BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044P12

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13650.1|  unnamed protein product                                131   4e-33   Coffea canephora [robusta coffee]
ref|XP_011095627.1|  PREDICTED: KH domain-containing protein At5g...    129   3e-32   Sesamum indicum [beniseed]
ref|XP_011095628.1|  PREDICTED: KH domain-containing protein At5g...    128   3e-32   Sesamum indicum [beniseed]
gb|KHN01498.1|  KH domain-containing protein                            127   4e-32   Glycine soja [wild soybean]
ref|XP_011000365.1|  PREDICTED: KH domain-containing protein At5g...    128   4e-32   Populus euphratica
gb|ABK95423.1|  unknown                                                 125   5e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006377999.1|  hypothetical protein POPTR_0011s17110g             128   6e-32   Populus trichocarpa [western balsam poplar]
gb|KJB63132.1|  hypothetical protein B456_009G454400                    124   6e-32   Gossypium raimondii
gb|KJB63133.1|  hypothetical protein B456_009G454400                    124   1e-31   Gossypium raimondii
ref|XP_003522828.1|  PREDICTED: KH domain-containing protein At5g...    127   1e-31   Glycine max [soybeans]
ref|XP_009762106.1|  PREDICTED: KH domain-containing protein At5g...    127   1e-31   Nicotiana sylvestris
ref|XP_009762105.1|  PREDICTED: KH domain-containing protein At5g...    126   2e-31   Nicotiana sylvestris
ref|XP_002274648.1|  PREDICTED: KH domain-containing protein At5g...    126   2e-31   Vitis vinifera
ref|XP_006452745.1|  hypothetical protein CICLE_v10009077mg             123   2e-31   
ref|XP_006452748.1|  hypothetical protein CICLE_v10009077mg             124   2e-31   
gb|KDP36322.1|  hypothetical protein JCGZ_09537                         125   4e-31   Jatropha curcas
ref|XP_010244820.1|  PREDICTED: KH domain-containing protein At5g...    125   4e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006474774.1|  PREDICTED: KH domain-containing protein At5g...    125   4e-31   Citrus sinensis [apfelsine]
ref|XP_003527575.1|  PREDICTED: KH domain-containing protein At5g...    125   4e-31   Glycine max [soybeans]
ref|XP_006452754.1|  hypothetical protein CICLE_v10009077mg             124   5e-31   
ref|XP_011097700.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    125   5e-31   Sesamum indicum [beniseed]
ref|XP_008813752.1|  PREDICTED: KH domain-containing protein At5g...    125   6e-31   Phoenix dactylifera
ref|XP_009620232.1|  PREDICTED: KH domain-containing protein At5g...    125   7e-31   Nicotiana tomentosiformis
ref|XP_008813751.1|  PREDICTED: KH domain-containing protein At5g...    125   7e-31   
ref|XP_002532938.1|  nucleic acid binding protein, putative             125   7e-31   Ricinus communis
ref|XP_009620233.1|  PREDICTED: KH domain-containing protein At5g...    125   7e-31   Nicotiana tomentosiformis
ref|XP_008813749.1|  PREDICTED: KH domain-containing protein At5g...    125   8e-31   
ref|XP_010092393.1|  KH domain-containing protein                       125   8e-31   Morus notabilis
ref|XP_008813750.1|  PREDICTED: KH domain-containing protein At5g...    124   9e-31   Phoenix dactylifera
gb|KJB63136.1|  hypothetical protein B456_009G454400                    124   9e-31   Gossypium raimondii
ref|XP_006452752.1|  hypothetical protein CICLE_v10009077mg             124   1e-30   
gb|KDO73992.1|  hypothetical protein CISIN_1g022785mg                   124   1e-30   Citrus sinensis [apfelsine]
ref|XP_006452751.1|  hypothetical protein CICLE_v10009077mg             124   1e-30   
gb|KJB63134.1|  hypothetical protein B456_009G454400                    124   1e-30   Gossypium raimondii
ref|XP_006452747.1|  hypothetical protein CICLE_v10009077mg             124   1e-30   Citrus clementina [clementine]
ref|XP_003598316.1|  KH domain-containing protein                       122   1e-30   
gb|KHG00195.1|  hypothetical protein F383_19595                         124   2e-30   Gossypium arboreum [tree cotton]
ref|XP_002299073.2|  KH domain-containing family protein                124   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006346087.1|  PREDICTED: KH domain-containing protein At5g...    124   2e-30   Solanum tuberosum [potatoes]
ref|XP_006346086.1|  PREDICTED: KH domain-containing protein At5g...    123   2e-30   Solanum tuberosum [potatoes]
ref|XP_011039862.1|  PREDICTED: KH domain-containing protein At5g...    123   3e-30   Populus euphratica
gb|KJB45527.1|  hypothetical protein B456_007G310100                    123   3e-30   Gossypium raimondii
gb|AGV54732.1|  KH domain-containing protein                            123   3e-30   Phaseolus vulgaris [French bean]
gb|KJB45526.1|  hypothetical protein B456_007G310100                    123   3e-30   Gossypium raimondii
ref|XP_008219133.1|  PREDICTED: KH domain-containing protein At5g...    123   4e-30   Prunus mume [ume]
ref|XP_006857601.1|  hypothetical protein AMTR_s00061p00100880          122   4e-30   Amborella trichopoda
ref|XP_007205649.1|  hypothetical protein PRUPE_ppa009341mg             123   4e-30   Prunus persica
ref|XP_008219129.1|  PREDICTED: KH domain-containing protein At5g...    123   4e-30   Prunus mume [ume]
ref|XP_007148648.1|  hypothetical protein PHAVU_005G003500g             122   5e-30   Phaseolus vulgaris [French bean]
ref|XP_008384622.1|  PREDICTED: KH domain-containing protein At5g...    122   5e-30   
ref|XP_010676134.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008805546.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   
ref|XP_010676133.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008353854.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   Malus domestica [apple tree]
ref|XP_008805547.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   Phoenix dactylifera
ref|XP_004499705.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   Cicer arietinum [garbanzo]
ref|XP_008805544.1|  PREDICTED: KH domain-containing protein At5g...    122   6e-30   Phoenix dactylifera
ref|XP_003598315.1|  KH domain-containing protein                       122   7e-30   Medicago truncatula
ref|XP_008805543.1|  PREDICTED: KH domain-containing protein At5g...    122   7e-30   
ref|XP_008805545.1|  PREDICTED: KH domain-containing protein At5g...    122   7e-30   Phoenix dactylifera
ref|XP_008805542.1|  PREDICTED: KH domain-containing protein At5g...    122   8e-30   Phoenix dactylifera
ref|XP_010252937.1|  PREDICTED: KH domain-containing protein At5g...    122   9e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004953739.1|  PREDICTED: KH domain-containing protein At5g...    122   1e-29   Setaria italica
ref|XP_009379123.1|  PREDICTED: KH domain-containing protein At5g...    122   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_002454368.1|  hypothetical protein SORBIDRAFT_04g029520          121   1e-29   Sorghum bicolor [broomcorn]
gb|EYU27503.1|  hypothetical protein MIMGU_mgv1a011068mg                121   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_004294880.1|  PREDICTED: KH domain-containing protein At5g...    120   3e-29   Fragaria vesca subsp. vesca
ref|XP_008447796.1|  PREDICTED: KH domain-containing protein At5g...    119   3e-29   
ref|NP_001132735.1|  hypothetical protein                               116   3e-29   
ref|NP_001141163.1|  uncharacterized protein LOC100273249               120   3e-29   Zea mays [maize]
gb|ACG35732.1|  nucleic acid binding protein                            120   3e-29   Zea mays [maize]
ref|XP_004139764.1|  PREDICTED: KH domain-containing protein At5g...    120   4e-29   Cucumis sativus [cucumbers]
ref|XP_004244007.1|  PREDICTED: KH domain-containing protein At5g...    120   6e-29   Solanum lycopersicum
