BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044P23

Length=343
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADA70359.1|  mitotic cyclin A1-like protein                        65.5    6e-10   Persea americana
gb|KHG05394.1|  CYCA1-1: Cyclin-A1-1                                  60.8    7e-09   Gossypium arboreum [tree cotton]
emb|CDP10969.1|  unnamed protein product                              62.4    7e-09   Coffea canephora [robusta coffee]
ref|XP_007019146.1|  Cyclin A1,1, putative                            58.5    1e-08   
ref|XP_010260855.1|  PREDICTED: cyclin-A1-4                           61.6    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010925928.1|  PREDICTED: cyclin-A1-4                           61.2    2e-08   Elaeis guineensis
ref|XP_011102309.1|  PREDICTED: cyclin-A1-1                           60.8    2e-08   Sesamum indicum [beniseed]
ref|XP_010063417.1|  PREDICTED: cyclin-A1-1                           60.8    3e-08   
ref|XP_002520329.1|  cyclin A, putative                               60.8    3e-08   
dbj|BAE06271.1|  cyclin A                                             60.8    3e-08   Scutellaria baicalensis [Baikal skullcap]
gb|EYU32511.1|  hypothetical protein MIMGU_mgv1a005475mg              60.5    3e-08   Erythranthe guttata [common monkey flower]
gb|KJB64518.1|  hypothetical protein B456_010G052900                  60.5    3e-08   Gossypium raimondii
ref|XP_007019153.1|  Cyclin A1,1, putative                            60.5    4e-08   
ref|XP_006386358.1|  hypothetical protein POPTR_0002s08020g           59.7    6e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006351136.1|  PREDICTED: cyclin-A1-3-like isoform X1           59.7    7e-08   Solanum tuberosum [potatoes]
ref|XP_006351138.1|  PREDICTED: cyclin-A1-3-like isoform X3           59.7    7e-08   Solanum tuberosum [potatoes]
ref|XP_010312445.1|  PREDICTED: cyclin A1 isoform X1                  59.7    7e-08   
ref|NP_001233762.1|  cyclin A1                                        59.7    8e-08   Solanum lycopersicum
ref|XP_006351137.1|  PREDICTED: cyclin-A1-3-like isoform X2           59.3    8e-08   Solanum tuberosum [potatoes]
ref|XP_009796391.1|  PREDICTED: cyclin-A1-4                           59.3    9e-08   Nicotiana sylvestris
ref|XP_009593177.1|  PREDICTED: cyclin-A1-4 isoform X1                59.3    9e-08   Nicotiana tomentosiformis
ref|XP_009593178.1|  PREDICTED: cyclin-A1-4 isoform X2                59.3    9e-08   Nicotiana tomentosiformis
dbj|BAA09366.1|  A-type cyclin                                        59.3    9e-08   Nicotiana tabacum [American tobacco]
emb|CAA63542.1|  cyclin A-like protein                                59.3    9e-08   Nicotiana tabacum [American tobacco]
ref|XP_011027473.1|  PREDICTED: cyclin-A1-1-like                      58.5    2e-07   Populus euphratica
ref|XP_011027470.1|  PREDICTED: cyclin-A1-1-like                      58.5    2e-07   Populus euphratica
ref|XP_004967382.1|  PREDICTED: cyclin-A1-1-like                      58.2    2e-07   Setaria italica
ref|XP_002284567.1|  PREDICTED: cyclin-A1-1-like                      58.2    2e-07   Vitis vinifera
emb|CBI18982.3|  unnamed protein product                              57.8    3e-07   Vitis vinifera
ref|XP_011003420.1|  PREDICTED: cyclin-A1-1-like                      57.8    3e-07   Populus euphratica
ref|XP_002306649.1|  cyclin family protein                            57.8    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010684698.1|  PREDICTED: cyclin-A1-4-like                      57.4    4e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008219599.1|  PREDICTED: cyclin-A1-4-like                      57.4    4e-07   Prunus mume [ume]
ref|XP_009387253.1|  PREDICTED: cyclin-A1-4-like                      57.0    5e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008656316.1|  PREDICTED: cyclin-A1-4-like                      54.7    6e-07   
ref|XP_008806262.1|  PREDICTED: cyclin-A1-4 isoform X2                56.6    6e-07   Phoenix dactylifera
ref|XP_009399851.1|  PREDICTED: cyclin-A1-4-like                      56.6    6e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN35496.1|  Cyclin-A1-1                                           56.2    6e-07   Glycine soja [wild soybean]
dbj|BAC56853.1|  cyclin A1                                            56.6    7e-07   Silene latifolia
gb|KDO80523.1|  hypothetical protein CISIN_1g017988mg                 56.2    7e-07   Citrus sinensis [apfelsine]
ref|XP_003526649.1|  PREDICTED: cyclin-A1-1-like                      56.6    7e-07   Glycine max [soybeans]
ref|XP_010530202.1|  PREDICTED: cyclin-A1-1                           56.6    7e-07   Tarenaya hassleriana [spider flower]
ref|XP_008806186.1|  PREDICTED: cyclin-A1-4 isoform X1                56.6    7e-07   Phoenix dactylifera
ref|NP_001237800.1|  mitotic cyclin a2-type                           56.6    8e-07   Glycine max [soybeans]
gb|KDP32823.1|  hypothetical protein JCGZ_12115                       56.6    8e-07   Jatropha curcas
ref|XP_007223288.1|  hypothetical protein PRUPE_ppa005557mg           56.2    9e-07   
gb|KJB59298.1|  hypothetical protein B456_009G248300                  56.2    9e-07   Gossypium raimondii
gb|KHG05847.1|  Cyclin-A1-1 -like protein                             56.2    1e-06   Gossypium arboreum [tree cotton]
ref|XP_008783212.1|  PREDICTED: cyclin-A1-4-like                      56.2    1e-06   Phoenix dactylifera
ref|XP_007019157.1|  Cyclin A1,1 isoform 1                            56.2    1e-06   
ref|XP_010664179.1|  PREDICTED: cyclin-A1-1-like                      55.8    1e-06   
ref|XP_004960667.1|  PREDICTED: cyclin-A1-3-like                      55.8    1e-06   Setaria italica
emb|CBI18983.3|  unnamed protein product                              55.5    1e-06   Vitis vinifera
ref|XP_010915932.1|  PREDICTED: cyclin-A1-4-like isoform X2           55.8    1e-06   
ref|XP_010915931.1|  PREDICTED: cyclin-A1-4-like isoform X1           55.8    1e-06   Elaeis guineensis
gb|KFK24211.1|  hypothetical protein AALP_AAs42301U000600             55.5    1e-06   Arabis alpina [alpine rockcress]
ref|XP_007137455.1|  hypothetical protein PHAVU_009G128200g           55.5    2e-06   Phaseolus vulgaris [French bean]
gb|AFK46051.1|  unknown                                               55.5    2e-06   Lotus japonicus
ref|XP_004149427.1|  PREDICTED: cyclin-A1-1-like                      55.5    2e-06   Cucumis sativus [cucumbers]
ref|XP_009343978.1|  PREDICTED: cyclin-A1-1-like                      55.5    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_006393746.1|  hypothetical protein EUTSA_v10011442mg           55.1    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_008338670.1|  PREDICTED: cyclin-A1-4                           55.1    2e-06   
