEYITKIGQYLMTLP  130

Query  567  QQLEPLAEGISNSDANA--------------DEAQYFATEWMFKVAEGATALYVDQLRGI  430
            QQLE      + +   A               E      +W+  +A      YV+Q+  +
Sbjct  131  QQLESFTTQDNTALEKALQMGKLPFPDTQGEHEEDTVVDQWIGSIARATMHHYVEQILMV  190

Query  429  QYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLD  250
              +T +G +QLS DI+YL NVL AL +P    L++  + L TP +Q +E+     G+ ++
Sbjct  191  PQLTTQGTKQLSADIDYLCNVLDALGIPASTSLSSVDTLLKTPIAQYEEI-----GDDIE  245

Query  249  LPTANLVCKMRRV  211
                N V  MR +
Sbjct  246  ARLINAVVGMRSI  258



>ref|XP_005847546.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
 gb|EFN55444.1| hypothetical protein CHLNCDRAFT_133750 [Chlorella variabilis]
Length=753

 Score =   102 bits (253),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 76/138 (55%), Gaps = 6/138 (4%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            V   V +VL  + R     L RL  W   +   A  LPTFSAYP  YVT+VGEYL+ LPQ
Sbjct  572  VGSCVLEVLTQRPRAQLAGLPRLGEWQ--QRAGALLLPTFSAYPLQYVTSVGEYLMMLPQ  629

Query  564  QLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDI  385
            QLE    G    + N +EA     +W+ KVA    A Y  QL  +  +T +GA QL+ D+
Sbjct  630  QLESALLG----EDNGEEAGQLVGDWIDKVALDTAAHYQQQLAALPGLTAQGAAQLAADL  685

Query  384  EYLSNVLSALSMPVPPVL  331
            EY  NVL+ L + VPP L
Sbjct  686  EYFCNVLTTLGVAVPPSL  703



>ref|XP_001701937.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
 gb|EDP06912.1| component of oligomeric golgi complex 7 [Chlamydomonas reinhardtii]
Length=758

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 92/199 (46%), Gaps = 19/199 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLT  574
            V   V+DVL+++V      L  LP W    E   H A PLP+F+ YP  YVT +G++L+ 
Sbjct  552  VQSTVFDVLLARVASLLASLPVLPEWRKGAEGSAHPAAPLPSFNTYPLPYVTAIGDHLMA  611

Query  573  LPQQLEPLAEGISNSDANADEAQYFATEWMF--------------KVAEGATALYVDQLR  436
            +PQQLE L  G +  D +A  A   A                   K   GA A+Y D + 
Sbjct  612  MPQQLEVLM-GDTGDDTSATAAAGGADASGGGAAEWEELAAEWLDKAVSGAAAMYADAIF  670

Query  435  GIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSD-SGN  259
             I  +  +G  QL+ D+EY  NV+ AL +  PP L T          +  EL +   +  
Sbjct  671  KIGDLGQQGGCQLATDVEYFVNVMGALHVAPPPSLLTVQLLAGAAPEEFAELGRGALAEG  730

Query  258  QLDLPTANLVCKMRRVSLE  202
              D P    +  MRR++LE
Sbjct  731  AADGPALRALAGMRRIALE  749



>ref|XP_005643872.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19328.1| hypothetical protein COCSUDRAFT_67854 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 77/146 (53%), Gaps = 17/146 (12%)
 Frame = -1

Query  735  LVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR-------PLPTFSAYPQSYVTNVGEYLL  577
            LVYDVL S        L   P+W +              PLP FSAYPQ  VT  GEYL+
Sbjct  556  LVYDVLGS-----LEGLGAQPVWGARGGEGGGAGGGAGGPLPAFSAYPQQAVTAAGEYLM  610

Query  576  TLPQQLEPLAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  397
             LPQ LE L  G S +     E +    EW+ +VA GA  LYV +L  I  +++ GA QL
Sbjct  611  MLPQTLEGLLGGDSEA-----EEEAVDAEWLDRVAAGAAELYVRELAKIAALSESGAAQL  665

Query  396  SVDIEYLSNVLSALSMPVPPVLATFH  319
            + D++Y  NVL+AL + VP  L T+ 
Sbjct  666  AADLDYFCNVLAALGVAVPLQLVTWQ  691



>ref|XP_797564.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=348

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 85/169 (50%), Gaps = 14/169 (8%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
             ++L + ++  +++   + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQ
Sbjct  159  AHKLAFGIVFFQLQLQLSQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQ  218

Query  564  QLEPLAEGISNSDANADEAQ--------------YFATEWMFKVAEGATALYVDQLRGIQ  427
            QLE      + +   A EA               + A  W+  VA     +YV+ +  I 
Sbjct  219  QLETCTSQDNPAMEKALEASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRIN  278

Query  426  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  280
             +T + A+QLS DI+YL NV+ AL +   P L      L  P SQ  E+
Sbjct  279  GLTQQAARQLSTDIDYLCNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  327



>gb|EKC24157.1| Conserved oligomeric Golgi complex subunit 7 [Crassostrea gigas]
Length=774

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 76/146 (52%), Gaps = 14/146 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTL  571
            V++  +D++   +R +  D+S + IW+S     A    LPTFS  PQ Y+T VG++L+TL
Sbjct  586  VHKFSFDIVFGTLRGYLADVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQFLMTL  645

Query  570  PQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQ  427
            PQ LEP            L  G        +  ++ A  W+  +A G   LY +Q+  IQ
Sbjct  646  PQHLEPFTMQDNPSVLVALKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQILKIQ  705

Query  426  YITDRGAQQLSVDIEYLSNVLSALSM  349
             +++   +QL  DI+YL NVL  L +
Sbjct  706  ELSNHAVKQLITDIDYLCNVLDDLGL  731



>ref|XP_011431811.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Crassostrea gigas]
Length=754

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 76/146 (52%), Gaps = 14/146 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTL  571
            V++  +D++   +R +  D+S + IW+S     A    LPTFS  PQ Y+T VG++L+TL
Sbjct  566  VHKFSFDIVFGTLRGYLADVSNMEIWTSKSAGGALTSDLPTFSLSPQEYITKVGQFLMTL  625

Query  570  PQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQ  427
            PQ LEP            L  G        +  ++ A  W+  +A G   LY +Q+  IQ
Sbjct  626  PQHLEPFTMQDNPSVLVALKHGKLPYTDETELPEHVADLWLESIARGTMHLYCEQILKIQ  685

Query  426  YITDRGAQQLSVDIEYLSNVLSALSM  349
             +++   +QL  DI+YL NVL  L +
Sbjct  686  ELSNHAVKQLITDIDYLCNVLDDLGL  711



>ref|XP_005105726.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Aplysia californica]
Length=750

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 80/159 (50%), Gaps = 14/159 (9%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTL  571
            V++  ++++ S+++ + N +S + IW+S     A    LPTFS  PQ Y+T VG+YL+TL
Sbjct  562  VHKFAFEIVFSQLKTYLNGVSIMEIWTSQSAGGAMTSDLPTFSLSPQEYITKVGQYLMTL  621

Query  570  PQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQ  427
            PQ L+P            L  G      + +  ++ A  W+  VA G    Y +++  I 
Sbjct  622  PQHLDPFTLQESPALITALKHGRLPYTNHQELPEHLADIWLESVAMGTMHTYTEEILKIP  681

Query  426  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  310
            Y T  G +QL  DI+YL NVL  L +     +    + L
Sbjct  682  YATPHGCKQLITDIDYLCNVLEDLGLKASETMTHIQTLL  720



>ref|XP_786237.3| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Strongylocentrotus purpuratus]
Length=762

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 85/168 (51%), Gaps = 14/168 (8%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            ++L + ++  +++   + +S++ +W+      +  LPTFS  PQ Y+T +G+YL+TLPQQ
Sbjct  574  HKLAFGIVFFQLQLQLSQVSQMEVWTDEGGMLSADLPTFSLSPQEYITKIGQYLMTLPQQ  633

Query  561  LEPLAEGISNSDANADEAQ--------------YFATEWMFKVAEGATALYVDQLRGIQY  424
            LE      + +   A EA               + A  W+  VA     +YV+ +  I  
Sbjct  634  LETCTSQDNPAMEKALEASQLPFPPSPGSPEVAHLADYWIGSVARATMHMYVEVILRINE  693