ref|XP_010324228.1|  PREDICTED: KH domain-containing protein At5g...    119   6e-29   Solanum lycopersicum
ref|XP_004244006.1|  PREDICTED: KH domain-containing protein At5g...    120   6e-29   Solanum lycopersicum
ref|XP_008447797.1|  PREDICTED: KH domain-containing protein At5g...    119   6e-29   Cucumis melo [Oriental melon]
dbj|BAK03295.1|  predicted protein                                      118   6e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009346681.1|  PREDICTED: KH domain-containing protein At5g...    119   6e-29   Pyrus x bretschneideri [bai li]
ref|XP_010324227.1|  PREDICTED: KH domain-containing protein At5g...    120   7e-29   Solanum lycopersicum
ref|XP_010913290.1|  PREDICTED: KH domain-containing protein At5g...    118   9e-29   Elaeis guineensis
gb|ACN25994.1|  unknown                                                 115   1e-28   Zea mays [maize]
ref|XP_010913289.1|  PREDICTED: KH domain-containing protein At5g...    118   1e-28   
dbj|BAJ88160.1|  predicted protein                                      118   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647814.1|  PREDICTED: KH domain-containing protein At5g...    118   2e-28   Oryza brachyantha
ref|XP_010913287.1|  PREDICTED: KH domain-containing protein At5g...    118   2e-28   
ref|XP_010913288.1|  PREDICTED: KH domain-containing protein At5g...    118   3e-28   Elaeis guineensis
ref|XP_010913286.1|  PREDICTED: KH domain-containing protein At5g...    118   3e-28   Elaeis guineensis
ref|XP_010913285.1|  PREDICTED: KH domain-containing protein At5g...    118   3e-28   
ref|XP_010913282.1|  PREDICTED: KH domain-containing protein At5g...    118   3e-28   
ref|XP_010913284.1|  PREDICTED: KH domain-containing protein At5g...    118   3e-28   Elaeis guineensis
gb|EAZ24441.1|  hypothetical protein OsJ_08192                          117   4e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87341.1|  hypothetical protein OsI_08744                          117   6e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_003570477.1|  PREDICTED: KH domain-containing protein At5g...    116   8e-28   Brachypodium distachyon [annual false brome]
gb|ACN35020.1|  unknown                                                 116   1e-27   Zea mays [maize]
ref|XP_009407925.1|  PREDICTED: KH domain-containing protein At5g...    116   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD13019.1|  putative KH domain protein                             117   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010539129.1|  PREDICTED: KH domain-containing protein At4g...    115   1e-27   
ref|XP_010063216.1|  PREDICTED: KH domain-containing protein At5g...    115   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010063215.1|  PREDICTED: KH domain-containing protein At5g...    115   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010545297.1|  PREDICTED: KH domain-containing protein At4g...    115   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_010928018.1|  PREDICTED: KH domain-containing protein At5g...    114   8e-27   Elaeis guineensis
ref|XP_010928016.1|  PREDICTED: KH domain-containing protein At5g...    114   9e-27   Elaeis guineensis
ref|XP_010928019.1|  PREDICTED: KH domain-containing protein At5g...    114   9e-27   Elaeis guineensis
ref|XP_010928017.1|  PREDICTED: KH domain-containing protein At5g...    114   9e-27   Elaeis guineensis
ref|XP_009415555.1|  PREDICTED: KH domain-containing protein At5g...    113   1e-26   
ref|XP_009395891.1|  PREDICTED: KH domain-containing protein At5g...    113   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415554.1|  PREDICTED: KH domain-containing protein At5g...    113   1e-26   
ref|XP_009415552.1|  PREDICTED: KH domain-containing protein At5g...    113   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415553.1|  PREDICTED: KH domain-containing protein At5g...    113   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399821.1|  PREDICTED: KH domain-containing protein At5g...    113   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399829.1|  PREDICTED: KH domain-containing protein At5g...    112   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE77960.1|  unknown                                                 112   3e-26   Picea sitchensis
ref|XP_010539351.1|  PREDICTED: KH domain-containing protein At5g...    112   5e-26   
ref|XP_010929006.1|  PREDICTED: KH domain-containing protein At5g...    112   5e-26   Elaeis guineensis
ref|XP_004973255.1|  PREDICTED: KH domain-containing protein At4g...    111   9e-26   Setaria italica
ref|XP_009410310.1|  PREDICTED: KH domain-containing protein At5g...    109   1e-25   
ref|XP_007020328.1|  RNA-binding KH domain-containing protein           111   1e-25   
ref|XP_009410308.1|  PREDICTED: KH domain-containing protein At5g...    110   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410309.1|  PREDICTED: KH domain-containing protein At5g...    110   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_194378.2|  RNA-binding KH domain-containing protein              110   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284180.1|  hypothetical protein CARUB_v10005327mg             110   3e-25   Capsella rubella
ref|XP_010448266.1|  PREDICTED: KH domain-containing protein At4g...    110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010438749.1|  PREDICTED: KH domain-containing protein At4g...    110   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006413178.1|  hypothetical protein EUTSA_v10025796mg             110   3e-25   Eutrema salsugineum [saltwater cress]
gb|KFK29165.1|  hypothetical protein AALP_AA7G098000                    109   4e-25   Arabis alpina [alpine rockcress]
ref|XP_008782987.1|  PREDICTED: KH domain-containing protein At5g...    109   4e-25   Phoenix dactylifera
ref|XP_006401374.1|  hypothetical protein EUTSA_v10014150mg             108   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010433498.1|  PREDICTED: KH domain-containing protein At4g...    108   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002452631.1|  hypothetical protein SORBIDRAFT_04g029426          103   2e-24   
gb|AAM14070.1|  unknown protein                                         107   2e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42731.1|  BnaA03g48080D                                          107   2e-24   Brassica napus [oilseed rape]
ref|XP_009137598.1|  PREDICTED: KH domain-containing protein At4g...    107   2e-24   Brassica rapa
gb|AFB34202.1|  hypothetical protein CL3054Contig1_01                   102   3e-24   Larix decidua
emb|CAA18222.1|  putative protein                                       109   3e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92817.1|  BnaC07g40750D                                          106   4e-24   
emb|CDY66744.1|  BnaAnng22840D                                          106   5e-24   Brassica napus [oilseed rape]
ref|XP_009142357.1|  PREDICTED: KH domain-containing protein At4g...    106   8e-24   Brassica rapa
emb|CDY11960.1|  BnaC03g13860D                                          105   1e-23   Brassica napus [oilseed rape]
ref|XP_006280844.1|  hypothetical protein CARUB_v10026819mg             105   1e-23   Capsella rubella
ref|XP_002864436.1|  KH domain-containing protein                       105   1e-23   
ref|NP_200425.1|  KH domain-containing protein                          105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120127.1|  PREDICTED: KH domain-containing protein At5g...    103   3e-23   Brassica rapa
emb|CDX94326.1|  BnaC01g18580D                                          104   3e-23   
ref|XP_010942516.1|  PREDICTED: KH domain-containing protein At5g...    103   3e-23   
ref|XP_010942514.1|  PREDICTED: KH domain-containing protein At5g...    103   4e-23   Elaeis guineensis