gb|AIL50247.1|  Ttam-3D                                               55.1    3e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002457051.1|  hypothetical protein SORBIDRAFT_03g000520        55.1    3e-06   
ref|XP_006434258.1|  hypothetical protein CICLE_v10000927mg           54.7    3e-06   Citrus clementina [clementine]
ref|XP_006307397.1|  hypothetical protein CARUB_v10009020mg           54.7    3e-06   Capsella rubella
ref|XP_006472826.1|  PREDICTED: cyclin-A1-1-like                      54.7    3e-06   Citrus sinensis [apfelsine]
gb|AIL50245.1|  Ttam-3A                                               54.7    4e-06   Triticum turgidum [cone wheat]
dbj|BAJ94732.1|  predicted protein                                    54.3    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_175077.1|  cyclin-A1-1                                         53.9    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466750.1|  PREDICTED: cyclin-A1-1                           53.9    5e-06   Cucumis melo [Oriental melon]
gb|EEC70247.1|  hypothetical protein OsI_01036                        53.1    6e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_004160710.1|  PREDICTED: cyclin-A1-1-like                      53.9    6e-06   
ref|XP_009341345.1|  PREDICTED: cyclin-A1-4-like                      53.9    6e-06   Pyrus x bretschneideri [bai li]
ref|XP_010461434.1|  PREDICTED: cyclin-A1-1-like                      53.9    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_003566404.1|  PREDICTED: cyclin-A1-4-like                      53.9    7e-06   Brachypodium distachyon [annual false brome]
emb|CDM82517.1|  unnamed protein product                              53.5    7e-06   Triticum aestivum [Canadian hard winter wheat]
emb|CDY02719.1|  BnaC02g07160D                                        53.5    8e-06   
ref|XP_002893979.1|  CYCA1_1                                          53.5    8e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010500134.1|  PREDICTED: cyclin-A1-1-like                      53.5    8e-06   Camelina sativa [gold-of-pleasure]
gb|ACF80031.1|  unknown                                               53.5    8e-06   Zea mays [maize]
gb|ACR33952.1|  unknown                                               53.5    9e-06   Zea mays [maize]
ref|XP_010095430.1|  hypothetical protein L484_013387                 53.5    9e-06   Morus notabilis
ref|NP_001288521.1|  uncharacterized protein LOC103649996             53.5    9e-06   Zea mays [maize]
ref|XP_002455447.1|  hypothetical protein SORBIDRAFT_03g010940        53.5    9e-06   Sorghum bicolor [broomcorn]
ref|XP_007225619.1|  hypothetical protein PRUPE_ppa004701mg           53.1    1e-05   Prunus persica
ref|NP_001042512.1|  Os01g0233500                                     53.1    1e-05   
ref|XP_008219598.1|  PREDICTED: cyclin-A1-1-like                      53.1    1e-05   Prunus mume [ume]
gb|ABG21984.1|  Cyclin, N-terminal domain containing protein, exp...  52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126172.1|  PREDICTED: cyclin-A1-1-like                      52.4    2e-05   Brassica rapa
ref|NP_001176910.1|  Os12g0298950                                     52.4    2e-05   
ref|XP_002454880.1|  hypothetical protein SORBIDRAFT_03g000690        52.4    2e-05   Sorghum bicolor [broomcorn]
sp|Q0INT0.2|CCA13_ORYSJ  RecName: Full=Cyclin-A1-3; AltName: Full...  52.4    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAA51660.1|  cyclin                                                52.4    2e-05   Brassica napus [oilseed rape]
gb|EEC70248.1|  hypothetical protein OsI_01039                        52.4    2e-05   Oryza sativa Indica Group [Indian rice]
emb|CDX85466.1|  BnaA02g03470D                                        52.4    2e-05   
ref|XP_006643958.1|  PREDICTED: cyclin-A1-1-like                      52.4    2e-05   
gb|KEH35323.1|  carboxy-terminal domain cyclin                        52.4    2e-05   Medicago truncatula
ref|XP_010095429.1|  hypothetical protein L484_013386                 52.0    2e-05   Morus notabilis
ref|XP_009145051.1|  PREDICTED: cyclin-A1-1                           51.6    3e-05   Brassica rapa
emb|CDY25649.1|  BnaC05g25280D                                        51.6    3e-05   Brassica napus [oilseed rape]
dbj|BAD81374.1|  putative type A-like cyclin                          51.2    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003566077.1|  PREDICTED: cyclin-A1-1-like                      51.2    4e-05   Brachypodium distachyon [annual false brome]
ref|XP_008653791.1|  PREDICTED: cyclin-A1-1-like                      48.5    5e-05   
ref|NP_001241939.1|  uncharacterized protein LOC100776207             50.8    7e-05   Glycine max [soybeans]
gb|KHN05188.1|  Cyclin-A1-1                                           50.8    7e-05   Glycine soja [wild soybean]
ref|XP_004292715.1|  PREDICTED: cyclin-A1-4-like                      50.4    7e-05   Fragaria vesca subsp. vesca
ref|XP_006645684.1|  PREDICTED: cyclin-A1-1-like                      50.4    9e-05   
ref|XP_010521286.1|  PREDICTED: cyclin-A1-2 isoform X2                50.1    1e-04   Tarenaya hassleriana [spider flower]
gb|AAA20237.1|  cyclin IIZm                                           50.1    1e-04   Zea mays [maize]
ref|XP_007019154.1|  Cyclin A1,1, putative isoform 1                  49.7    1e-04   
ref|XP_010521285.1|  PREDICTED: cyclin-A1-2 isoform X1                49.7    1e-04   Tarenaya hassleriana [spider flower]
ref|NP_001105387.1|  cyclin2                                          49.7    2e-04   
ref|XP_006859067.1|  hypothetical protein AMTR_s00068p00198800        49.3    2e-04   Amborella trichopoda
ref|XP_004290902.1|  PREDICTED: cyclin-A1-1                           49.3    2e-04   Fragaria vesca subsp. vesca
ref|XP_010532201.1|  PREDICTED: cyclin-A1-1-like isoform X2           49.3    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_010532200.1|  PREDICTED: cyclin-A1-1-like isoform X1           49.3    2e-04   Tarenaya hassleriana [spider flower]
gb|KHN38997.1|  Cyclin-A1-1                                           48.9    3e-04   Glycine soja [wild soybean]
ref|XP_003545652.1|  PREDICTED: cyclin-A1-1-like                      48.9    3e-04   Glycine max [soybeans]
ref|XP_004962646.1|  PREDICTED: cyclin-A1-1-like isoform X2           48.9    3e-04   
gb|AEV43294.1|  cyclin A1                                             46.2    3e-04   Nicotiana benthamiana
ref|XP_004962645.1|  PREDICTED: cyclin-A1-1-like isoform X1           48.5    3e-04   Setaria italica
gb|KFK38207.1|  hypothetical protein AALP_AA3G082800                  47.8    6e-04   Arabis alpina [alpine rockcress]
ref|XP_009343979.1|  PREDICTED: cyclin-A1-1-like                      47.4    0.001   Pyrus x bretschneideri [bai li]