Query  423  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKEL  280
            +T + A+QLS DI+YL NV+ AL +   P L      L  P SQ  E+
Sbjct  694  LTQQAARQLSTDIDYLCNVVDALGIHPSPNLKHIEELLKMPLSQYGEV  741



>gb|EFA86654.1| oligomeric Golgi complex component [Polysphondylium pallidum 
PN500]
Length=785

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 98/216 (45%), Gaps = 49/216 (23%)
 Frame = -1

Query  735  LVYDVLISKVRQHFNDLSRLPIW---SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
             V++ +I+ +R    DL RLP W   S  E +   P         SY+T + E+LL +PQ
Sbjct  577  FVFETMINFIRLKLKDLPRLPEWKQQSGTESYQTNPSQV------SYITQIAEHLLNIPQ  630

Query  564  QLEPLAE----------GISNSDANADEAQYF----------------------------  499
            QL+P +E           +S   AN D  Q                              
Sbjct  631  QLDPYSEEELIRFSYRIALSQPIANDDFYQNLVRQLYKSEQTTSAATISEDEEEEEEDGI  690

Query  498  ATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFH  319
            A +WM  VA+    LY+  +  I  +TD G QQL+ DI YL N+LSA+ +P  P+L+   
Sbjct  691  AHQWMSLVAKATEKLYLQSIVEISTLTDSGCQQLANDISYLFNILSAIGVPHDPLLSLTQ  750

Query  318  SCLSTPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
              +S P+ +  E + +   ++ ++  +NL+ KMR +
Sbjct  751  QLISIPKDKYLESIANYESSEKNI--SNLISKMRGI  784



>ref|XP_011402672.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Amphimedon queenslandica]
Length=553

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 21/167 (13%)
 Frame = -1

Query  735  LVYDVLISKVRQHFNDLSRLPIWSS-----VEEHSA--RPLPTFSAYPQSYVTNVGEYLL  577
            L +DV+ S+++Q   ++ +L +WS      +E   A    LP+FS  P +Y+T +G++LL
Sbjct  360  LAFDVVFSQLKQKLIEIPKLKVWSRSTSSPLESPQALTDDLPSFSLSPLTYITEIGDHLL  419

Query  576  TLPQQLEP--------LAEGISNS------DANADEAQYFATEWMFKVAEGATALYVDQL  439
            TLP+QLEP        LA  + +       D   +     +  W+  +A G    YV+ +
Sbjct  420  TLPEQLEPFTSQDNPSLAAAMKHGRLPFTEDDGENRDLSLSDMWLDAIARGTMETYVESI  479

Query  438  RGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPR  298
              I  +TD  A QLS DI YL NVL+AL  P  P L      L + +
Sbjct  480  LKIPRLTDAAALQLSTDIGYLCNVLAALDQPPIPALTALEKLLKSDK  526



>ref|XP_001844946.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS38841.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=727

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 79/155 (51%), Gaps = 12/155 (8%)
 Frame = -1

Query  732  VYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEP  553
            +   ++  + +HFN +     +S+ +E     LP +S  PQ Y+T +G+YLLTLPQ LEP
Sbjct  552  IMKFILYAIEKHFNGMR----FSANKEGEGFNLPDYSYAPQEYITQIGQYLLTLPQHLEP  607

Query  552  LAE--------GISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQL  397
            L           + + D    + ++ A   +  + E  TA Y + +  IQ +T  G++QL
Sbjct  608  LLLSPSPSLKFALQSCDDAYSKDKFCADVLLALIVEETTAFYQESIDNIQSLTAAGSKQL  667

Query  396  SVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  292
            +VDIEY  NVL  +S+P    L      L TP  Q
Sbjct  668  AVDIEYFGNVLEEMSLPFNATLQQTVVLLRTPLEQ  702



>ref|XP_009062761.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
 gb|ESO86524.1| hypothetical protein LOTGIDRAFT_194952 [Lottia gigantea]
Length=737

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 80/146 (55%), Gaps = 14/146 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTL  571
            V++  ++++ ++++++ +++S + IW+S     A    LP+FS  PQ Y+T +G+YL+T+
Sbjct  549  VHKFGFEIVFAQLKKYLSNISNMEIWTSKRAEGALTSDLPSFSLSPQEYITKIGQYLMTI  608

Query  570  PQQLEP------------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQ  427
            PQ LEP            L  G      + D  ++ A  W+  VA+G   +Y +++  I 
Sbjct  609  PQHLEPFMLHDNPTLTTALKYGKLPYIDDQDLPEHLADLWLESVAKGTMHIYCEEILKII  668

Query  426  YITDRGAQQLSVDIEYLSNVLSALSM  349
             ++    +QL  DIEYL NVL  L +
Sbjct  669  NLSPHATKQLITDIEYLLNVLDDLGL  694



>ref|XP_004206189.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Hydra vulgaris]
Length=216

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 85/171 (50%), Gaps = 12/171 (7%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQ  565
            + L +D++  + +   + +S + +W + E+ +A   LP FS  PQSY+T +G+ LLTLPQ
Sbjct  31   HSLAFDLIFYQFKCLLDGVSSMEVWRTEEKEAAGGDLPKFSLSPQSYITQIGDSLLTLPQ  90

Query  564  QLEP----------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  415
            QLE           ++  +        E  +    W+  +A  A+A YV+ +  I Y+T 
Sbjct  91   QLEGYFNEQNVSLIVSLKVGRLPFQETEGAHLDHCWLESLARSASANYVEAIIKIPYLTA  150

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSG  262
             G +QL  DI+Y   +L AL + V   L T    +    S   E V +++G
Sbjct  151  YGTRQLLADIDYYLKILGALEVNVNEKLLTIQKLMIADPSSFNE-VAAETG  200



>gb|ELT88100.1| hypothetical protein CAPTEDRAFT_161050 [Capitella teleta]
Length=754

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 73/147 (50%), Gaps = 15/147 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTL  571
            +++  +DV+ + ++Q    L    IW S  +  A    LP F   PQ Y+T +G+YL+TL
Sbjct  564  LHQFAFDVVFAPLQQLLMSLPDFEIWQSESQAGAITTNLPAFGLTPQEYITKIGQYLMTL  623

Query  570  PQQLEPLAEG-------------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGI  430
            PQQLEP  +              + ++    D  +  A  W+  VA G+  LY +Q+  I
Sbjct  624  PQQLEPFTQEDNPALCVALKHGRLPHTLDQTDMPEQLADLWLESVANGSMRLYAEQILNI  683

Query  429  QYITDRGAQQLSVDIEYLSNVLSALSM  349
              ++    QQL +DI+Y  NV+  L +
Sbjct  684  PKLSTLATQQLLIDIDYFCNVMDDLGL  710



>ref|XP_002407978.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
 gb|EEC12391.1| conserved oligomeric golgi complex subunit, putative [Ixodes 
scapularis]
Length=749

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 80/161 (50%), Gaps = 14/161 (9%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSA--RPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++  +D + ++V+ HFN +  L +W+      A  R LP FS  P  Y+T +G+YLLT+P
Sbjct  563  SKFTFDTVFAEVQSHFNTVPSLKVWALENPGGAIARDLPAFSISPLEYITQIGQYLLTIP  622

Query  567  QQLEP--------LAEGISNSD----ANADEAQYFATEWMFKVAEGATALYVDQLRGIQY  424
            Q +EP        LA  +  S+      +    + A   +  VA+     Y+D +  I  
Sbjct  623  QHIEPFIVEENEALAMALKYSNLPHVIESTSTDHVADYLLGCVAQATMYTYLDTVMQIDR  682

Query  423  ITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  301
            +T + + QL+ DI YL NVL  L +P+   L    + L +P
Sbjct  683  LTQQASAQLATDIGYLCNVLDDLGLPLLENLQQLAALLKSP  723



>emb|CDS12214.1| hypothetical protein LRAMOSA04409 [Absidia idahoensis var. thermophila]
Length=892

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 87/193 (45%), Gaps = 50/193 (26%)
 Frame = -1