ref|XP_010942515.1|  PREDICTED: KH domain-containing protein At5g...    103   4e-23   Elaeis guineensis
ref|XP_010443253.1|  PREDICTED: KH domain-containing protein At5g...    104   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002867563.1|  KH domain-containing protein                       106   4e-23   
ref|XP_010483081.1|  PREDICTED: KH domain-containing protein At5g...    104   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009120126.1|  PREDICTED: KH domain-containing protein At5g...    104   4e-23   Brassica rapa
ref|XP_010450699.1|  PREDICTED: KH domain-containing protein At5g...    104   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010942513.1|  PREDICTED: KH domain-containing protein At5g...    103   4e-23   Elaeis guineensis
ref|XP_010942512.1|  PREDICTED: KH domain-containing protein At5g...    103   4e-23   Elaeis guineensis
emb|CDY17395.1|  BnaA10g10290D                                          103   4e-23   Brassica napus [oilseed rape]
gb|AAL87326.1|  putative RNA-binding protein                            103   5e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132341.1|  PREDICTED: KH domain-containing protein At5g...    103   6e-23   Brassica rapa
emb|CDY51960.1|  BnaCnng21440D                                          103   7e-23   Brassica napus [oilseed rape]
gb|AFB34203.1|  hypothetical protein CL3054Contig1_01                 97.8    1e-22   Pinus mugo [mountain pine]
gb|KFK27184.1|  hypothetical protein AALP_AA8G346800                    103   1e-22   Arabis alpina [alpine rockcress]
ref|XP_008794733.1|  PREDICTED: KH domain-containing protein At5g...    100   6e-22   
ref|XP_008794732.1|  PREDICTED: KH domain-containing protein At5g...    100   7e-22   Phoenix dactylifera
gb|ABK25791.1|  unknown                                               99.8    1e-21   Picea sitchensis
ref|XP_008786388.1|  PREDICTED: KH domain-containing protein At1g...  98.6    3e-21   Phoenix dactylifera
gb|ABR16439.1|  unknown                                               97.8    7e-21   Picea sitchensis
ref|XP_010930408.1|  PREDICTED: KH domain-containing protein At1g...  95.5    5e-20   Elaeis guineensis
ref|XP_003573788.1|  PREDICTED: KH domain-containing protein At5g...  94.4    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_009414641.1|  PREDICTED: KH domain-containing protein At1g...  93.6    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278944.1|  PREDICTED: KH domain-containing protein At2g...  92.8    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010930407.1|  PREDICTED: KH domain-containing protein At1g...  92.8    4e-19   
ref|XP_010245420.1|  PREDICTED: KH domain-containing protein At1g...  92.4    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010245421.1|  PREDICTED: KH domain-containing protein At1g...  92.4    6e-19   Nelumbo nucifera [Indian lotus]
gb|EMT02598.1|  hypothetical protein F775_43967                       90.5    8e-19   
gb|AAO60031.1|  unknown protein, 5'-partial                           87.8    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008775562.1|  PREDICTED: KH domain-containing protein At1g...  91.3    1e-18   Phoenix dactylifera
ref|XP_008775561.1|  PREDICTED: KH domain-containing protein At1g...  91.3    1e-18   Phoenix dactylifera
ref|XP_006842569.1|  hypothetical protein AMTR_s00077p00149420        90.9    2e-18   Amborella trichopoda
ref|XP_010927868.1|  PREDICTED: KH domain-containing protein At1g...  90.5    2e-18   Elaeis guineensis
ref|XP_010931399.1|  PREDICTED: KH domain-containing protein SPIN...  90.1    2e-18   
ref|XP_006858588.1|  hypothetical protein AMTR_s00071p00192730        90.1    3e-18   Amborella trichopoda
ref|XP_010908089.1|  PREDICTED: KH domain-containing protein At1g...  90.1    3e-18   Elaeis guineensis
ref|XP_010244588.1|  PREDICTED: KH domain-containing protein At2g...  90.1    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006645141.1|  PREDICTED: KH domain-containing protein At1g...  89.0    8e-18   Oryza brachyantha
ref|XP_004962052.1|  PREDICTED: KH domain-containing protein At1g...  87.8    1e-17   Setaria italica
ref|XP_002441114.1|  hypothetical protein SORBIDRAFT_09g020640        88.2    1e-17   
ref|XP_004981292.1|  PREDICTED: KH domain-containing protein SPIN...  88.2    2e-17   Setaria italica
ref|XP_002466215.1|  hypothetical protein SORBIDRAFT_01g003680        88.2    2e-17   Sorghum bicolor [broomcorn]
ref|XP_002456759.1|  hypothetical protein SORBIDRAFT_03g042090        88.2    2e-17   Sorghum bicolor [broomcorn]
ref|XP_002533340.1|  nucleic acid binding protein, putative           87.8    2e-17   
gb|KHN18643.1|  KH domain-containing protein                          87.8    2e-17   Glycine soja [wild soybean]
ref|XP_003553178.1|  PREDICTED: KH domain-containing protein At3g...  87.8    2e-17   Glycine max [soybeans]
ref|XP_004962051.1|  PREDICTED: KH domain-containing protein At1g...  87.8    2e-17   Setaria italica
ref|NP_001051685.1|  Os03g0815700                                     87.4    2e-17   
ref|XP_006650789.1|  PREDICTED: KH domain-containing protein SPIN...  87.4    3e-17   Oryza brachyantha
ref|XP_010922800.1|  PREDICTED: KH domain-containing protein SPIN...  87.4    3e-17   Elaeis guineensis
ref|XP_008803015.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...  87.4    3e-17   Phoenix dactylifera
ref|XP_009411877.1|  PREDICTED: KH domain-containing protein At1g...  87.4    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095178.1|  PREDICTED: KH domain-containing protein At2g...  87.4    3e-17   Sesamum indicum [beniseed]
ref|XP_009772459.1|  PREDICTED: KH domain-containing protein At3g...  87.0    3e-17   Nicotiana sylvestris
ref|NP_001045029.1|  Os01g0886300                                     87.4    3e-17   
gb|EMT27361.1|  KH domain-containing protein                          87.0    3e-17   
ref|XP_011006271.1|  PREDICTED: KH domain-containing protein At2g...  87.0    3e-17   Populus euphratica
ref|XP_006381264.1|  hypothetical protein POPTR_0006s11210g           86.7    3e-17   
ref|XP_002323686.2|  KH domain-containing family protein              87.0    3e-17   
ref|XP_009600354.1|  PREDICTED: KH domain-containing protein At3g...  87.0    3e-17   Nicotiana tomentosiformis
ref|XP_006654416.1|  PREDICTED: KH domain-containing protein At1g...  87.0    3e-17   Oryza brachyantha
ref|NP_001148920.1|  nucleic acid binding protein                     87.0    3e-17   Zea mays [maize]
gb|EYU42056.1|  hypothetical protein MIMGU_mgv1a011431mg              87.0    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_009600353.1|  PREDICTED: KH domain-containing protein At3g...  87.0    3e-17   Nicotiana tomentosiformis
ref|XP_003564796.1|  PREDICTED: KH domain-containing protein At1g...  87.0    3e-17   Brachypodium distachyon [annual false brome]
ref|XP_009772457.1|  PREDICTED: KH domain-containing protein At3g...  87.0    4e-17   Nicotiana sylvestris
ref|XP_006381266.1|  KH domain-containing family protein              87.0    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011018950.1|  PREDICTED: KH domain-containing protein At2g...  87.0    4e-17   Populus euphratica
ref|XP_011018951.1|  PREDICTED: KH domain-containing protein At2g...  87.0    4e-17   Populus euphratica
gb|KDP21840.1|  hypothetical protein JCGZ_00627                       86.7    5e-17   Jatropha curcas
ref|XP_004970832.1|  PREDICTED: KH domain-containing protein At1g...  86.7    5e-17   Setaria italica
ref|XP_009617855.1|  PREDICTED: KH domain-containing protein At3g...  86.7    5e-17   Nicotiana tomentosiformis
ref|XP_006654415.1|  PREDICTED: KH domain-containing protein At1g...  86.7    5e-17   Oryza brachyantha
ref|XP_009793498.1|  PREDICTED: KH domain-containing protein At3g...  86.3    5e-17   Nicotiana sylvestris