>gb|ADA70359.1| mitotic cyclin A1-like protein [Persea americana]
Length=479

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LHNL  +SH    PAIREK SQHKYK VAKK CP++IP EFF D+
Sbjct  433  LHNLFCDSHSNSLPAIREKYSQHKYKFVAKKCCPSTIPLEFFYDL  477



>gb|KHG05394.1| CYCA1-1: Cyclin-A1-1 [Gossypium arboreum]
Length=245

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N      PAIREK SQHKYK VAKK CP SIP EFF DV
Sbjct  201  LHHLCRNGGGANLPAIREKYSQHKYKFVAKKYCPASIPEEFFQDV  245



>emb|CDP10969.1| unnamed protein product [Coffea canephora]
Length=504

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH+L   SH+   PAIREK SQHKYK VAKK CP SIP EFF +V S
Sbjct  458  LHSLCSGSHNSSLPAIREKYSQHKYKFVAKKYCPPSIPPEFFQNVSS  504



>ref|XP_007019146.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16371.1| Cyclin A1,1, putative [Theobroma cacao]
Length=126

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N      PAIREK SQHKYK VAKK CP SIP EFF D+
Sbjct  80   LHHLCRNGGRANLPAIREKYSQHKYKFVAKKYCPASIPQEFFQDL  124



>ref|XP_010260855.1| PREDICTED: cyclin-A1-4 [Nelumbo nucifera]
Length=497

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L  NS +   PAIREK SQHKYK VAKK CP SIP E+F D+ S
Sbjct  450  LHRLFCNSFNTSLPAIREKYSQHKYKFVAKKYCPPSIPVEYFHDISS  496



>ref|XP_010925928.1| PREDICTED: cyclin-A1-4 [Elaeis guineensis]
Length=491

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NS     PA+REK SQHKYK VAKK CP SIP EFF D
Sbjct  445  LHRLFRNSAGSSLPAVREKYSQHKYKFVAKKYCPPSIPSEFFED  488



>ref|XP_011102309.1| PREDICTED: cyclin-A1-1 [Sesamum indicum]
Length=495

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L  NSH+   PAIREK SQHKYK VAKK CP S+P E+F D  S
Sbjct  449  LHGLCCNSHNSSLPAIREKYSQHKYKFVAKKYCPPSVPPEYFHDESS  495



>ref|XP_010063417.1| PREDICTED: cyclin-A1-1 [Eucalyptus grandis]
 gb|KCW70645.1| hypothetical protein EUGRSUZ_F03815 [Eucalyptus grandis]
Length=498

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L  N+H    PAIREK SQHKYK VAKK CP SIP EFF ++
Sbjct  452  LHRLCFNNHGSTLPAIREKYSQHKYKYVAKKYCPPSIPPEFFHNL  496



>ref|XP_002520329.1| cyclin A, putative [Ricinus communis]
 gb|EEF42115.1| cyclin A, putative [Ricinus communis]
Length=498

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  N H+   PAIREK SQHKYK VAKK CP SIP EFF D
Sbjct  452  LHRLCCNGHNSTLPAIREKYSQHKYKFVAKKYCPPSIPQEFFHD  495



>dbj|BAE06271.1| cyclin A [Scutellaria baicalensis]
Length=496

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH    NSH+   PAIREK SQHKYK VAKK CP SIP E+F +V S
Sbjct  450  LHGFCCNSHNSSLPAIREKYSQHKYKFVAKKYCPLSIPPEYFHNVSS  496



>gb|EYU32511.1| hypothetical protein MIMGU_mgv1a005475mg [Erythranthe guttata]
Length=482

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L  NS     PA+REK SQHKYK VAKK CP SIP E+F +V S
Sbjct  436  LHGLCCNSQSSNLPAVREKYSQHKYKFVAKKYCPQSIPAEYFYNVSS  482



>gb|KJB64518.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64520.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=482

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N      PAIREK SQHKYK VAKK CP SIP EFF DV
Sbjct  438  LHHLCRNGGGANLPAIREKYSQHKYKFVAKKYCPASIPEEFFQDV  482



>ref|XP_007019153.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16378.1| Cyclin A1,1, putative [Theobroma cacao]
Length=499

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N      PAIREK SQHKYK VAKK CP SIP EFF D+
Sbjct  453  LHHLCRNGGRANLPAIREKYSQHKYKFVAKKYCPASIPQEFFQDL  497



>ref|XP_006386358.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
 gb|ERP64155.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
Length=499

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L   +H+   PAIREK SQHKYK VAKK CP SIP EFF ++ S
Sbjct  453  LHRLCCGNHNSTLPAIREKYSQHKYKFVAKKYCPPSIPGEFFQNLGS  499



>ref|XP_006351136.1| PREDICTED: cyclin-A1-3-like isoform X1 [Solanum tuberosum]
Length=488

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH+L  N+++   PA+REK SQHKYK VAKK CP ++P EFF ++ S
Sbjct  442  LHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  488



>ref|XP_006351138.1| PREDICTED: cyclin-A1-3-like isoform X3 [Solanum tuberosum]
Length=483