Query  735  LVYDVLISKVRQHFNDLSRL-PIWSSVEEHSARP----------LPTFSAYPQSYVTNVG  589
            +++  ++  + +H + +  L  +W++ E  S R           +P FS  P +Y+T +G
Sbjct  699  MLHKAILGPIIRHLDTIPTLRSVWTAPEPPSRRKNVQDATIHVDMPQFSLSPNAYITRIG  758

Query  588  EYLLTLPQQLEPLAEG------------ISNSDANA---DEAQYFATE------------  490
            E LL LPQ+ E  A+             I  SD +A   +E    A+E            
Sbjct  759  EKLLMLPQEFEVYADDSSLRYHIESAPFIEKSDLSAHDEEEDTIDASEEHQQQPLDNEEE  818

Query  489  ------------WMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMP  346
                        W   +A G  A ++D++R IQ  T +G +QL  DIEYL NVLSAL + 
Sbjct  819  EEEEEGSDVIQLWTTSIARGTMARFLDEIRKIQKTTPQGQRQLRTDIEYLVNVLSALDVQ  878

Query  345  VPPVLATFHSCLS  307
              P L  FHS LS
Sbjct  879  PLPDLVEFHSTLS  891



>ref|XP_005825555.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
 gb|EKX38575.1| oligomeric Golgi complex subunit 7 [Guillardia theta CCMP2712]
Length=842

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 15/146 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQ  565
            V  L+ D  +S VR+   ++++L +W   E      LP+FS+ P  +VTN+ E+L +LP+
Sbjct  651  VELLLQDTALSFVRRQLINVAKLQVWG--ENKKKGHLPSFSSSPLPHVTNIAEHLFSLPE  708

Query  564  QLEPLAEG---ISNSDA-------NADEA---QYFATEWMFKVAEGATALYVDQLRGIQY  424
            QL+P A      S S A       N DE      F  +W+ ++     +LYV+++  I  
Sbjct  709  QLDPAAHDEVPCSTSAALQLTQPQNVDEGSSEHKFMQKWLSRITGEVVSLYVEKILEIPA  768

Query  423  ITDRGAQQLSVDIEYLSNVLSALSMP  346
            ++  G  QL  DI+Y+S++L  L  P
Sbjct  769  LSPSGRVQLGTDIQYISSILDTLGAP  794



>ref|XP_004535745.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Ceratitis capitata]
Length=751

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 91/186 (49%), Gaps = 24/186 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            +E+  ++L+  V +H  ++   P      +  +  +P FS  PQ  +T +G+YLLTLPQ 
Sbjct  570  HEIALNILLKPVEEHLLNIE--PSQHLNSDSLSATMPEFSFVPQESITQIGQYLLTLPQH  627

Query  561  LEP--------LAEGISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGA  406
            LEP        L + +   +A   ++   A   +  V E    LY  Q+  ++ +    +
Sbjct  628  LEPLLFTPSALLKQALEICNAKYTQSIPCADILLSLVVEQCCQLYQSQILQVKVMPVSSS  687

Query  405  QQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANLVC  226
            +Q +VDIEYLSNVL  L + +           ST  SQ+  L+K+DSGN L L      C
Sbjct  688  KQFAVDIEYLSNVLEELGLNI-----------STSLSQILVLLKADSGNYLALSVG---C  733

Query  225  KMRRVS  208
            + R V+
Sbjct  734  EPRLVT  739



>ref|XP_003703617.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Megachile rotundata]
Length=764

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 78/148 (53%), Gaps = 15/148 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  578  YEVIFAPIFTQLLLVQKAPAWSTETNKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  637

Query  558  EP--LAEGIS-NSDANADEAQYF--ATEWMFK------VAEGATALYVDQLRGI-QYITD  415
            EP  L E  S N    A + QY    TE  F       +A+G   +++DQ  GI Q+++ 
Sbjct  638  EPFLLRENPSLNQALKAADPQYAQGTTESGFTGILLDIIAKGTCQMFLDQTLGICQFLSS  697

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVL  331
               +QL+ DI+YL NVL  L + +   L
Sbjct  698  AACKQLATDIDYLGNVLEELGLSLSENL  725



>ref|XP_006682175.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77069.1| hypothetical protein BATDEDRAFT_27828 [Batrachochytrium dendrobatidis 
JAM81]
Length=846

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 82/182 (45%), Gaps = 18/182 (10%)
 Frame = -1

Query  738  ELVYDVLISKVRQHFNDLSRLPIWSS-----VEEHSARPLPTFSAYPQSYVTNVGEYLLT  574
            +LV+  L+ ++ +  + +  L  W+S     V       LP FS  P +Y+TN+GE LL 
Sbjct  646  KLVFQCLLQRMTREMDGMFALSCWTSQYTNTVAGSFDTQLPEFSLLPLAYMTNIGEQLLA  705

Query  573  LPQQLEPLAE------------GISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGI  430
            LP  L+  A             G+   D    E+      W+  ++    +  +DQ++ I
Sbjct  706  LPLHLDTFAGEQSLQYSLATLPGVECIDLEDQESIDVTHVWILSMSRAIESRLMDQVKRI  765

Query  429  QYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQL-KELVKSDSGNQL  253
              ++ RG +QL+ DI YLSNV SA+ +     L     CL      L K + + D+    
Sbjct  766  PTLSSRGCRQLATDINYLSNVFSAMEIEPHMTLQVMIQCLECNEQDLEKRMTEQDTAENS  825

Query  252  DL  247
            D+
Sbjct  826  DI  827



>ref|XP_011299085.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Fopius arisanus]
Length=698

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  513  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  571

Query  561  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  415
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  572  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  631

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  310
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  632  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  666



>ref|XP_011299070.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Fopius arisanus]
Length=750

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  565  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  623

Query  561  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  415
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  624  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  683

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  310
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  684  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  718



>dbj|GAM17697.1| hypothetical protein SAMD00019534_008720 [Acytostelium subglobosum 
LB1]
Length=735

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -1

Query  528  DANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
            D N DE    A +WM  VA     LY+  +  I  +++ G QQLS DI YL NVLSAL +
Sbjct  626  DENIDEMDGIAHQWMTLVASATEKLYLQSIVEISMLSEFGCQQLSNDIGYLFNVLSALGV  685

Query  348  PVPPVLATFHSCLSTPRSQLKELVKS--DSGNQLDLPTANLVCKMRRVSL  205
               P+L+     +STP+ +  E++ +   S N  +   ANL+ KMR + L
Sbjct  686  SADPLLSRTQQLVSTPKERYAEIISNIMKSDNNAEKNIANLIAKMRGIKL  735



>ref|XP_011299078.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Fopius arisanus]
Length=736

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 75/155 (48%), Gaps = 16/155 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIW----SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            Y+V+ + +      + R P W    + V+  S+  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  551  YEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSS-DLPDYSFAPQEYITQVGQYLMTLPQH  609

Query  561  LEP--------LAEGISNSDANADEAQY---FATEWMFKVAEGATALYVDQLRGIQYITD  415
            LEP        L   +  +DA   +      F    +  VA+G   ++ DQ  GI  +  
Sbjct  610  LEPFLLRDNPSLVHALRAADAQYTQGSAEGGFTATLLGIVAKGTCQMFQDQALGICELNT  669

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCL  310
               +QL+ DI+YL NVL  L +P+   L    + L
Sbjct  670  GACKQLATDIDYLGNVLEELGLPLSDNLQQMSTLL  704



>ref|XP_002109935.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
 gb|EDV28101.1| hypothetical protein TRIADDRAFT_53345 [Trichoplax adhaerens]
Length=710

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 22/152 (14%)
 Frame = -1

Query  687  LSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLEPLA----------  547
            L  + +WS+   V + S   LPTF + P SY+T +G+YLL LPQQLEP A          
Sbjct  539  LKSVKVWSAEKEVSDVSNEDLPTFIS-PSSYITQIGDYLLNLPQQLEPFATQNNPSLEMA  597

Query  546  --EG------ISNSDANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSV  391
              EG       S+++  +         W+  VA G    YV+ +  I  +TD  A+QL  
Sbjct  598  LKEGKLPYPDTSDNEDTSLNVNDTTIYWLGAVARGTVLTYVENIMKIPTLTDHAARQLIE  657