ref|XP_009617854.1|  PREDICTED: KH domain-containing protein At3g...  86.7    5e-17   Nicotiana tomentosiformis
ref|XP_009793497.1|  PREDICTED: KH domain-containing protein At3g...  86.7    6e-17   Nicotiana sylvestris
ref|XP_010683433.1|  PREDICTED: KH domain-containing protein At3g...  86.3    6e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO64189.1|  hypothetical protein CISIN_1g023068mg                 84.7    7e-17   Citrus sinensis [apfelsine]
ref|XP_007033461.1|  RNA-binding KH domain-containing protein         85.5    1e-16   Theobroma cacao [chocolate]
ref|XP_004955829.1|  PREDICTED: KH domain-containing protein SPIN...  85.5    1e-16   Setaria italica
ref|XP_003552330.1|  PREDICTED: KH domain-containing protein At2g...  85.5    1e-16   Glycine max [soybeans]
ref|XP_002268790.1|  PREDICTED: KH domain-containing protein At2g...  85.1    1e-16   Vitis vinifera
gb|KHG17170.1|  hypothetical protein F383_07324                       84.7    1e-16   Gossypium arboreum [tree cotton]
gb|EMS59864.1|  KH domain-containing protein SPIN1                    85.1    1e-16   Triticum urartu
gb|KHN40599.1|  KH domain-containing protein                          85.5    2e-16   Glycine soja [wild soybean]
ref|XP_007205691.1|  hypothetical protein PRUPE_ppa009701mg           85.1    2e-16   Prunus persica
ref|NP_001130116.1|  uncharacterized protein LOC100191210             85.1    2e-16   Zea mays [maize]
gb|KHG12649.1|  hypothetical protein F383_20322                       85.1    2e-16   Gossypium arboreum [tree cotton]
dbj|BAJ96236.1|  predicted protein                                    85.1    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010228217.1|  PREDICTED: KH domain-containing protein SPIN...  85.1    2e-16   Brachypodium distachyon [annual false brome]
ref|NP_001142049.1|  hypothetical protein                             85.1    2e-16   Zea mays [maize]
ref|XP_008672524.1|  PREDICTED: hypothetical protein isoform X2       85.1    2e-16   Zea mays [maize]
ref|XP_008672523.1|  PREDICTED: hypothetical protein isoform X1       85.1    2e-16   Zea mays [maize]
ref|XP_009370879.1|  PREDICTED: KH domain-containing protein At3g...  85.1    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_003557365.1|  PREDICTED: KH domain-containing protein SPIN...  85.1    2e-16   Brachypodium distachyon [annual false brome]
ref|XP_008355743.1|  PREDICTED: KH domain-containing protein At3g...  85.1    2e-16   Malus domestica [apple tree]
ref|XP_002974032.1|  hypothetical protein SELMODRAFT_100146           84.7    2e-16   
ref|XP_003616063.1|  KH domain-containing protein                     85.1    2e-16   
gb|KJB71497.1|  hypothetical protein B456_011G125700                  84.7    2e-16   Gossypium raimondii
ref|XP_009337813.1|  PREDICTED: KH domain-containing protein At3g...  84.7    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008359840.1|  PREDICTED: KH domain-containing protein At3g...  84.7    2e-16   
gb|KDO64187.1|  hypothetical protein CISIN_1g023068mg                 84.3    2e-16   Citrus sinensis [apfelsine]
ref|XP_003626661.1|  KH domain-containing protein                     84.7    2e-16   Medicago truncatula
gb|KJB71496.1|  hypothetical protein B456_011G125700                  84.7    2e-16   Gossypium raimondii
gb|AES99021.2|  RNA-binding KH domain protein                         84.7    2e-16   Medicago truncatula
gb|AET01129.2|  RNA-binding KH domain protein                         84.7    2e-16   Medicago truncatula
ref|XP_003626653.1|  KH domain-containing protein                     84.7    2e-16   
gb|KHG24418.1|  hypothetical protein F383_31230                       84.7    2e-16   Gossypium arboreum [tree cotton]
ref|XP_006429645.1|  hypothetical protein CICLE_v10012376mg           84.7    2e-16   Citrus clementina [clementine]
ref|XP_003616062.1|  KH domain-containing protein                     84.3    2e-16   
ref|XP_003626662.1|  KH domain-containing protein                     84.7    2e-16   
ref|XP_006657570.1|  PREDICTED: KH domain-containing protein SPIN...  84.7    2e-16   Oryza brachyantha
ref|XP_006429644.1|  hypothetical protein CICLE_v10012376mg           84.3    3e-16   Citrus clementina [clementine]
ref|XP_003616061.1|  KH domain-containing protein                     84.3    3e-16   
gb|ACJ84729.1|  unknown                                               84.3    3e-16   Medicago truncatula
ref|XP_009383283.1|  PREDICTED: KH domain-containing protein SPIN...  84.3    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534621.1|  PREDICTED: KH domain-containing protein At2g...  84.0    4e-16   Glycine max [soybeans]
gb|ACU24211.1|  unknown                                               84.0    4e-16   Glycine max [soybeans]
ref|XP_010043877.1|  PREDICTED: KH domain-containing protein At2g...  83.6    5e-16   Eucalyptus grandis [rose gum]
emb|CDP04028.1|  unnamed protein product                              83.6    5e-16   Coffea canephora [robusta coffee]
ref|XP_004492593.1|  PREDICTED: KH domain-containing protein At2g...  83.6    5e-16   Cicer arietinum [garbanzo]
gb|KDP45673.1|  hypothetical protein JCGZ_17280                       83.6    5e-16   Jatropha curcas
ref|XP_001777736.1|  predicted protein                                83.6    5e-16   
gb|KHN29474.1|  KH domain-containing protein                          84.3    5e-16   Glycine soja [wild soybean]
emb|CDM85378.1|  unnamed protein product                              83.6    5e-16   Triticum aestivum [Canadian hard winter wheat]
emb|CDP06370.1|  unnamed protein product                              83.6    6e-16   Coffea canephora [robusta coffee]
ref|XP_009760263.1|  PREDICTED: KH domain-containing protein At2g...  83.6    6e-16   Nicotiana sylvestris
ref|XP_009790260.1|  PREDICTED: KH domain-containing protein At1g...  83.6    6e-16   Nicotiana sylvestris
ref|XP_009589069.1|  PREDICTED: KH domain-containing protein At2g...  83.6    6e-16   Nicotiana tomentosiformis
gb|AFK47467.1|  unknown                                               83.6    6e-16   Lotus japonicus
ref|XP_009587501.1|  PREDICTED: KH domain-containing protein At1g...  83.6    7e-16   Nicotiana tomentosiformis
ref|XP_004302513.1|  PREDICTED: KH domain-containing protein At3g...  83.2    7e-16   Fragaria vesca subsp. vesca
gb|EMT28447.1|  hypothetical protein F775_05859                       83.6    7e-16   
gb|KGN58679.1|  hypothetical protein Csa_3G727970                     82.8    7e-16   Cucumis sativus [cucumbers]
ref|XP_011041754.1|  PREDICTED: KH domain-containing protein At2g...  83.2    7e-16   Populus euphratica
gb|EMS53218.1|  hypothetical protein TRIUR3_13157                     83.2    8e-16   
ref|XP_003623654.1|  KH domain-containing protein                     83.2    8e-16   
ref|XP_002459573.1|  hypothetical protein SORBIDRAFT_02g006770        83.2    8e-16   
ref|NP_001059216.1|  Os07g0227400                                     83.2    8e-16   
ref|XP_004230441.1|  PREDICTED: KH domain-containing protein At1g...  83.2    9e-16   
ref|XP_009374444.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...  81.6    9e-16   
ref|XP_006349313.1|  PREDICTED: KH domain-containing protein At1g...  83.2    9e-16   
ref|XP_004170718.1|  PREDICTED: KH domain-containing protein At2g...  82.8    9e-16   
ref|XP_004142668.1|  PREDICTED: KH domain-containing protein At2g...  82.8    1e-15   
ref|XP_008463293.1|  PREDICTED: KH domain-containing protein At2g...  82.8    1e-15   
ref|XP_008463292.1|  PREDICTED: KH domain-containing protein At2g...  82.8    1e-15   
tpg|DAA60064.1|  TPA: hypothetical protein ZEAMMB73_533537            82.4    1e-15   
ref|XP_003521946.1|  PREDICTED: KH domain-containing protein At2g...  82.4    1e-15   
ref|XP_007134588.1|  hypothetical protein PHAVU_010G059400g           82.4    1e-15   