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH+L  N+++   PA+REK SQHKYK VAKK CP ++P EFF ++ S
Sbjct  437  LHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  483



>ref|XP_010312445.1| PREDICTED: cyclin A1 isoform X1 [Solanum lycopersicum]
Length=489

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH+L  N+++   PA+REK SQHKYK VAKK CP ++P EFF ++ S
Sbjct  443  LHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  489



>ref|NP_001233762.1| cyclin A1 [Solanum lycopersicum]
 emb|CAB46641.1| cyclin A1 [Solanum lycopersicum]
Length=490

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH+L  N+++   PA+REK SQHKYK VAKK CP ++P EFF ++ S
Sbjct  444  LHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  490



>ref|XP_006351137.1| PREDICTED: cyclin-A1-3-like isoform X2 [Solanum tuberosum]
Length=487

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH+L  N+++   PA+REK SQHKYK VAKK CP ++P EFF ++ S
Sbjct  441  LHSLCCNNNNSSLPAVREKYSQHKYKFVAKKYCPPTVPVEFFQNISS  487



>ref|XP_009796391.1| PREDICTED: cyclin-A1-4 [Nicotiana sylvestris]
 emb|CAA63543.1| cyclin A-like protein [Nicotiana tabacum]
Length=482

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N+++   PAIREK SQHKYK VAKK CP +IP EFF ++
Sbjct  436  LHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNI  480



>ref|XP_009593177.1| PREDICTED: cyclin-A1-4 isoform X1 [Nicotiana tomentosiformis]
Length=484

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N+++   PAIREK SQHKYK VAKK CP +IP EFF ++
Sbjct  438  LHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNI  482



>ref|XP_009593178.1| PREDICTED: cyclin-A1-4 isoform X2 [Nicotiana tomentosiformis]
Length=483

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N+++   PAIREK SQHKYK VAKK CP +IP EFF ++
Sbjct  437  LHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNI  481



>dbj|BAA09366.1| A-type cyclin [Nicotiana tabacum]
Length=483

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N+++   PAIREK SQHKYK VAKK CP +IP EFF ++
Sbjct  437  LHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNI  481



>emb|CAA63542.1| cyclin A-like protein [Nicotiana tabacum]
Length=483

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  N+++   PAIREK SQHKYK VAKK CP +IP EFF ++
Sbjct  437  LHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCPPTIPVEFFQNI  481



>ref|XP_011027473.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027474.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L   +H+   PAIREK SQHKYK VAKK CP SIP EFF ++
Sbjct  453  LHRLCCGNHNSTLPAIREKYSQHKYKFVAKKYCPPSIPGEFFQNL  497



>ref|XP_011027470.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027471.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L   +H+   PAIREK SQHKYK VAKK CP SIP EFF ++
Sbjct  453  LHRLCCGNHNSTLPAIREKYSQHKYKFVAKKYCPPSIPGEFFQNL  497



>ref|XP_004967382.1| PREDICTED: cyclin-A1-1-like [Setaria italica]
Length=506

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L         PAIREK SQHKYK VAKK CPTSIP EFF DV
Sbjct  460  LHHLFSVGPASNLPAIREKYSQHKYKFVAKKQCPTSIPTEFFRDV  504



>ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=495

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  N+H+   PAIREK SQHKYK VAKK CP SIP E F
Sbjct  449  LHRLCCNNHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELF  490



>emb|CBI18982.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  N+H+   PAIREK SQHKYK VAKK CP SIP E F
Sbjct  504  LHRLCCNNHNSSLPAIREKYSQHKYKFVAKKYCPPSIPSELF  545



>ref|XP_011003420.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=493

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            L+ L   SH+   PAIREK SQHKYK VAKK CP SIP EFF ++
Sbjct  447  LYRLCCGSHNSTLPAIREKYSQHKYKFVAKKYCPPSIPEEFFQNL  491



>ref|XP_002306649.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93645.1| cyclin family protein [Populus trichocarpa]
Length=493

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            L+ L   SH+   PAIREK SQHKYK VAKK CP SIP EFF ++
Sbjct  447  LYRLCCGSHNSTLPAIREKYSQHKYKFVAKKYCPPSIPEEFFQNL  491



>ref|XP_010684698.1| PREDICTED: cyclin-A1-4-like [Beta vulgaris subsp. vulgaris]
Length=504

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L  +SH    PAIREK SQHKYK VAKK CP +IP E+F    S
Sbjct  458  LHQLCLSSHSSTLPAIREKYSQHKYKFVAKKCCPPTIPSEYFHSTSS  504



>ref|XP_008219599.1| PREDICTED: cyclin-A1-4-like [Prunus mume]
Length=514

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L  N      PA+REK  QHKYK VAKK CP SIP EFF D+ S
Sbjct  468  LHRLCCNGCSSDLPAVREKYCQHKYKFVAKKYCPPSIPTEFFQDLNS  514



>ref|XP_009387253.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=493

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L   S     PAIREK SQHKYK VAKK CP SIP E+F D 
Sbjct  447  LHRLFCTSSGNNLPAIREKYSQHKYKFVAKKYCPASIPAEYFQDA  491



>ref|XP_008656316.1| PREDICTED: cyclin-A1-4-like [Zea mays]
Length=194

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L         PAIREK SQHKYK VAKK CP SIP +FF D+ S
Sbjct  148  LHRLFRLGPGSNLPAIREKYSQHKYKFVAKKYCPQSIPTKFFQDLTS  194



>ref|XP_008806262.1| PREDICTED: cyclin-A1-4 isoform X2 [Phoenix dactylifera]
Length=425

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  +S     PAIREK SQHKYK VAKK CP SIP EFF D
Sbjct  379  LHQLFHSSPGSSLPAIREKYSQHKYKFVAKKYCPPSIPSEFFQD  422



>ref|XP_009399851.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=495

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L   S     PAIREK SQHKYK VAKK CP SIP ++F D
Sbjct  449  LHRLFCTSAGNNLPAIREKYSQHKYKFVAKKYCPASIPLDYFQD  492



>gb|KHN35496.1| Cyclin-A1-1 [Glycine soja]
Length=348

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS +   PAIREK SQHKYK VAKK CP SIP EFF
Sbjct  305  LHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPPSIPPEFF  346



>dbj|BAC56853.1| cyclin A1 [Silene latifolia]
Length=487

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NSH    PAIREK S HKYK VAKK CP+SIP E+F +
Sbjct  441  LHQLCLNSHISSLPAIREKYSHHKYKSVAKKHCPSSIPAEYFQN  484