Query  390  DIEYLSNVLSALSMPVPPVLATFHSCLSTPRS  295
            DIEYL N+L AL +     L      L +P S
Sbjct  658  DIEYLFNILEALEISPGIKLKQIVLLLKSPSS  689



>ref|XP_006872058.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysochloris 
asiatica]
Length=770

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 83/178 (47%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W+  SV E  A  LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNAVSVGEPLAEDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_004080382.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Oryzias 
latipes]
Length=769

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++ I   S + E+    LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLGLVSKMEIQEASGIGENFTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  445
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YLSNV+ AL +
Sbjct  695  AILLIPQLTPHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_006637161.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Lepisosteus oculatus]
Length=728

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 78/174 (45%), Gaps = 18/174 (10%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++   + + R+  WSS    E     LPTFS  P  Y+TN+G+Y+++LP
Sbjct  537  HQLAFDAVFLQIKHQLSLVHRMESWSSSGTGETLTEDLPTFSLSPLEYITNIGQYIMSLP  596

Query  567  QQLEPL-------------AEGISNSDANAD---EAQYFATEWMFKVAEGATALYVDQLR  436
              LEP              A  +      AD   E    A  W+  +A      Y D + 
Sbjct  597  LHLEPFVTQEDPALELALHAGKLPFPPEQADDLPELDNIADYWLGSIARATMQTYCDAIL  656

Query  435  GIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  274
             I  +T   A+QL+ DI+YLSNV+ AL +     L    + L       ++  K
Sbjct  657  QIPELTPHSAKQLATDIDYLSNVMDALGLQASRTLQQIVTLLKAKPEDFRQTAK  710



>ref|XP_003490215.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus impatiens]
Length=783

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 92/189 (49%), Gaps = 19/189 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  598  YEVIFAPIFTQLLSVQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  657

Query  558  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L E  S + A  A + QY   +TE  F       +A+    +++DQ  GI  ++  
Sbjct  658  EPFLLRENPSLTQALKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSA  717

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  232
              +QL+ DI+YL NVL  L + +   L      L  P    +   KS SG    +  A  
Sbjct  718  ACKQLATDIDYLGNVLEELGLSLSENLQHMSLLLRLPPEDYQ---KSSSGCNARVVAA--  772

Query  231  VCKMRRVSL  205
            V +MR ++ 
Sbjct  773  VRQMRNITF  781



>ref|XP_007571518.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=224

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 73/153 (48%), Gaps = 24/153 (16%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTL  571
             N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++L
Sbjct  32   ANQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSL  91

Query  570  PQQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYV  448
            P  LEP    ++  D   + A +                    A  W+  +A      Y 
Sbjct  92   PLHLEPF---VTQEDPALEMALHAGKLPFPPDQGDDLPELDNTADYWLGSIARATMQTYC  148

Query  447  DQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
            D +  I  ++    +QL+ DIEYLSNV+ AL +
Sbjct  149  DAILLIPRLSPHSTKQLATDIEYLSNVMDALGL  181



>ref|XP_005810284.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Xiphophorus maculatus]
Length=769

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/152 (30%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  445
              LEP    ++  D   D A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALDMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I +++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPHLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_003397366.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Bombus terrestris]
Length=735

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 93/189 (49%), Gaps = 19/189 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSS---VEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFTQLLSVQKAPAWSTEINKMTHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  558  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L E  S + A  A + QY   +TE  F       +A+    +++DQ  GI  ++  
Sbjct  610  EPFLLRENPSLTQALKAADPQYAQSSTESGFTGILLEIIAKETCQMFLDQTLGICQLSSA  669

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDSGNQLDLPTANL  232
              +QL+ DI+YL NVL  L + +   L      L  P    ++  KS SG    +  A  
Sbjct  670  ACKQLATDIDYLGNVLEELGLSLSENLQHMSLLLRLPP---EDYHKSSSGCNARVVAA--  724

Query  231  VCKMRRVSL  205
            V +MR ++ 
Sbjct  725  VRQMRNITF  733



>ref|XP_006892752.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Elephantulus 
edwardii]
Length=770

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 80/167 (48%), Gaps = 24/167 (14%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E  A  LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWSTAGIGETLADDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLST  304
             +  I  +T    +QL+ DI+YL+NV+ AL +    +L    + L T
Sbjct  696  VILQIPELTPHSTKQLTTDIDYLTNVMDALGLQPSRLLQNIVTLLKT  742



>ref|XP_004706118.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Echinops 
telfairi]
Length=770

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS  SV E     LPTFS  P  Y++N+G+YL++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTASVGETLTDDLPTFSLTPLEYISNIGQYLMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDEPPELDNMADNWLGAIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGL  727



>ref|XP_007951381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orycteropus 
afer afer]
Length=731

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  540  HQLAFDSIFLRIKQQLLLVSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  599

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  600  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLVSIARATMQTYCD  656

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  657  VILQIPELTPHSTKQLATDIDYLTNVMDALGL  688



>ref|XP_006003103.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Latimeria chalumnae]
 ref|XP_006003104.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Latimeria chalumnae]
 ref|XP_006003105.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Latimeria chalumnae]
Length=769

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q  + +SR+  WSS  + E     LPTFS  P  Y+TN+G+Y+++LP
Sbjct  578  HQLAFDSVFLRIKQQLSLVSRMESWSSGGMGETLTDDLPTFSLTPLEYITNIGQYIMSLP  637

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D   +                   E    A  W+  +A      Y +
Sbjct  638  LHLEPF---VTQEDPALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YLSNV+ AL +
Sbjct  695  IILQIPELTMHSTKQLATDIDYLSNVMDALGL  726



>ref|XP_006193181.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
ferus]
Length=770

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A+ V  MR V
Sbjct  754  ---LPRRLASTVATMRSV  768



>gb|KDR16116.1| Conserved oligomeric Golgi complex subunit 7 [Zootermopsis nevadensis]
Length=742

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 73/154 (47%), Gaps = 16/154 (10%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR---PLPTFSAYPQSYVTNVGEYLLT  574
            V+   + V+   +      +   P WS+  + +A     LP FS  PQ Y+T +G+YL+T
Sbjct  550  VHHTTFQVIFVPISVQLEQVQSAPAWSNANKQAATVAADLPDFSFAPQEYITQIGQYLMT  609

Query  573  LPQQLEP----------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRG  433
            LPQ LEP          LA  +++ +    +A+    FA   +  +A G    Y D + G
Sbjct  610  LPQHLEPFLLQDNPSLTLALQVADVEYGLLSAEAEGGFAGVLLGIIARGTCQTYCDNILG  669

Query  432  IQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  331
            I  +     +QL+ DI+YL NVL  L + +   L
Sbjct  670  ICELGSSSCKQLATDIDYLGNVLEDLGLSLSEHL  703



>ref|XP_010959320.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Camelus 
bactrianus]
 ref|XP_010985220.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camelus dromedarius]
Length=770

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A+ V  MR V
Sbjct  754  ---LPRRLASTVAAMRSV  768



>gb|EPY74529.1| conserved oligomeric Golgi complex subunit 7-like protein [Camelus 
ferus]
Length=800

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  609  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  668

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  669  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  725

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  726  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  783

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A+ V  MR V
Sbjct  784  ---LPRRLASTVATMRSV  798



>ref|XP_010985221.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Camelus dromedarius]
Length=705

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  514  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  573

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  630

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             L  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  631  ALLQIPGLTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  688

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A+ V  MR V
Sbjct  689  ---LPRRLASTVAAMRSV  703



>ref|XP_011340196.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Cerapachys biroi]
Length=705

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  520  YEVIFAPIFTQLLLVQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  579

Query  558  EP--LAEGISNSDA-NADEAQY--FATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L +  S + A  A + QY   +TE  F       VA G   +++DQ  GI  +   
Sbjct  580  EPFLLRDNPSLTQALKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSV  639

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  640  ACKQLATDIDYLGNVLEELGLCLSENL  666



>ref|XP_004373515.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Trichechus 
manatus latirostris]
Length=770