gb|ACU19015.1|  unknown                                               82.4    1e-15   
ref|XP_004137670.1|  PREDICTED: KH domain-containing protein At2g...  83.2    1e-15   
ref|XP_004510090.1|  PREDICTED: KH domain-containing protein At2g...  82.4    1e-15   
ref|NP_001150031.1|  nucleic acid binding protein                     82.4    2e-15   
ref|NP_001140438.1|  hypothetical protein                             82.0    2e-15   
gb|AFK41392.1|  unknown                                               82.0    2e-15   
ref|XP_004246970.1|  PREDICTED: KH domain-containing protein At2g...  82.0    2e-15   
ref|XP_009776889.1|  PREDICTED: KH domain-containing protein At1g...  82.0    2e-15   
ref|XP_006359981.1|  PREDICTED: KH domain-containing protein At2g...  82.0    2e-15   
ref|XP_006591271.1|  PREDICTED: KH domain-containing protein At3g...  81.6    2e-15   
ref|XP_009374412.1|  PREDICTED: KH domain-containing protein At3g...  82.0    2e-15   
gb|AFK41792.1|  unknown                                               81.6    2e-15   
ref|XP_006655420.1|  PREDICTED: KH domain-containing protein SPIN...  81.6    2e-15   
ref|XP_009355253.1|  PREDICTED: KH domain-containing protein At3g...  81.6    2e-15   
ref|XP_003548334.1|  PREDICTED: KH domain-containing protein At2g...  81.6    2e-15   
gb|KHN24715.1|  KH domain-containing protein                          81.6    3e-15   
ref|XP_003538343.1|  PREDICTED: KH domain-containing protein At3g...  81.6    3e-15   
ref|XP_003538342.1|  PREDICTED: KH domain-containing protein At3g...  81.6    3e-15   
tpg|DAA60062.1|  TPA: nucleic acid binding protein                    82.4    3e-15   
gb|EAZ39172.1|  hypothetical protein OsJ_23597                        81.6    3e-15   
ref|XP_007140039.1|  hypothetical protein PHAVU_008G079200g           81.6    3e-15   
ref|XP_002325628.1|  hypothetical protein POPTR_0019s15270g           81.3    3e-15   
ref|XP_004490738.1|  PREDICTED: KH domain-containing protein At3g...  81.3    3e-15   
ref|XP_008354244.1|  PREDICTED: KH domain-containing protein At3g...  81.3    3e-15   
ref|XP_006350897.1|  PREDICTED: KH domain-containing protein At3g...  81.3    4e-15   
ref|XP_004242461.1|  PREDICTED: KH domain-containing protein At3g...  81.3    4e-15   
ref|XP_004490737.1|  PREDICTED: KH domain-containing protein At3g...  81.6    4e-15   
ref|XP_002319982.1|  hypothetical protein POPTR_0013s15580g           80.9    4e-15   
ref|XP_002264308.1|  PREDICTED: KH domain-containing protein At3g...  80.9    4e-15   
ref|XP_004294849.1|  PREDICTED: KH domain-containing protein At3g...  80.9    4e-15   
emb|CAN61397.1|  hypothetical protein VITISV_015779                   80.9    4e-15   
ref|XP_007205693.1|  hypothetical protein PRUPE_ppa009725mg           80.9    5e-15   
gb|KHG06086.1|  hypothetical protein F383_05584                       80.1    9e-15   
ref|XP_011008510.1|  PREDICTED: KH domain-containing protein At3g...  80.1    9e-15   
ref|XP_011008509.1|  PREDICTED: KH domain-containing protein At2g...  80.1    9e-15   
ref|XP_004500397.1|  PREDICTED: KH domain-containing protein SPIN...  79.7    1e-14   
tpg|DAA39471.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...  80.5    1e-14   
gb|AFW78410.1|  hypothetical protein ZEAMMB73_819710                  78.6    1e-14   
ref|XP_003563829.1|  PREDICTED: KH domain-containing protein SPIN...  79.3    1e-14   
ref|XP_010227830.1|  PREDICTED: KH domain-containing protein SPIN...  79.3    1e-14   
dbj|BAJ94104.1|  predicted protein                                    79.3    2e-14   
ref|XP_007146910.1|  hypothetical protein PHAVU_006G080900g           79.0    2e-14   
ref|NP_001055861.1|  Os05g0481500                                     79.3    2e-14   
gb|ACU19066.1|  unknown                                               79.0    2e-14   
gb|EEE64120.1|  hypothetical protein OsJ_18952                        79.0    2e-14   
ref|XP_002531808.1|  conserved hypothetical protein                   81.6    2e-14   
ref|XP_001764522.1|  predicted protein                                79.0    2e-14   
ref|XP_006362335.1|  PREDICTED: KH domain-containing protein At3g...  79.0    2e-14   
ref|XP_010327700.1|  PREDICTED: KH domain-containing protein At3g...  79.0    2e-14   
gb|AFW78409.1|  hypothetical protein ZEAMMB73_819710                  78.6    2e-14   
ref|NP_001150991.1|  nucleic acid binding protein                     78.6    3e-14   
gb|ACG41186.1|  nucleic acid binding protein                          78.6    3e-14   
ref|XP_004961722.1|  PREDICTED: KH domain-containing protein SPIN...  78.6    3e-14   
ref|XP_002441276.1|  hypothetical protein SORBIDRAFT_09g023640        78.6    3e-14   
dbj|BAD06470.1|  hypothetical protein                                 78.2    4e-14   
ref|XP_009780437.1|  PREDICTED: KH domain-containing protein At2g...  78.2    4e-14   
ref|XP_001780004.1|  predicted protein                                77.8    5e-14   
ref|XP_010558412.1|  PREDICTED: KH domain-containing protein At3g...  77.4    7e-14   
ref|XP_009614149.1|  PREDICTED: KH domain-containing protein At3g...  77.4    7e-14   
ref|XP_010553177.1|  PREDICTED: KH domain-containing protein At3g...  76.6    1e-13   
ref|NP_187474.2|  RNA-binding KH domain-containing protein            76.6    1e-13   
ref|XP_007141998.1|  hypothetical protein PHAVU_008G244000g           76.6    1e-13   
ref|XP_009146996.1|  PREDICTED: KH domain-containing protein At3g...  76.6    2e-13   
ref|XP_006407758.1|  hypothetical protein EUTSA_v10021281mg           76.6    2e-13   
ref|XP_003519299.1|  PREDICTED: KH domain-containing protein At3g...  76.6    2e-13   
gb|KHN41004.1|  KH domain-containing protein                          77.0    2e-13   
ref|XP_006575463.1|  PREDICTED: KH domain-containing protein At3g...  77.0    2e-13   
gb|AAG51340.1|AC012562_1  unknown protein; 28504-31237                76.6    2e-13   
gb|EYU46041.1|  hypothetical protein MIMGU_mgv1a007711mg              77.4    2e-13   
ref|XP_010098608.1|  KH domain-containing protein                     75.9    4e-13   
ref|XP_006298282.1|  hypothetical protein CARUB_v10014346mg           75.1    5e-13   
ref|XP_003568231.1|  PREDICTED: KH domain-containing protein SPIN1    75.1    5e-13   
gb|EAZ13953.1|  hypothetical protein OsJ_03879                        74.7    6e-13   
ref|XP_002882575.1|  KH domain-containing protein                     74.7    6e-13   
emb|CDY27991.1|  BnaC05g43930D                                        74.7    6e-13   
gb|KJB77959.1|  hypothetical protein B456_012G169800                  74.7    6e-13   
ref|NP_001044630.1|  Os01g0818300                                     74.7    7e-13   
gb|ACN27764.1|  unknown                                               73.9    1e-12   
ref|XP_010486402.1|  PREDICTED: KH domain-containing protein At3g...  73.6    1e-12   
ref|XP_009410498.1|  PREDICTED: KH domain-containing protein SPIN...  73.6    1e-12   
ref|XP_009410499.1|  PREDICTED: KH domain-containing protein SPIN...  73.6    1e-12   
ref|XP_010462948.1|  PREDICTED: KH domain-containing protein At3g...  73.6    1e-12   
ref|NP_001168305.1|  hypothetical protein                             73.9    1e-12   
gb|KHN39678.1|  KH domain-containing protein                          73.2    1e-12   
ref|XP_010464471.1|  PREDICTED: KH domain-containing protein At3g...  73.6    1e-12   
ref|XP_006644907.1|  PREDICTED: KH domain-containing protein SPIN...  73.6    2e-12   
gb|EPS71004.1|  hypothetical protein M569_03750                       73.2    2e-12   
gb|ACF83493.1|  unknown                                               72.4    5e-12   
ref|XP_002456539.1|  hypothetical protein SORBIDRAFT_03g038070        72.4    5e-12   