>gb|KDO80523.1| hypothetical protein CISIN_1g017988mg [Citrus sinensis]
Length=362

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS     PAIREK S HKYK VAKK CP SIP EFF
Sbjct  317  LHRLYCNSQSSTLPAIREKYSLHKYKCVAKKYCPPSIPPEFF  358



>ref|XP_003526649.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=480

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NS +   PAIREK SQHKYK VAKK CP SIP EFF +
Sbjct  437  LHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPPSIPPEFFQN  480



>ref|XP_010530202.1| PREDICTED: cyclin-A1-1 [Tarenaya hassleriana]
Length=493

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  N+H    PA+REK SQHKYK VAKK CP  IP EFF
Sbjct  448  LHGLCCNAHTSTLPAVREKYSQHKYKFVAKKFCPPIIPSEFF  489



>ref|XP_008806186.1| PREDICTED: cyclin-A1-4 isoform X1 [Phoenix dactylifera]
Length=493

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  +S     PAIREK SQHKYK VAKK CP SIP EFF D
Sbjct  447  LHQLFHSSPGSSLPAIREKYSQHKYKFVAKKYCPPSIPSEFFQD  490



>ref|NP_001237800.1| mitotic cyclin a2-type [Glycine max]
 dbj|BAA09466.1| mitotic cyclin a2-type [Glycine max]
Length=484

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NS +   PAIREK SQHKYK VAKK CP SIP EFF +
Sbjct  441  LHRLCCNSPNSNLPAIREKYSQHKYKYVAKKYCPPSIPPEFFQN  484



>gb|KDP32823.1| hypothetical protein JCGZ_12115 [Jatropha curcas]
Length=494

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L   SH+   PAIREK SQHKYK VAKK CP SIP E+F
Sbjct  449  LHCLCCGSHNSTLPAIREKYSQHKYKFVAKKYCPPSIPQEYF  490



>ref|XP_007223288.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
 gb|EMJ24487.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
Length=454

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L  N      PA+REK  QHKYK VAKK CP SIP EFF D+
Sbjct  408  LHRLCCNGCSSDLPAVREKYCQHKYKFVAKKYCPPSIPTEFFQDL  452



>gb|KJB59298.1| hypothetical protein B456_009G248300 [Gossypium raimondii]
Length=489

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  N+++   PAIREK SQHKYK VAKK CP SIP +FF
Sbjct  446  LHRLCCNNNNSTLPAIREKYSQHKYKCVAKKYCPPSIPSDFF  487



>gb|KHG05847.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=489

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  N+++   PAIREK SQHKYK VAKK CP SIP +FF
Sbjct  446  LHRLCCNNNNSTLPAIREKYSQHKYKCVAKKYCPPSIPSDFF  487



>ref|XP_008783212.1| PREDICTED: cyclin-A1-4-like [Phoenix dactylifera]
Length=534

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NS     PAIREK SQHK+K VAKK CP SIP E F D
Sbjct  488  LHRLFLNSFGSSLPAIREKYSQHKFKFVAKKNCPPSIPSELFRD  531



>ref|XP_007019157.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
 gb|EOY16382.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
Length=493

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  N+ +   PAIREK +QHKYK VAKK CP SIP EFF +
Sbjct  450  LHRLCCNNQNSTLPAIREKYNQHKYKCVAKKYCPPSIPSEFFQN  493



>ref|XP_010664179.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=424

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH+L  N+H    PAI+EK SQHKYK VAKK CP  +P EFF D
Sbjct  378  LHHLCCNNHGSGLPAIKEKYSQHKYKFVAKKYCPPCVPPEFFED  421



>ref|XP_004960667.1| PREDICTED: cyclin-A1-3-like [Setaria italica]
Length=476

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDVXS  203
            LH L         PAIREK SQHKYK VAKK CP SIP EFF D  S
Sbjct  430  LHRLFCFGPGRDLPAIREKYSQHKYKFVAKKYCPPSIPTEFFQDATS  476



>emb|CBI18983.3| unnamed protein product [Vitis vinifera]
Length=343

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH+L  N+H    PAI+EK SQHKYK VAKK CP  +P EFF D
Sbjct  297  LHHLCCNNHGSGLPAIKEKYSQHKYKFVAKKYCPPCVPPEFFED  340



>ref|XP_010915932.1| PREDICTED: cyclin-A1-4-like isoform X2 [Elaeis guineensis]
Length=533

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS     PA+REK SQHK+K VAKK CP SIP EFF
Sbjct  487  LHRLFLNSSGSSLPAVREKYSQHKFKFVAKKNCPPSIPSEFF  528



>ref|XP_010915931.1| PREDICTED: cyclin-A1-4-like isoform X1 [Elaeis guineensis]
Length=534

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS     PA+REK SQHK+K VAKK CP SIP EFF
Sbjct  488  LHRLFLNSSGSSLPAVREKYSQHKFKFVAKKNCPPSIPSEFF  529



>gb|KFK24211.1| hypothetical protein AALP_AAs42301U000600 [Arabis alpina]
Length=444

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L  N+H    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  400  LQRLCSNAHASTLPAVREKYSQHKYKFVAKKFCPSIIPQEFF  441



>ref|XP_007137455.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
 gb|ESW09449.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
Length=488

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS +   PAI+EK SQHKYK VAKK CP SIP EFF
Sbjct  445  LHRLCGNSPNTNLPAIKEKYSQHKYKYVAKKYCPPSIPQEFF  486



>gb|AFK46051.1| unknown [Lotus japonicus]
Length=507

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NS +   PAI+EK SQHKYK VAKK CP SIP EFF +
Sbjct  464  LHRLFCNSPNSNLPAIKEKYSQHKYKYVAKKYCPPSIPSEFFQN  507



>ref|XP_004149427.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
 gb|KGN47698.1| hypothetical protein Csa_6G382370 [Cucumis sativus]
Length=506

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -1

Query  343  LHNLX-XNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L   N+H+   PAIREK SQHKYK VAKK CP +IP EFF +
Sbjct  459  LHGLCCNNTHNSSLPAIREKYSQHKYKHVAKKYCPPTIPPEFFQN  503



>ref|XP_009343978.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=515

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L  N      PAIREK  QHKYK VAKK CP SIP EFF D+
Sbjct  469  LHQLCCNGCGSNLPAIREKYCQHKYKFVAKKYCPPSIPPEFFQDL  513



>ref|XP_006393746.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
 gb|ESQ31032.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
Length=481