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_003418948.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Loxodonta 
africana]
Length=770

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL+NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGLQPSRTLQNIVTLLKTKPEDYRQATKS  753



>ref|XP_006125865.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Pelodiscus sinensis]
Length=700

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WSS  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  509  HQLAFDSVFLRIKQQLLLISKMEGWSSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLP  568

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  569  LHLEPF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  625

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     +++ KS
Sbjct  626  VILQIPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQIAKS  683



>gb|EFZ22757.1| hypothetical protein SINV_01051 [Solenopsis invicta]
Length=780

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            Y+V+ + +      + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  595  YEVIFAPIFTQLLLVQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQH  653

Query  561  LEP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  415
            LEP        L + +  +D   A       F +  +  VA G   ++ DQ  GI  +  
Sbjct  654  LEPFLLRDNPSLTQALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNS  713

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  301
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  714  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  751



>ref|XP_011340195.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Cerapachys biroi]
 gb|EZA53204.1| Conserved oligomeric Golgi complex subunit [Cerapachys biroi]
Length=735

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 76/147 (52%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS   S   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  550  YEVIFAPIFTQLLLVQKAPAWSADTSKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  609

Query  558  EP--LAEGISNSDA-NADEAQY--FATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L +  S + A  A + QY   +TE  F       VA G   +++DQ  GI  +   
Sbjct  610  EPFLLRDNPSLTQALKAADPQYAQVSTESGFTGILLDIVARGTCQMFLDQTLGICQLNSV  669

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  670  ACKQLATDIDYLGNVLEELGLCLSENL  696



>ref|XP_008434639.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Poecilia 
reticulata]
Length=769

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D   +                   E    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALELALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I +++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPHLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_011159533.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Solenopsis 
invicta]
Length=735

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEEHS----ARPLPTFSAYPQSYVTNVGEYLLTLPQQ  562
            Y+V+ + +      + + P WS VE +     +  LP +S  PQ Y+T VG+YL+TLPQ 
Sbjct  550  YEVIFAPIFTQLLLVQKAPAWS-VETNKMSNLSSELPDYSFAPQEYITQVGQYLMTLPQH  608

Query  561  LEP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITD  415
            LEP        L + +  +D   A       F +  +  VA G   ++ DQ  GI  +  
Sbjct  609  LEPFLLRDNPSLTQALKAADPQYAQGSTESGFTSILLDIVARGTCQMFQDQTLGICQLNS  668

Query  414  RGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  301
               +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  669  VACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  706



>ref|XP_007058642.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chelonia 
mydas]
 gb|EMP36935.1| Conserved oligomeric Golgi complex subunit 7 [Chelonia mydas]
Length=770

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISRMEGWSSGGIGETLTDDLPNFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  VA      Y +
Sbjct  639  LHLEPF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSVARATMQTYCE  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>ref|XP_005288959.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chrysemys 
picta bellii]
Length=770

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  WSS  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISRMEGWSSAGIGETLTDDLPNFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  639  LHLEPF---VTQEDSALELALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L T     ++  KS
Sbjct  696  VILQIPELTLHSAKQLATDIDYLINVMDALGLQPSKTLQNIVTLLKTKPEDYRQTAKS  753



>ref|XP_004604166.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Sorex 
araneus]
Length=770

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + R+  W++  + E     LPTFS  P  Y++N+G+YL++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVCRMDSWTTAGIGETLTDDLPTFSLTPLEYISNIGQYLMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADHWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL+NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLTNVMDALGL  727



>ref|XP_003961343.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Takifugu rubripes]
Length=769

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWS--SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++         E+    LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMETHEPPGFGENYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  445
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNVADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++ R  +QL+ DI+YLSNV+ AL +
Sbjct  695  AILLIPQLSTRSTKQLATDIDYLSNVMDALGL  726



>gb|ENN72949.1| hypothetical protein YQE_10420, partial [Dendroctonus ponderosae]
Length=247

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 75/165 (45%), Gaps = 14/165 (8%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEYLLTL  571
            V+   Y V+   V  H   +S    W+  +  S     LP +S  PQ Y+T +G+YLL L
Sbjct  58   VHHTTYQVVFGPVSAHLEIVSASETWAQFDGSSLHNSDLPDYSFSPQEYITQIGQYLLEL  117

Query  570  PQQLEPL-----------AEGISNSDANA-DEAQYFATEWMFKVAEGATALYVDQLRGIQ  427
            PQ LEP             + I    A+A D     A  ++ KVA G    + +++  I 
Sbjct  118  PQHLEPFLFKENPALTCALKAIDQEYADAPDREGALAQIFLQKVARGICNSFAEKVLSIS  177

Query  426  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  292
             ++   ++QLS DI YL+N+L  L + +   L    + L  P  Q
Sbjct  178  TLSQPASRQLSHDINYLNNILQDLGITMSENLQQLLALLKIPPDQ  222



>ref|XP_007571524.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  445
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPRLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_007571519.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Poecilia formosa]
Length=769

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIW--SSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++     S++ E     LPTFS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFLQIKHQLCLVSKMESQDASAIGESYTEDLPTFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSDANADEAQY-------------------FATEWMFKVAEGATALYVD  445
              LEP    ++  D   + A +                    A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPDQGDDLPELDNTADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++    +QL+ DIEYLSNV+ AL +
Sbjct  695  AILLIPRLSPHSTKQLATDIEYLSNVMDALGL  726



>ref|XP_001652664.1| AAEL007307-PA [Aedes aegypti]
 gb|EAT41036.1| AAEL007307-PA [Aedes aegypti]
Length=708

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 9/133 (7%)
 Frame = -1

Query  663  SVEEHSAR-PLPTFSAYPQSYVTNVGEYLLTLPQQLEPLAEG--------ISNSDANADE  511
            ++++HS    LP +S  PQ YVT +G+YLLTLPQ LEPL           +   +     
Sbjct  551  TIKQHSENYDLPDYSYAPQEYVTQIGQYLLTLPQHLEPLLLSPSPALKFIMEFCEDKYKG  610

Query  510  AQYFATEWMFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVL  331
             +  A   +F + E  TA+Y +++  I  ++   A+QL+ DIEY  NVL  +S+ +   L
Sbjct  611  EKACADVLLFLIVEETTAMYQEKIDEILSLSASSAKQLATDIEYFGNVLEEMSLTLSTNL  670

Query  330  ATFHSCLSTPRSQ  292
                  L  P  Q
Sbjct  671  QQIIVLLRAPLDQ  683



>ref|XP_009194445.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Papio 
anubis]
Length=781

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 74/152 (49%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++ IW++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  590  HQLAFDSVFLRIKQQLLLISKMDIWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  649

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  650  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  706

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  707  AILQIPELSPHSAKQLATDIDYLINVMDALGL  738



>ref|XP_006201263.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Vicugna 
pacos]
Length=770

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AILQIPGLTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_003691700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Apis florea]
Length=697

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  512  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  571

Query  558  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  572  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  631

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  632  ACKQLATDIDYLGNVLEELGLSLSENL  658



>ref|XP_006623838.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X1 [Apis dorsata]
Length=760

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  575  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  634

Query  558  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  635  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  694

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  695  ACKQLATDIDYLGNVLEELGLSLSENL  721



>ref|XP_006623839.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
isoform X2 [Apis dorsata]
Length=734

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  549  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  608

Query  558  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  609  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  668

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  669  ACKQLATDIDYLGNVLEELGLSLSENL  695



>ref|XP_008150973.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Eptesicus 
fuscus]
Length=770

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            +EL +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HELAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  696  VILQIPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSKG  753



>ref|XP_394713.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Apis 
mellifera]
Length=733

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWSSVEE---HSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS+      H +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  548  YEVIFAPIFTQLLLVQKAPAWSTEANKMIHLSADLPDYSFAPQEYITQVGQYLMTLPQHL  607

Query  558  EP--LAEGISNSDA-NADEAQYF--ATEWMFK------VAEGATALYVDQLRGIQYITDR  412
            EP  L E  S + A  A + QY   +TE  F       + +    +++DQ  GI  +   
Sbjct  608  EPFLLRENPSLTQALKAADPQYTQSSTESGFTDILLEIITKETCQMFLDQTLGICQLNSA  667