ref|NP_001148784.1|  protein held out wings                           72.0    5e-12   
ref|XP_002977855.1|  hypothetical protein SELMODRAFT_107444           71.6    5e-12   
gb|EMT11095.1|  KH domain-containing protein                          72.0    5e-12   
gb|EMT15768.1|  KH domain-containing protein                          72.0    6e-12   
ref|XP_002979473.1|  hypothetical protein SELMODRAFT_110771           71.6    8e-12   
gb|KJB09230.1|  hypothetical protein B456_001G130400                  70.1    9e-12   
ref|XP_010244589.1|  PREDICTED: KH domain-containing protein At2g...  70.1    2e-11   
gb|KJB19741.1|  hypothetical protein B456_003G117200                  68.6    2e-11   
ref|XP_010529949.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...  70.5    2e-11   
gb|ACJ83750.1|  unknown                                               67.8    3e-11   
ref|XP_006492549.1|  PREDICTED: KH domain-containing protein At1g...  68.6    4e-11   
ref|XP_009143371.1|  PREDICTED: KH domain-containing protein At2g...  69.7    4e-11   
emb|CDY60757.1|  BnaA05g34810D                                        69.7    4e-11   
emb|CDX91481.1|  BnaC04g06690D                                        69.7    4e-11   
gb|ACF87618.1|  unknown                                               67.4    4e-11   
ref|XP_006411077.1|  hypothetical protein EUTSA_v10017040mg           69.7    4e-11   
ref|NP_181395.1|  RNA-binding KH domain-containing protein            69.7    5e-11   
ref|XP_010509148.1|  PREDICTED: KH domain-containing protein At2g...  69.7    5e-11   
gb|KFK36766.1|  hypothetical protein AALP_AA4G167700                  69.7    5e-11   
ref|XP_011092287.1|  PREDICTED: KH domain-containing protein At1g...  69.3    5e-11   
ref|XP_006294628.1|  hypothetical protein CARUB_v10023665mg           69.7    6e-11   
gb|EMS48704.1|  KH domain-containing protein SPIN1                    70.1    6e-11   
ref|XP_004970377.1|  PREDICTED: KH domain-containing protein SPIN...  68.9    6e-11   
gb|KHN30620.1|  KH domain-containing protein                          69.3    7e-11   
ref|XP_003600562.1|  KH domain-containing protein                     65.1    7e-11   
ref|XP_009133271.1|  PREDICTED: KH domain-containing protein At2g...  68.9    7e-11   
emb|CDY07718.1|  BnaA03g17930D                                        68.9    8e-11   
ref|XP_008218703.1|  PREDICTED: KH domain-containing protein At1g...  67.8    1e-10   
ref|XP_006591877.1|  PREDICTED: uncharacterized protein LOC100796...  68.2    1e-10   
ref|NP_001239952.1|  uncharacterized protein LOC100796731             68.2    1e-10   
ref|NP_001055572.1|  Os05g0419500                                     68.2    1e-10   
ref|XP_008218701.1|  PREDICTED: KH domain-containing protein At1g...  67.8    2e-10   
ref|XP_008357681.1|  PREDICTED: KH domain-containing protein At1g...  67.8    2e-10   
ref|XP_010030197.1|  PREDICTED: KH domain-containing protein At1g...  67.4    2e-10   
ref|XP_008218700.1|  PREDICTED: KH domain-containing protein At1g...  67.8    2e-10   
ref|XP_007225752.1|  hypothetical protein PRUPE_ppa009432mg           67.8    2e-10   
ref|XP_010030196.1|  PREDICTED: KH domain-containing protein At1g...  67.0    2e-10   
ref|XP_007148574.1|  hypothetical protein PHAVU_006G219900g           67.8    2e-10   
ref|XP_009353790.1|  PREDICTED: KH domain-containing protein At1g...  67.8    2e-10   
emb|CDY14446.1|  BnaC03g21490D                                        67.8    2e-10   
ref|XP_008378908.1|  PREDICTED: KH domain-containing protein At1g...  67.8    2e-10   
ref|XP_009355337.1|  PREDICTED: KH domain-containing protein At1g...  67.4    3e-10   
emb|CDO97629.1|  unnamed protein product                              67.4    3e-10   
ref|XP_002526434.1|  nucleic acid binding protein, putative           67.0    4e-10   
ref|NP_001132285.1|  uncharacterized protein LOC100193725             67.0    4e-10   
ref|XP_006431583.1|  hypothetical protein CICLE_v10002036mg           67.0    4e-10   
ref|XP_010030192.1|  PREDICTED: KH domain-containing protein At1g...  67.0    4e-10   
ref|XP_006431582.1|  hypothetical protein CICLE_v10002036mg           67.0    4e-10   
ref|XP_010030191.1|  PREDICTED: KH domain-containing protein At1g...  67.0    4e-10   
ref|XP_008443566.1|  PREDICTED: KH domain-containing protein At3g...  65.5    5e-10   
ref|XP_008361674.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...  66.2    7e-10   
gb|KDP42460.1|  hypothetical protein JCGZ_00257                       66.6    7e-10   
ref|XP_002263798.1|  PREDICTED: KH domain-containing protein At1g...  66.2    7e-10   
ref|XP_010096437.1|  KH domain-containing protein                     65.9    1e-09   
ref|XP_004300000.1|  PREDICTED: KH domain-containing protein At1g...  65.5    1e-09   
ref|XP_011028364.1|  PREDICTED: KH domain-containing protein At1g...  65.5    1e-09   
ref|XP_006385053.1|  hypothetical protein POPTR_0004s23460g           65.5    2e-09   
gb|AAB60723.1|  F21M12.5 gene product                                 63.2    2e-09   
ref|XP_010030195.1|  PREDICTED: KH domain-containing protein At1g...  64.7    3e-09   
ref|XP_010030193.1|  PREDICTED: KH domain-containing protein At1g...  64.7    3e-09   
gb|KEH36412.1|  RNA-binding KH domain protein                         64.3    4e-09   
ref|XP_003592904.1|  KH domain-containing protein                     64.3    4e-09   
ref|XP_006417550.1|  hypothetical protein EUTSA_v10008323mg           62.8    1e-08   
gb|AAL31922.1|AF419590_1  At1g09660/F21M12_5                          62.8    1e-08   
ref|NP_172437.2|  RNA-binding KH domain-containing protein            62.8    1e-08   
ref|XP_004133720.1|  PREDICTED: KH domain-containing protein At1g...  62.8    1e-08   
ref|XP_010475807.1|  PREDICTED: KH domain-containing protein At1g...  62.8    1e-08   
ref|XP_010458263.1|  PREDICTED: KH domain-containing protein At1g...  62.8    1e-08   
ref|XP_010490233.1|  PREDICTED: KH domain-containing protein At1g...  62.8    1e-08   
ref|XP_002892515.1|  hypothetical protein ARALYDRAFT_471067           62.8    1e-08   
ref|XP_006305461.1|  hypothetical protein CARUB_v10009882mg           62.8    1e-08   
gb|KGN56263.1|  hypothetical protein Csa_3G110600                     63.2    2e-08   
ref|XP_007041198.1|  RNA-binding KH domain-containing protein iso...  62.4    2e-08   
ref|XP_011047889.1|  PREDICTED: KH domain-containing protein At1g...  62.4    2e-08   
ref|XP_006389504.1|  hypothetical protein POPTR_0022s00450g           62.4    2e-08   
emb|CDY50885.1|  BnaCnng19770D                                        62.0    2e-08   
ref|XP_009148265.1|  PREDICTED: KH domain-containing protein At1g...  62.0    2e-08   
gb|KDO39787.1|  hypothetical protein CISIN_1g039634mg                 59.7    3e-08   
emb|CDX93492.1|  BnaA06g05560D                                        62.0    3e-08   
gb|KJB47895.1|  hypothetical protein B456_008G046100                  59.7    6e-08   
gb|KHG06621.1|  hypothetical protein F383_33149                       60.8    6e-08   
gb|KJB47892.1|  hypothetical protein B456_008G046100                  59.7    1e-07   
gb|KJB47893.1|  hypothetical protein B456_008G046100                  59.7    2e-07   
ref|XP_009110812.1|  PREDICTED: KH domain-containing protein At1g...  59.7    2e-07   
emb|CDY31072.1|  BnaA08g26220D                                        59.3    2e-07   
ref|XP_009110811.1|  PREDICTED: KH domain-containing protein At1g...  59.3    2e-07   
emb|CDY20680.1|  BnaC08g13780D                                        59.3    2e-07   
ref|XP_010549026.1|  PREDICTED: KH domain-containing protein At1g...  56.2    3e-06   
ref|XP_006431578.1|  hypothetical protein CICLE_v10003000mg           49.3    6e-05   
ref|XP_009395222.1|  PREDICTED: KH domain-containing protein SPIN...  50.4    3e-04   