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L  N+H    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  437  LQRLCSNAHVSTLPAVREKYSQHKYKFVAKKFCPSIIPQEFF  478



>ref|XP_008338670.1| PREDICTED: cyclin-A1-4 [Malus domestica]
Length=522

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L  N      PA+REK  QHKYK VAKK CP SIP EFF D+
Sbjct  476  LHQLCCNGCGSNLPAVREKYCQHKYKFVAKKYCPPSIPPEFFQDL  520



>gb|AIL50247.1| Ttam-3D [Triticum aestivum]
Length=510

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK V KK CPTS+P EFF D 
Sbjct  464  LHRLFSVGPGSNLPAIREKYSQHKYKFVGKKQCPTSVPAEFFRDA  508



>ref|XP_002457051.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
 gb|EES02171.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
Length=533

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VA+K CP SIP EFF DV
Sbjct  462  LHRLFSVGPGSNLPAIREKYSQHKYKFVARKQCPPSIPTEFFRDV  506



>ref|XP_006434258.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
 gb|ESR47498.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
Length=503

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS     PAIREK S HKYK VAKK CP SIP EFF
Sbjct  458  LHRLYCNSQSSTLPAIREKYSLHKYKCVAKKYCPPSIPPEFF  499



>ref|XP_006307397.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
 gb|EOA40295.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
Length=476

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L   SH    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  432  LQRLCSTSHGSTLPAVREKYSQHKYKFVAKKFCPSIIPQEFF  473



>ref|XP_006472826.1| PREDICTED: cyclin-A1-1-like [Citrus sinensis]
Length=503

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  NS     PAIREK S HKYK VAKK CP SIP EFF
Sbjct  458  LHRLCCNSQSSTLPAIREKYSLHKYKCVAKKYCPPSIPPEFF  499



>gb|AIL50245.1| Ttam-3A [Triticum turgidum]
Length=513

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK SQHKYK V KK CPTS+P EFF D
Sbjct  467  LHRLFSVGPGSNLPAIREKYSQHKYKFVGKKQCPTSVPAEFFRD  510



>dbj|BAJ94732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK SQHKYK V KK CPTS+P EFF D
Sbjct  469  LHRLFSVGPGSNLPAIREKYSQHKYKFVGKKQCPTSVPAEFFRD  512



>ref|NP_175077.1| cyclin-A1-1 [Arabidopsis thaliana]
 sp|Q9C6Y3.1|CCA11_ARATH RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Arabidopsis thaliana]
 gb|AAG50557.1|AC074228_12 mitotic cyclin a2-type, putative [Arabidopsis thaliana]
 dbj|BAD43169.1| putative mitotic cyclin a2-type [Arabidopsis thaliana]
 gb|AEE32021.1| cyclin-A1-1 [Arabidopsis thaliana]
Length=460

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L   +H    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  416  LQRLCSTAHGSTLPAVREKYSQHKYKFVAKKFCPSVIPQEFF  457



>ref|XP_008466750.1| PREDICTED: cyclin-A1-1 [Cucumis melo]
Length=507

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -1

Query  343  LHNLX-XNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L   N+H+   PAIREK SQHKYK VAKK CP +IP EFF
Sbjct  460  LHGLCCNNTHNSSLPAIREKYSQHKYKHVAKKYCPPTIPPEFF  502



>gb|EEC70247.1| hypothetical protein OsI_01036 [Oryza sativa Indica Group]
Length=262

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK +QHKYK VAKK CP S+P EFF DV
Sbjct  216  LHRLFSVGPGSNLPAIREKYTQHKYKFVAKKHCPPSVPSEFFRDV  260



>ref|XP_004160710.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
Length=506

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -1

Query  343  LHNLX-XNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L   N+H+   PAIREK SQHKYK VAKK CP +IP EFF
Sbjct  459  LHGLCCNNTHNSSLPAIREKYSQHKYKHVAKKYCPPTIPPEFF  501



>ref|XP_009341345.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341346.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341352.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341353.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
Length=521

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH+L  N      PA+REK SQHKYK VAKK CP SIP E F D
Sbjct  475  LHHLCCNGCGSNLPAVREKYSQHKYKFVAKKYCPLSIPPELFQD  518



>ref|XP_010461434.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=486

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L   +H    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  442  LQRLCSTAHGSTLPAVREKYSQHKYKFVAKKFCPSVIPQEFF  483



>ref|XP_003566404.1| PREDICTED: cyclin-A1-4-like [Brachypodium distachyon]
Length=482

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP SIP EFF D 
Sbjct  436  LHLLFRVGPGSNLPAIREKYSQHKYKFVAKKYCPPSIPVEFFQDT  480



>emb|CDM82517.1| unnamed protein product [Triticum aestivum]
 gb|AIL50246.1| Ttam-3B [Triticum turgidum]
Length=510

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK V KK CP+S+P EFF D 
Sbjct  464  LHRLFSVGPGSNLPAIREKYSQHKYKFVGKKQCPSSVPAEFFRDA  508



>emb|CDY02719.1| BnaC02g07160D [Brassica napus]
Length=429

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L  N+H    PA+R+K SQHKYK VAKK CP+ IP EFF
Sbjct  385  LQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPEFF  426



>ref|XP_002893979.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70238.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L   +H    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  423  LQRLCSTAHGSTLPAVREKYSQHKYKFVAKKFCPSIIPQEFF  464



>ref|XP_010500134.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=474

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L   +H    PA+REK SQHKYK VAKK CP+ IP EFF
Sbjct  430  LQRLCITAHGSTLPAVREKYSQHKYKFVAKKFCPSVIPQEFF  471



>gb|ACF80031.1| unknown [Zea mays]
Length=502

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP  IP EFF D 
Sbjct  456  LHRLSSVGPGSNLPAIREKYSQHKYKFVAKKQCPPQIPAEFFRDA  500



>gb|ACR33952.1| unknown [Zea mays]
Length=527

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP  IP EFF D 
Sbjct  481  LHRLSSVGPGSNLPAIREKYSQHKYKFVAKKQCPPQIPAEFFRDA  525



>ref|XP_010095430.1| hypothetical protein L484_013387 [Morus notabilis]
 gb|EXB60122.1| hypothetical protein L484_013387 [Morus notabilis]
Length=495

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  N+H+   PAIREK SQHKYK VAKK  P  IP EFF
Sbjct  452  LHRLCSNNHNSSLPAIREKYSQHKYKYVAKKYVPPMIPPEFF  493