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  668  ACKQLATDIDYLGNVLEELGLCLSENL  694



>ref|XP_003341699.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Monodelphis domestica]
Length=769

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  578  HQLAFDSVFLRIKQQLLLISKMESWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  637

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  638  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  695  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNMVTLLKTKPEDYRQVAKG--  752

Query  264  GNQLDLPTANLVCKMRRVS  208
               L    A+ V  MR V+
Sbjct  753  ---LPRRLASKVASMRNVN  768



>ref|XP_008695386.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex 
subunit 7 [Ursus maritimus]
Length=761

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  570  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  629

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  630  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  686

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  687  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  744

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A  V  MR V
Sbjct  745  ---LPRRLATTVANMRNV  759



>ref|XP_004398866.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Odobenus 
rosmarus divergens]
Length=770

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWSTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T    +QL+ D++YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  VILHIPELTPHSTKQLATDMDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A  V  MR V
Sbjct  754  ---LPRRLATTVANMRNV  768



>ref|XP_004360949.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
 gb|EGG23098.1| oligomeric Golgi complex component [Dictyostelium fasciculatum]
Length=861

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/212 (24%), Positives = 94/212 (44%), Gaps = 43/212 (20%)
 Frame = -1

Query  735  LVYDVLISKVRQHFNDLSRLPIWSSVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQLE  556
             +Y+ +I+ ++  F ++ ++  W    + +   + ++ +   +Y T + ++LLT+PQQL+
Sbjct  655  FIYETMITFIKLKFKEVPKMNEW----KQNLNIVDSYQSNQSAYSTQIADHLLTIPQQLD  710

Query  555  PLAE-------------------------------------GISNSDANADEAQYFATEW  487
            P +E                                      IS++    D+    A +W
Sbjct  711  PYSEEISLRFSYQIAISYPTNDEMYQNIIKQLHQTMLNETKDISDTSDIEDDMVGIAHQW  770

Query  486  MFKVAEGATALYVDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLS  307
            +  VA     LY+  +  I  +TD G   L+ DI YL NVLSAL +   P+L+     + 
Sbjct  771  IHIVACATEKLYLQSIVEITSLTDYGCHHLANDITYLFNVLSALGVAPDPLLSKTQLLVQ  830

Query  306  TPRSQLKELVKSDSGNQLDLPTANLVCKMRRV  211
             P+    E ++S  G + ++  A L+ KMR +
Sbjct  831  IPKEAYLESIQSLEGGEKNI--AILISKMRSI  860



>ref|XP_004442758.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ceratotherium 
simum simum]
Length=770

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG  753



>ref|XP_010903275.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903283.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
 ref|XP_010903290.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Esox 
lucius]
Length=768

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 71/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++    +    E  A  LPTFS  PQ Y+TN+G+Y+++LP
Sbjct  577  NQLAFDSVFLQIKHQLCLVSKMESRDAGGFGESYAEDLPTFSLSPQEYITNIGQYIMSLP  636

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D   +                   E    A  W+  +A      Y D
Sbjct  637  LHLEPF---VTQEDPALELALHAGKLPFPPEQGDDLPELDNTADYWLGSIARATMQTYCD  693

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DIEYLSNV+ AL +
Sbjct  694  AILLIPELTAHSTKQLATDIEYLSNVMDALGL  725



>ref|XP_002927171.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ailuropoda 
melanoleuca]
 gb|EFB18307.1| hypothetical protein PANDA_016927 [Ailuropoda melanoleuca]
Length=770

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (44%), Gaps = 29/198 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K   
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEDYRQVSKG--  753

Query  264  GNQLDLPTANLVCKMRRV  211
               L    A  V  MR V
Sbjct  754  ---LPRRLATTVAHMRNV  768



>ref|XP_004268622.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Orcinus 
orca]
Length=770

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+L+LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYILSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELSELDNMADSWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AVLQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_011068677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Acromyrmex 
echinatior]
Length=735

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 79/162 (49%), Gaps = 14/162 (9%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLT  574
            ++ + Y+V+ + +      + + P W+   +   + +  LP +S  PQ Y+T VG+YL+T
Sbjct  545  LHHITYEVIFAPIFSQLLLVQKAPAWTLEANKMSNLSSDLPDYSFAPQEYITQVGQYLMT  604

Query  573  LPQQLEP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQ  427
            LPQ LEP  L +  S + A  A + QY        F +  +  +A G   ++ DQ  GI 
Sbjct  605  LPQHLEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSILLDIIARGTCQMFQDQTLGIC  664

Query  426  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  301
             +     +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  665  QLNSVACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  706



>gb|ELK37852.1| Conserved oligomeric Golgi complex subunit 7 [Myotis davidii]
Length=705

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+L+LP
Sbjct  514  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYILSLP  573

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  630

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  631  VILQIPELTPHSTKQLATDIDYLVNVMDALGL  662



>ref|XP_007516677.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Erinaceus 
europaeus]
Length=759

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    ++++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  568  HQLAFDSVFLRIKQQLLLVTKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  627

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  628  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  684

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L +  + L T     ++  K 
Sbjct  685  IILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQSIATLLKTKPGDFRQASKG  742



>ref|NP_001029061.1| conserved oligomeric Golgi complex subunit 7 [Rattus norvegicus]
 sp|Q3T1G7.1|COG7_RAT RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Rattus norvegicus]
 gb|AAI01932.1| Component of oligomeric golgi complex 7 [Rattus norvegicus]
 gb|EDM17578.1| component of oligomeric golgi complex 7 [Rattus norvegicus]
Length=770

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGEELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  GILQIPAVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIATLLKAKPEEYRQVSKG  753



>gb|EGI69206.1| Conserved oligomeric Golgi complex subunit 7 [Acromyrmex echinatior]
Length=864

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/162 (30%), Positives = 79/162 (49%), Gaps = 14/162 (9%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLT  574
            ++ + Y+V+ + +      + + P W+   +   + +  LP +S  PQ Y+T VG+YL+T
Sbjct  674  LHHITYEVIFAPIFSQLLLVQKAPAWTLEANKMSNLSSDLPDYSFAPQEYITQVGQYLMT  733

Query  573  LPQQLEP--LAEGISNSDA-NADEAQY--------FATEWMFKVAEGATALYVDQLRGIQ  427
            LPQ LEP  L +  S + A  A + QY        F +  +  +A G   ++ DQ  GI 
Sbjct  734  LPQHLEPFLLRDNPSLTQALKAADPQYVQGSSESGFTSILLDIIARGTCQMFQDQTLGIC  793

Query  426  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTP  301
             +     +QL+ DI+YL NVL  L + +   L      L  P
Sbjct  794  QLNSVACKQLATDIDYLGNVLEELGLCLSENLQHMSLLLRLP  835



>ref|XP_002953697.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
 gb|EFJ45321.1| component of oligomeric golgi complex 7 [Volvox carteri f. nagariensis]
Length=957

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 64/137 (47%), Gaps = 26/137 (19%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEH----SARPLPTFSAYPQSYVTNVGEYLL  577
            V   V+DVL+++V      L  LP W          +A PLPTF+ YP  YVT +G++L+
Sbjct  656  VQSTVFDVLLARVASLLAPLPSLPEWRKAAGADPGTAAAPLPTFNTYPLPYVTAIGDHLM  715

Query  576  TLPQQLEPL--------AEGISNSDANADEA--------------QYFATEWMFKVAEGA  463
             +PQQLE L        A G++   A A  A              +  A EW+ K   GA
Sbjct  716  AMPQQLEVLMGDTADEAASGVTIGTAAAVSADGSGAGSGDPTAEWEELAAEWLDKAVSGA  775

Query  462  TALYVDQLRGIQYITDR  412
              +Y D +  I  +T++
Sbjct  776  AGMYADTIFKIPTLTEQ  792



>ref|XP_007615834.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
Length=770

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQISEVTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_004855999.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALRAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI YL NV+ AL +   P L +  + L       ++L K 
Sbjct  696  VILQIPELTPHSTKQLATDIAYLINVVDALGLRPSPTLQSIVTLLKAKPEGYRQLSKG  753