>emb|CDP13650.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 72/85 (85%), Gaps = 8/85 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYL--------LLMQDESQDFYKKHQLRELAMLNGTLRE  444
            E+IDAR MQAREILEDLLKPV  +        L MQDESQDFYKK QLRELAM+NGTLRE
Sbjct  225  EVIDARLMQAREILEDLLKPVIGISNDEAFCPLQMQDESQDFYKKQQLRELAMINGTLRE  284

Query  443  EGSQMSGSVSPFNNSLGMKRAKTRG  369
            EGSQMSGSVSPF+NSLGMKRAKTRG
Sbjct  285  EGSQMSGSVSPFHNSLGMKRAKTRG  309



>ref|XP_011095627.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Sesamum indicum]
Length=297

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 68/77 (88%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQDFYKK QLRELA+LNGTLREEGSQMSGS
Sbjct  228  EIIDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAVLNGTLREEGSQMSGS  280

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  281  VSPFHNSLGMKRAKTRG  297



>ref|XP_011095628.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Sesamum indicum]
Length=285

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 68/77 (88%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQDFYKK QLRELA+LNGTLREEGSQMSGS
Sbjct  216  EIIDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAVLNGTLREEGSQMSGS  268

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  269  VSPFHNSLGMKRAKTRG  285



>gb|KHN01498.1| KH domain-containing protein [Glycine soja]
Length=238

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  169  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  221

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  222  VSPFHNSLGMKRAKTRG  238



>ref|XP_011000365.1| PREDICTED: KH domain-containing protein At5g56140-like [Populus 
euphratica]
Length=302

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQD+YKK QLRELAMLNGTLREEGS MSGS
Sbjct  233  EIVDARLMQAREILEDLLKPV-------DESQDYYKKQQLRELAMLNGTLREEGSPMSGS  285

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFNNSLGMKRAKTRG
Sbjct  286  VSPFNNSLGMKRAKTRG  302



>gb|ABK95423.1| unknown [Populus trichocarpa]
Length=176

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQA EILEDLLKPV       DESQD+YKK QLRELAMLNGTLREEGS MSGS
Sbjct  107  EIVDARLMQASEILEDLLKPV-------DESQDYYKKQQLRELAMLNGTLREEGSPMSGS  159

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFNNSLGMKRAKTRG
Sbjct  160  VSPFNNSLGMKRAKTRG  176



>ref|XP_006377999.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa]
 gb|ERP55796.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa]
Length=301

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQD+YKK QLRELAMLNGTLREEGS MSGS
Sbjct  232  EIVDARLMQAREILEDLLKPV-------DESQDYYKKQQLRELAMLNGTLREEGSPMSGS  284

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFNNSLGMKRAKTRG
Sbjct  285  VSPFNNSLGMKRAKTRG  301



>gb|KJB63132.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=140

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  70   EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  122

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  123  VSPFQNNSLGMKRAKTRG  140



>gb|KJB63133.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=177

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  107  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  159

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  160  VSPFQNNSLGMKRAKTRG  177



>ref|XP_003522828.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine 
max]
Length=291

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  222  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  275  VSPFHNSLGMKRAKTRG  291



>ref|XP_009762106.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Nicotiana sylvestris]
Length=289

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  220  EIIDARLLQAREILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  272

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  273  VSPFHNSLGMKRAKTRG  289



>ref|XP_009762105.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Nicotiana sylvestris]
Length=293

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 68/77 (88%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  224  EIIDARLLQAREILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  276

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  277  VSPFHNSLGMKRAKTRG  293



>ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 [Vitis vinifera]
 emb|CBI39805.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  218  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  270

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  271  VSPFHNSLGMKRAKTRG  287



>ref|XP_006452745.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 ref|XP_006452746.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65985.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65986.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=172

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  103  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  155

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  156  VSPFHNSLGMKRAKTRG  172



>ref|XP_006452748.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 ref|XP_006452749.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 ref|XP_006452753.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65988.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65989.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65993.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=178

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  109  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  161

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  162  VSPFHNSLGMKRAKTRG  178



>gb|KDP36322.1| hypothetical protein JCGZ_09537 [Jatropha curcas]
Length=295

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  226  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELAMLNGTLREEGSPMSGS  278

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  279  VSPFHNSLGMKRAKTRG  295



>ref|XP_010244820.1| PREDICTED: KH domain-containing protein At5g56140-like [Nelumbo 
nucifera]
Length=290

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DE QDF+KK QLRELAMLNGTLREEGS +SGS
Sbjct  221  EIVDARLMQAREILEDLLKPV-------DECQDFFKKQQLRELAMLNGTLREEGSHLSGS  273

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFNNSLGMKRAKTRG
Sbjct  274  VSPFNNSLGMKRAKTRG  290



>ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g56140-like [Citrus 
sinensis]
Length=292

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  223  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELAMLNGTLREEGSPMSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  276  VSPFHNSLGMKRAKTRG  292



>ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine 
max]
 gb|KHN20564.1| KH domain-containing protein [Glycine soja]
Length=292

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAR+ILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  223  EIVDARLMQARDILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  276  VSPFHNSLGMKRAKTRG  292



>ref|XP_006452754.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65994.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=223

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  154  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  206

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  207  VSPFHNSLGMKRAKTRG  223



>ref|XP_011097700.1| PREDICTED: LOW QUALITY PROTEIN: KH domain-containing protein 
At4g26480-like [Sesamum indicum]
Length=286

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQDFYKK QLRELA+LNGTLREEGSQMSGS
Sbjct  217  EIIDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELALLNGTLREEGSQMSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFN++LGMKRAKT G
Sbjct  270  VSPFNSTLGMKRAKTTG  286



>ref|XP_008813752.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Phoenix dactylifera]
Length=285

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KKHQLRELA+LNGTLREEGS MSGS
Sbjct  216  EIVDARLMQAREILEDLLKPV-------DESQDFFKKHQLRELALLNGTLREEGSHMSGS  268

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSLGMKRAKTRG
Sbjct  269  GSPFRNSLGMKRAKTRG  285



>ref|XP_009620232.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Nicotiana tomentosiformis]
Length=293