>ref|NP_001288521.1| uncharacterized protein LOC103649996 [Zea mays]
 ref|XP_008673897.1| PREDICTED: cyclin-A1-1 [Zea mays]
 ref|XP_008673900.1| PREDICTED: cyclin-A1-1-like [Zea mays]
 gb|ACF87709.1| unknown [Zea mays]
Length=509

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK SQHKYK VAKK CP  IP EFF D
Sbjct  463  LHRLCSVGSGSNLPAIREKYSQHKYKFVAKKQCPPQIPTEFFRD  506



>ref|XP_002455447.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
 gb|EES00567.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
Length=505

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP  IP EFF D 
Sbjct  459  LHRLCSVGSGTNLPAIREKYSQHKYKFVAKKQCPPQIPTEFFRDA  503



>ref|XP_007225619.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
 gb|EMJ26818.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
Length=495

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEF  221
            LH L  NS     PAIREK SQHKYK VAKK CP +IP E+
Sbjct  453  LHRLCCNSQSSSLPAIREKYSQHKYKHVAKKYCPPTIPSEY  493



>ref|NP_001042512.1| Os01g0233500 [Oryza sativa Japonica Group]
 sp|Q7F830.1|CCA11_ORYSJ RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Oryza sativa Japonica Group]
 dbj|BAA86628.1| cyclin [Oryza sativa]
 dbj|BAA96590.1| putative type A-like cyclin [Oryza sativa Japonica Group]
 dbj|BAF04426.1| Os01g0233500 [Oryza sativa Japonica Group]
Length=508

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK +QHKYK VAKK CP SIP EFF D
Sbjct  462  LHRLFSVGPGSNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  505



>ref|XP_008219598.1| PREDICTED: cyclin-A1-1-like [Prunus mume]
Length=496

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEF  221
            LH L  NS     PAIREK SQHKYK VAKK CP +IP E+
Sbjct  454  LHRLCCNSQSSSLPAIREKYSQHKYKHVAKKYCPPTIPSEY  494



>gb|ABG21984.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABG21985.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE53081.1| hypothetical protein OsJ_35837 [Oryza sativa Japonica Group]
Length=345

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK +QHKYK VAKK CP SIP EFF D
Sbjct  299  LHRLFCVGPGSNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  342



>ref|XP_009126172.1| PREDICTED: cyclin-A1-1-like [Brassica rapa]
Length=426

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L  N+H    PA+R+K SQHKYK VAKK CP+ IP +FF
Sbjct  380  LQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPDFF  421



>ref|NP_001176910.1| Os12g0298950 [Oryza sativa Japonica Group]
 dbj|BAH95638.1| Os12g0298950 [Oryza sativa Japonica Group]
Length=391

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK +QHKYK VAKK CP SIP EFF D
Sbjct  345  LHRLFCVGPGSNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  388



>ref|XP_002454880.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
 gb|EER99999.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
Length=502

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP  IP EFF D 
Sbjct  457  LHRLFSVGPGSNLPAIREKYSQHKYKFVAKKQCPPQIPTEFFRDT  501



>sp|Q0INT0.2|CCA13_ORYSJ RecName: Full=Cyclin-A1-3; AltName: Full=G2/mitotic-specific 
cyclin-A1-3; Short=CycA1;3 [Oryza sativa Japonica Group]
 gb|ABG21983.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=491

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK +QHKYK VAKK CP SIP EFF D
Sbjct  445  LHRLFCVGPGSNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  488



>gb|AAA51660.1| cyclin [Brassica napus]
Length=425

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L  N+H    PA+R+K SQHKYK VAKK CP+ IP +FF
Sbjct  379  LQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPDFF  420



>gb|EEC70248.1| hypothetical protein OsI_01039 [Oryza sativa Indica Group]
Length=506

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK +QHKYK VAKK CP SIP EFF D
Sbjct  460  LHRLFCVGPGSNLPAIREKYTQHKYKFVAKKPCPPSIPTEFFRD  503



>emb|CDX85466.1| BnaA02g03470D [Brassica napus]
Length=422

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L  L  N+H    PA+R+K SQHKYK VAKK CP+ IP +FF
Sbjct  376  LQRLCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPDFF  417



>ref|XP_006643958.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=496

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK SQHKYK VAKK CP S+P EFF +
Sbjct  450  LHRLFSVGPGSNLPAIREKYSQHKYKFVAKKHCPPSVPTEFFRN  493



>gb|KEH35323.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=505

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L  NS +   PAI+EK +QHKYK VA K CP SIP EFF +
Sbjct  462  LHRLCCNSPNSNLPAIKEKYNQHKYKYVANKYCPPSIPQEFFQN  505



>ref|XP_010095429.1| hypothetical protein L484_013386 [Morus notabilis]
 gb|EXB60121.1| hypothetical protein L484_013386 [Morus notabilis]
Length=498

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH+L  +  +   PAIREK S HKYK VA+K CP S+P EFF D+
Sbjct  452  LHHLWCSGSNSNLPAIREKYSHHKYKFVAQKYCPLSLPPEFFQDL  496



>ref|XP_009145051.1| PREDICTED: cyclin-A1-1 [Brassica rapa]
 emb|CDY65994.1| BnaA05g35600D [Brassica napus]
Length=443

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            L     N+H    PA+R+K SQHKYK VAKK CP+ IP EFF
Sbjct  392  LQRFCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPEFF  433



>emb|CDY25649.1| BnaC05g25280D [Brassica napus]
Length=437

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            L     N+H    PA+R+K SQHKYK VAKK CP+ IP EFF +
Sbjct  386  LQRFCSNAHVSTLPAVRDKYSQHKYKFVAKKFCPSIIPPEFFNN  429



>dbj|BAD81374.1| putative type A-like cyclin [Oryza sativa Japonica Group]
Length=521

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK +QHKYK VAKK CP S+P EFF D
Sbjct  475  LHRLFSVGPGSNLPAIREKYTQHKYKFVAKKHCPPSVPSEFFRD  518



>ref|XP_003566077.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=510

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH L         PAIREK SQHKYK VAKK CP  +P +FF D
Sbjct  464  LHRLFSVGPGSNLPAIREKYSQHKYKFVAKKQCPPLVPADFFRD  507



>ref|XP_008653791.1| PREDICTED: cyclin-A1-1-like [Zea mays]
Length=124

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         P+I EK SQHKYK VAKK CP  IP EFF D 
Sbjct  78   LHRLSSVGPGSNLPSITEKYSQHKYKFVAKKQCPPQIPAEFFKDA  122