>gb|ERE78144.1| conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=1090

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741   NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
             ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  899   HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  958

Query  567   QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
               LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  959   LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  1015

Query  444   QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
              +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  1016  VILQISEVTPHSTKQLATDIDYLINVMDALGL  1047



>ref|XP_006753680.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Myotis 
davidii]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+L+LP
Sbjct  579  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYILSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLVNVMDALGL  727



>ref|XP_007105719.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Physeter 
catodon]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  VA      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSVARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AVLQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_007450043.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Lipotes 
vexillifer]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  AVLQIPELTPHSTKQLATDIDYLINVMDALGL  727



>gb|ERL93874.1| hypothetical protein D910_11160 [Dendroctonus ponderosae]
Length=663

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 75/165 (45%), Gaps = 14/165 (8%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSSVEEHSAR--PLPTFSAYPQSYVTNVGEYLLTL  571
            V+   Y V+   V  H   +S    W+  +  S     LP +S  PQ Y+T +G+YLL L
Sbjct  474  VHHTTYQVVFGPVSAHLEIVSASETWAQFDGSSLHNSDLPDYSFSPQEYITQIGQYLLEL  533

Query  570  PQQLEPL-----------AEGISNSDANA-DEAQYFATEWMFKVAEGATALYVDQLRGIQ  427
            PQ LEP             + I    A+A D     A  ++ KVA G    + +++  I 
Sbjct  534  PQHLEPFLFKENPALTCALKAIDQEYADAPDREGALAQIFLQKVARGICNSFAEKVLSIS  593

Query  426  YITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQ  292
             ++   ++QLS DI YL+NVL  L + +   L    + L  P  Q
Sbjct  594  TLSQPASRQLSHDINYLNNVLQDLGITMSENLQQLLALLKIPPDQ  638



>ref|XP_004900783.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Heterocephalus glaber]
 gb|EHB13186.1| Conserved oligomeric Golgi complex subunit 7 [Heterocephalus 
glaber]
Length=770

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALRAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI YL NV+ AL +   P L +  + L       ++L K 
Sbjct  696  VILQIPELTPHSTKQLATDIAYLINVVDALGLRPSPTLQSIVTLLKAKPEGYRQLSKG  753



>ref|XP_004453849.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Dasypus 
novemcinctus]
Length=770

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDDLPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_007233023.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Astyanax mexicanus]
Length=545

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/179 (26%), Positives = 79/179 (44%), Gaps = 26/179 (15%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIW---SSVEEHSARPLPTFSAYPQSYVTNVGEYLLT  574
             N+L +D +  +++     L+  P +   + + E     LPTFS  PQ Y+TN+G+Y+++
Sbjct  353  ANQLAFDSVFLQIKHQLC-LANKPEFRGSAGLGETLNENLPTFSLSPQEYITNIGQYIMS  411

Query  573  LPQQLEPLAEGISNSD-------------------ANADEAQYFATEWMFKVAEGATALY  451
            LP  LEP    ++  D                    +  E +  A  W+  +A      Y
Sbjct  412  LPLHLEPF---VTQEDPALELALHTGKLPYPPEQGDDVPELENTADYWLGSIARATMQTY  468

Query  450  VDQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  274
             D +  IQ +     +QL+ DI+YLSNV+ AL +     L    + L     + ++  K
Sbjct  469  CDVILQIQELNPHSTKQLATDIDYLSNVMDALGLQTSRTLQNITTLLRAKPEEFRQTAK  527



>ref|XP_010184345.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesitornis 
unicolor]
 gb|KFQ27417.1| Conserved oligomeric Golgi complex subunit 7 [Mesitornis unicolor]
Length=769

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            + L +D + ++++Q    +S++  W+S  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  578  HHLAFDSVFTRIKQQLLLVSKMEGWNSGGIGETLTEDLPNFSLTPLEYISNIGQYIMSLP  637

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  638  LHLEPF---VTQEDSALEVALHAGKLPYPPEQGDELPELDNMADYWLGSIARATMQTYCE  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T   A+QL+ DI+YL NV+ AL +     L    + L       ++  KS
Sbjct  695  VILQIPELTAHSAKQLATDIDYLINVMDALGLQPSRTLQNIVALLKAKPEDFRQTAKS  752



>gb|EPQ17692.1| Conserved oligomeric Golgi complex subunit 7 [Myotis brandtii]
Length=705

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  514  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  573

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  630

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K 
Sbjct  631  VILQIPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSKG  688



>ref|XP_004691773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Condylura 
cristata]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 82/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMERWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +    +L +  + L     + ++  K 
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRMLQSIATLLKAKPEEYRQASKG  753



>sp|Q3UM29.1|COG7_MOUSE RecName: Full=Conserved oligomeric Golgi complex subunit 7; Short=COG 
complex subunit 7; AltName: Full=Component of oligomeric 
Golgi complex 7 [Mus musculus]
 dbj|BAE26269.1| unnamed protein product [Mus musculus]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  753



>ref|XP_003795773.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
1 [Otolemur garnettii]
Length=772

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q  + +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  581  HQLAFDSVFLRIKQQLSLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLP  640

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  641  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  697

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  698  VILQIPELTPHSTKQLATDIDYLINVMDALGL  729



>ref|NP_001028490.2| conserved oligomeric Golgi complex subunit 7 [Mus musculus]
 dbj|BAE32768.1| unnamed protein product [Mus musculus]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  753



>ref|XP_006912615.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Pteropus 
alecto]
Length=755

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  WS+  V E  A  LP FS  P  Y++N+G+Y+++LP
Sbjct  564  HQLAFDSVFLRIKQQLLLVPKMESWSTAGVGESLADGLPAFSLTPLEYISNIGQYIMSLP  623

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  624  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  680

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  681  VILQIPTLTPHSTKQLATDIDYLINVMDALGL  712



>ref|XP_005882395.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Myotis 
brandtii]
Length=757

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/177 (25%), Positives = 80/177 (45%), Gaps = 24/177 (14%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  566  HQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSLP  625

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  626  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  682

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  274
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T     +++ K
Sbjct  683  VILQIPELTPHSTKQLATDIDYLVNVMDALGLQPSRTLQHVGTLLKTKPEDYRQVSK  739



>ref|XP_004778381.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004819145.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Mustela putorius furo]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTDDLPTFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDEPPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPELTPHSTKQLATDIDYLINVMDALGL  727



>ref|XP_006085923.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X2 [Myotis lucifugus]
Length=949

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 24/153 (16%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTL  571
             ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++L
Sbjct  757  AHQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSL  816

Query  570  PQQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYV  448
            P  LEP    ++  D+  +                   E    A  W+  +A      Y 
Sbjct  817  PLNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYC  873

Query  447  DQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
            D +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  874  DVILQIPELTPHSTKQLATDIDYLVNVMDALGL  906



>ref|XP_001510180.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Ornithorhynchus 
anatinus]
Length=777

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 81/178 (46%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W+S  + E     LPTFS  P  Y++N+G+Y+++LP
Sbjct  586  HQLAFDSVFLRIKQQLLLVSKMESWNSGGIGETLTEDLPTFSLTPLEYISNIGQYIMSLP  645

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y +
Sbjct  646  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADYWLGSIARATMQTYCE  702

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L T   + ++  K 
Sbjct  703  VILQIPELTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKTKPEEYRQTAKG  760



>gb|EDL17254.1| component of oligomeric golgi complex 7 [Mus musculus]
Length=823

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  632  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  691

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  692  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  748

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  749  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIAALLKAKPEEYRQVSKG  806



>ref|XP_005351192.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Microtus 
ochrogaster]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (45%), Gaps = 24/178 (13%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKS  271
             +  I  +T    +QL+ DI+YL NV+ AL +     L    + L     + +++ K 
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGLQPSRTLQNIVTLLKAKPEEYRQISKG  753



>ref|XP_006085922.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Myotis lucifugus]
Length=950

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 24/153 (16%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTL  571
             ++L +D +  +++Q    + ++  WS+  + E     LPTFS  P  Y++N+G+Y+++L
Sbjct  758  AHQLAFDSVFLRIKQQLLLIPKMESWSTAGIGETLTDALPTFSLTPLEYISNIGQYIMSL  817

Query  570  PQQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYV  448
            P  LEP    ++  D+  +                   E    A  W+  +A      Y 
Sbjct  818  PLNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYC  874

Query  447  DQLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
            D +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  875  DVILQIPELTPHSTKQLATDIDYLVNVMDALGL  907



>ref|XP_004670260.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Jaculus 
jaculus]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 87/199 (44%), Gaps = 29/199 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVPKMDSWTTAGIGETLTEDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  VA      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELAELDNMADNWLGSVARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T    +QL+ DI+YL NV+ AL +     L +  + L     + ++L K   
Sbjct  696  MILQIPELTLHSTKQLATDIDYLINVMDALGLQPSRTLQSIITLLKAKPEEYRQLSKG--  753

Query  264  GNQLDLPTANLVCKMRRVS  208
               L    A  V  MR VS
Sbjct  754  ---LPRRLATTVAAMRGVS  769



>ref|XP_006808092.1| PREDICTED: conserved oligomeric Golgi complex subunit 7-like 
[Neolamprologus brichardi]
Length=769

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 78/177 (44%), Gaps = 24/177 (14%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            N+L +D +  +++     +S++    S  + E     LP FS  PQ Y+TN+G+YL++LP
Sbjct  578  NQLAFDSVFMQIKHQLCLVSKMESQESPGLGESYTEDLPNFSLSPQEYITNIGQYLMSLP  637

Query  567  QQLEPLAEGISNSD----------------ANADEAQYF---ATEWMFKVAEGATALYVD  445
              LEP    ++  D                   DE       A  W+  +A      Y D
Sbjct  638  LHLEPF---VTQEDPALEMALHAGKLPFPPEQGDELTELDNTADYWLGSIARATMQTYCD  694

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVK  274
             +  I  ++    +QL+ DI+YLSNV+ AL +     L    + L T   + ++  K
Sbjct  695  AILLIPQLSTHSTKQLATDIDYLSNVMDALGLQPSRTLQNIVTLLRTKPQEYRQTAK  751



>ref|XP_005405154.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Chinchilla lanigera]
Length=794

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  603  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  662

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  663  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  719

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K   
Sbjct  720  VILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG--  777

Query  264  GNQLDLPTANLVCKMRRVS  208
               L    A+ V  MR V+
Sbjct  778  ---LPRRLASTVAAMRGVN  793



>gb|ELK12106.1| Conserved oligomeric Golgi complex subunit 7 [Pteropus alecto]
Length=660

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    + ++  WS+  V E  A  LP FS  P  Y++N+G+Y+++LP
Sbjct  469  HQLAFDSVFLRIKQQLLLVPKMESWSTAGVGESLADGLPAFSLTPLEYISNIGQYIMSLP  528

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  529  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  585

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  586  VILQIPTLTPHSTKQLATDIDYLINVMDALGL  617



>ref|XP_003513853.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Cricetulus 
griseus]
 gb|EGV91994.1| Conserved oligomeric Golgi complex subunit 7 [Cricetulus griseus]
Length=770

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  579  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  638

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  639  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  695

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  696  VILQIPEVTPHSTKQLATDIDYLINVMDALGL  727



>gb|AAQ88995.1| COG7 [Homo sapiens]
Length=491

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  300  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLP  359

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  360  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  416

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  417  AILQIPELSPHSAKQLATDIDYLINVMDALGL  448



>ref|XP_005405156.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X3 [Chinchilla lanigera]
Length=705

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/199 (25%), Positives = 89/199 (45%), Gaps = 29/199 (15%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  514  HQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSLP  573

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  574  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYCD  630

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSDS  265
             +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K   
Sbjct  631  VILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG--  688

Query  264  GNQLDLPTANLVCKMRRVS  208
               L    A+ V  MR V+
Sbjct  689  ---LPRRLASTVAAMRGVN  704



>ref|XP_007986068.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Chlorocebus 
sabaeus]
Length=491

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  300  HQLAFDSVFLRIKQQLLLISKMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  359

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  360  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  416

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  417  AILQIPELSPHSAKQLATDIDYLINVMDALGL  448



>ref|XP_005063464.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Mesocricetus 
auratus]
Length=715

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 72/152 (47%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +SR+  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  524  HQLAFDSVFLRIKQQLLLVSRMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  583

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  584  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  640

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  +T    +QL+ DI+YL NV+ AL +
Sbjct  641  VILQIPEVTPHSTKQLATDIDYLINVMDALGL  672



>ref|XP_003261698.2| PREDICTED: conserved oligomeric Golgi complex subunit 7 [Nomascus 
leucogenys]
Length=712

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/152 (26%), Positives = 73/152 (48%), Gaps = 24/152 (16%)
 Frame = -1

Query  741  NELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTLP  568
            ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++LP
Sbjct  521  HQLAFDSVFMRIKQQLLLISKMDSWNTAGIGETLTDDLPAFSLTPLEYISNIGQYIMSLP  580

Query  567  QQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYVD  445
              LEP    ++  D+  +                   E    A  W+  +A      Y D
Sbjct  581  LNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADNWLGSIARATMQTYCD  637

Query  444  QLRGIQYITDRGAQQLSVDIEYLSNVLSALSM  349
             +  I  ++   A+QL+ DI+YL NV+ AL +
Sbjct  638  AILQIPELSPHSAKQLATDIDYLINVMDALGL  669



>ref|XP_005405157.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X4 [Chinchilla lanigera]
Length=685

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 89/200 (45%), Gaps = 29/200 (15%)
 Frame = -1

Query  744  VNELVYDVLISKVRQHFNDLSRLPIWSS--VEEHSARPLPTFSAYPQSYVTNVGEYLLTL  571
             ++L +D +  +++Q    +S++  W++  + E     LP FS  P  Y++N+G+Y+++L
Sbjct  493  AHQLAFDSVFLRIKQQLLLVSKMDSWNTAGIGETLTEELPAFSLTPLEYISNIGQYIMSL  552

Query  570  PQQLEPLAEGISNSDANAD-------------------EAQYFATEWMFKVAEGATALYV  448
            P  LEP    ++  D+  +                   E    A  W+  +A      Y 
Sbjct  553  PLNLEPF---VTQEDSALELALHAGKLPFPPEQGDELPELDNMADSWLGSIARATMQTYC  609

Query  447  DQLRGIQYITDRGAQQLSVDIEYLSNVLSALSMPVPPVLATFHSCLSTPRSQLKELVKSD  268
            D +  I  +T   ++QL+ DI+YL NV+ AL +     L +  + L       ++L K  
Sbjct  610  DVILQIPELTAHSSKQLATDIDYLINVMDALGLQPSRTLQSIVTLLKAKPEDYRQLSKG-  668

Query  267  SGNQLDLPTANLVCKMRRVS  208
                L    A+ V  MR V+
Sbjct  669  ----LPRRLASTVAAMRGVN  684



>ref|XP_011264700.1| PREDICTED: conserved oligomeric Golgi complex subunit 7 isoform 
X1 [Camponotus floridanus]
Length=747

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 14/147 (10%)
 Frame = -1

Query  729  YDVLISKVRQHFNDLSRLPIWS---SVEEHSARPLPTFSAYPQSYVTNVGEYLLTLPQQL  559
            Y+V+ + +      + + P WS   +   + +  LP +S  PQ Y+T VG+YL+TLPQ L
Sbjct  562  YEVIFAPIFSQLLLVQKAPAWSLDANKMSNLSSDLPDYSFAPQEYITQVGQYLMTLPQHL  621

Query  558  EP--------LAEGISNSD---ANADEAQYFATEWMFKVAEGATALYVDQLRGIQYITDR  412
            EP        L + +  +D   A       F    +  VA G   ++ DQ  GI  +   
Sbjct  622  EPFLLRDNPSLTQALKAADPQYAQGLTESGFTGILLDIVARGTCQMFQDQTLGICQLNSV  681

Query  411  GAQQLSVDIEYLSNVLSALSMPVPPVL  331
              +QL+ DI+YL NVL  L + +   L
Sbjct  682  ACKQLATDIDYLGNVLEELGLCLSENL  708



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420