>ref|NP_001241939.1| uncharacterized protein LOC100776207 [Glycine max]
 gb|ACU22685.1| unknown [Glycine max]
Length=503

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  +SH    PAIR+K SQHKYK VAKK  P SIP E F
Sbjct  460  LHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKCIPPSIPQEVF  501



>gb|KHN05188.1| Cyclin-A1-1 [Glycine soja]
Length=503

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  +SH    PAIR+K SQHKYK VAKK  P SIP E F
Sbjct  460  LHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKCIPPSIPQEVF  501



>ref|XP_004292715.1| PREDICTED: cyclin-A1-4-like [Fragaria vesca subsp. vesca]
Length=506

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH+L  N       A+REK  QHKYK VAKK CP SIP EFF D
Sbjct  460  LHHLCCNGSGSNLAAVREKYCQHKYKFVAKKYCPPSIPPEFFHD  503



>ref|XP_006645684.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=538

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP S+P EFF + 
Sbjct  492  LHRLFSVGPGSNLPAIREKYSQHKYKFVAKKHCPPSVPTEFFRNA  536



>ref|XP_010521286.1| PREDICTED: cyclin-A1-2 isoform X2 [Tarenaya hassleriana]
Length=493

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  319  HHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            H    PA+R+K SQHKYK  AKK CP S+P EFF
Sbjct  458  HSCSVPAVRKKYSQHKYKFAAKKFCPASVPPEFF  491



>gb|AAA20237.1| cyclin IIZm, partial [Zea mays]
Length=456

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 27/46 (59%), Gaps = 1/46 (2%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIP-FEFFXDV  209
            LH L         PAIREK SQHKYK VAKK CP  IP  EFF D 
Sbjct  407  LHRLCSVGSGSNLPAIREKYSQHKYKFVAKKQCPPQIPSLEFFRDA  452



>ref|XP_007019154.1| Cyclin A1,1, putative isoform 1 [Theobroma cacao]
 gb|EOY16379.1| Cyclin A1,1, putative isoform 1 [Theobroma cacao]
Length=393

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            LH+L  N       AI++K SQHKYK VA+K CP+SIP EFF D
Sbjct  350  LHHLCLNGDCPNLAAIKQKYSQHKYKFVAEKDCPSSIPQEFFRD  393



>ref|XP_010521285.1| PREDICTED: cyclin-A1-2 isoform X1 [Tarenaya hassleriana]
Length=518

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -1

Query  319  HHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            H    PA+R+K SQHKYK  AKK CP S+P EFF
Sbjct  483  HSCSVPAVRKKYSQHKYKFAAKKFCPASVPPEFF  516



>ref|NP_001105387.1| cyclin2 [Zea mays]
 gb|AAC50013.1| type A-like cyclin [Zea mays]
Length=502

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            LH L         PAIREK SQHKYK VAKK  P  IP EFF D 
Sbjct  456  LHRLSSVGPGSNLPAIREKYSQHKYKFVAKKQSPPQIPAEFFRDA  500



>ref|XP_006859067.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
 gb|ERN20534.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
Length=498

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -1

Query  322  SHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXD  212
            S +   PAIREK SQHKYK VAK  CP +IP EFF D
Sbjct  462  SSNTNLPAIREKYSQHKYKCVAKYPCPPAIPAEFFQD  498



>ref|XP_004290902.1| PREDICTED: cyclin-A1-1 [Fragaria vesca subsp. vesca]
Length=500

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEF  221
            LH L  ++ +   PAIREK SQHKYK VAK  CP +IP E+
Sbjct  458  LHRLCCDNQNSSLPAIREKYSQHKYKYVAKMYCPPTIPKEY  498



>ref|XP_010532201.1| PREDICTED: cyclin-A1-1-like isoform X2 [Tarenaya hassleriana]
Length=501

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L   +     PA+REK SQHKYK VA+K CP  IP EFF
Sbjct  455  LHRLCCGACTSTLPAVREKYSQHKYKFVARKFCPPIIPPEFF  496



>ref|XP_010532200.1| PREDICTED: cyclin-A1-1-like isoform X1 [Tarenaya hassleriana]
Length=503

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L   +     PA+REK SQHKYK VA+K CP  IP EFF
Sbjct  457  LHRLCCGACTSTLPAVREKYSQHKYKFVARKFCPPIIPPEFF  498



>gb|KHN38997.1| Cyclin-A1-1 [Glycine soja]
Length=504

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  +SH    PAIR+K SQHKYK VAKK  P SIP E F
Sbjct  460  LHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKHIPPSIPREVF  501



>ref|XP_003545652.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=504

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFF  218
            LH L  +SH    PAIR+K SQHKYK VAKK  P SIP E F
Sbjct  460  LHRLCCSSHDSNLPAIRDKYSQHKYKCVAKKHIPPSIPREVF  501



>ref|XP_004962646.1| PREDICTED: cyclin-A1-1-like isoform X2 [Setaria italica]
Length=511

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  304  PAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            PA+REK  QHKYK VAK  CP SIP  FF DV
Sbjct  478  PAVREKYGQHKYKFVAKLRCPASIPTGFFEDV  509



>gb|AEV43294.1| cyclin A1 [Nicotiana benthamiana]
Length=127

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICP  242
            LH+L  N+++   PAIREK SQHKYK VAKK CP
Sbjct  92   LHSLCCNNNNSSLPAIREKYSQHKYKFVAKKYCP  125



>ref|XP_004962645.1| PREDICTED: cyclin-A1-1-like isoform X1 [Setaria italica]
Length=509

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -1

Query  304  PAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            PA+REK  QHKYK VAK  CP SIP  FF DV
Sbjct  476  PAVREKYGQHKYKFVAKLRCPASIPTGFFEDV  507



>gb|KFK38207.1| hypothetical protein AALP_AA3G082800 [Arabis alpina]
Length=399

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 3/45 (7%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEFFXDV  209
            L  L  N+H     A+REK SQHKYK VA K+CP+ IP EFF ++
Sbjct  358  LQRLSSNAHAF---AVREKYSQHKYKFVAYKLCPSIIPQEFFNNI  399



>ref|XP_009343979.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=498

 Score = 47.4 bits (111),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  343  LHNLXXNSHHXXXPAIREKXSQHKYKXVAKKICPTSIPFEF  221
            LH L  +S     PAIREK SQHKYK VAK  CP +IP ++
Sbjct  456  LHRLCCDSQTSSLPAIREKYSQHKYKYVAKMHCPPTIPSKY  496



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556620951360