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QA EILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  224  EIIDARLLQAHEILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  276

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  277  VSPFHNSLGMKRAKTRG  293



>ref|XP_008813751.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Phoenix dactylifera]
Length=286

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KKHQLRELA+LNGTLREEGS MSGS
Sbjct  217  EIVDARLMQAREILEDLLKPV-------DESQDFFKKHQLRELALLNGTLREEGSHMSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSLGMKRAKTRG
Sbjct  270  GSPFRNSLGMKRAKTRG  286



>ref|XP_002532938.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29442.1| nucleic acid binding protein, putative [Ricinus communis]
Length=300

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR  QAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  231  EIVDARIAQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  283

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  284  VSPFHNSLGMKRAKTRG  300



>ref|XP_009620233.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Nicotiana tomentosiformis]
Length=289

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QA EILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  220  EIIDARLLQAHEILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  272

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  273  VSPFHNSLGMKRAKTRG  289



>ref|XP_008813749.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Phoenix dactylifera]
Length=292

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KKHQLRELA+LNGTLREEGS MSGS
Sbjct  223  EIVDARLMQAREILEDLLKPV-------DESQDFFKKHQLRELALLNGTLREEGSHMSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSLGMKRAKTRG
Sbjct  276  GSPFRNSLGMKRAKTRG  292



>ref|XP_010092393.1| KH domain-containing protein [Morus notabilis]
 gb|EXB51069.1| KH domain-containing protein [Morus notabilis]
Length=307

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+D R MQAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  238  EIVDTRLMQAREILEDLLKPI-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  290

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  291  VSPFHNSLGMKRAKTRG  307



>ref|XP_008813750.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Phoenix dactylifera]
Length=291

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KKHQLRELA+LNGTLREEGS MSGS
Sbjct  222  EIVDARLMQAREILEDLLKPV-------DESQDFFKKHQLRELALLNGTLREEGSHMSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSLGMKRAKTRG
Sbjct  275  GSPFRNSLGMKRAKTRG  291



>gb|KJB63136.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=274

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  204  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  256

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  257  VSPFQNNSLGMKRAKTRG  274



>ref|XP_006452752.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65992.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=279

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  210  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  262

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  263  VSPFHNSLGMKRAKTRG  279



>gb|KDO73992.1| hypothetical protein CISIN_1g022785mg [Citrus sinensis]
Length=292

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  223  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  276  VSPFHNSLGMKRAKTRG  292



>ref|XP_006452751.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65991.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=269

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  200  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  252

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  253  VSPFHNSLGMKRAKTRG  269



>gb|KJB63134.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=301

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  231  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  283

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  284  VSPFQNNSLGMKRAKTRG  301



>ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65987.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=292

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DES DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  223  EIVDARLMQAREILEDLLKPV-------DESHDFYKKQQLRELALLNGTLREEGSPMSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  276  VSPFHNSLGMKRAKTRG  292



>ref|XP_003598316.1| KH domain-containing protein [Medicago truncatula]
Length=195

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLL+PV       +ES DFYKK QLRELAM+NGTLREEGS MSGS
Sbjct  126  EIIDARLMQAREILEDLLRPV-------EESHDFYKKQQLRELAMINGTLREEGSPMSGS  178

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  179  VSPFHNSLGMKRAKTRG  195



>gb|KHG00195.1| hypothetical protein F383_19595 [Gossypium arboreum]
Length=321

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  251  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  303

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  304  VSPFQNNSLGMKRAKTRG  321



>ref|XP_002299073.2| KH domain-containing family protein [Populus trichocarpa]
 gb|EEE83878.2| KH domain-containing family protein [Populus trichocarpa]
Length=302

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLL+PV       DESQD+YKK QLRELA+LNGT REEGS MSGS
Sbjct  233  EIVDARLMQAREILEDLLRPV-------DESQDYYKKQQLRELALLNGTFREEGSPMSGS  285

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFNNSLGMKRAKTRG
Sbjct  286  VSPFNNSLGMKRAKTRG  302



>ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Solanum tuberosum]
Length=289

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLL+P+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  220  EIIDARLLQAREILEDLLRPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  272

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSLGMKRAKTR
Sbjct  273  VSPFHNSLGMKRAKTR  288



>ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Solanum tuberosum]
Length=293

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 67/76 (88%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLL+P+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  224  EIIDARLLQAREILEDLLRPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  276

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSLGMKRAKTR
Sbjct  277  VSPFHNSLGMKRAKTR  292



>ref|XP_011039862.1| PREDICTED: KH domain-containing protein At5g56140 [Populus euphratica]
Length=300

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DA+ MQAREILEDLLKPV       DESQD+YKK QLRELA+LNGT REEGS MSGS
Sbjct  231  EIVDAQLMQAREILEDLLKPV-------DESQDYYKKQQLRELALLNGTFREEGSPMSGS  283

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFNNSLGMKRAKTRG
Sbjct  284  VSPFNNSLGMKRAKTRG  300



>gb|KJB45527.1| hypothetical protein B456_007G310100 [Gossypium raimondii]
Length=295

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP        DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  226  EIVDARLMQAREILEDLLKPT-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  278

Query  419  VSPFNNSLGMKRAKTRG  369
            +SPF NSLGMKRAKTRG
Sbjct  279  LSPFQNSLGMKRAKTRG  295



>gb|AGV54732.1| KH domain-containing protein [Phaseolus vulgaris]
Length=291

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAR+ILEDLLKPV       DESQDFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  222  EIIDARLLQARDILEDLLKPV-------DESQDFYKKQQLRELALLNGTLREEGSPMSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF NSLGMKRAKTRG
Sbjct  275  VSPFQNSLGMKRAKTRG  291



>gb|KJB45526.1| hypothetical protein B456_007G310100 [Gossypium raimondii]
Length=294

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP        DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  225  EIVDARLMQAREILEDLLKPT-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  277

Query  419  VSPFNNSLGMKRAKTRG  369
            +SPF NSLGMKRAKTRG
Sbjct  278  LSPFQNSLGMKRAKTRG  294



>ref|XP_008219133.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Prunus mume]
Length=296

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR  QARE+LEDLL+PV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  227  EIIDARLSQAREVLEDLLRPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  279

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  280  VSPFHNSLGMKRAKTRG  296



>ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda]
 gb|ERN19068.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda]
Length=286

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREIL+DLLKPV       DESQDF+KKHQLRELA+LNGTLR+EGS MSGS
Sbjct  216  EIIDARLMQAREILDDLLKPV-------DESQDFFKKHQLRELAILNGTLRDEGSHMSGS  268

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  269  VSPFQNNSLGMKRAKTRG  286



>ref|XP_007205649.1| hypothetical protein PRUPE_ppa009341mg [Prunus persica]
 gb|EMJ06848.1| hypothetical protein PRUPE_ppa009341mg [Prunus persica]
Length=296

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR  QARE+LEDLL+PV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  227  EIIDARLSQAREVLEDLLRPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  279

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  280  VSPFHNSLGMKRAKTRG  296



>ref|XP_008219129.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Prunus mume]
Length=306

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR  QARE+LEDLL+PV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  237  EIIDARLSQAREVLEDLLRPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  289

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  290  VSPFHNSLGMKRAKTRG  306



>ref|XP_007148648.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris]
 gb|ESW20642.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris]
Length=291

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAR+ILEDLLKPV       DESQDFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  222  EIVDARLLQARDILEDLLKPV-------DESQDFYKKQQLRELALLNGTLREEGSPMSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF NSLGMKRAKTRG
Sbjct  275  VSPFQNSLGMKRAKTRG  291



>ref|XP_008384622.1| PREDICTED: KH domain-containing protein At5g56140-like [Malus 
domestica]
Length=299

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIID R +QARE+LEDLL+PV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  230  EIIDTRLLQAREVLEDLLRPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  282

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  283  VSPFHNSLGMKRAKTRG  299



>ref|XP_010676134.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=291

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQDF+KK QLRELAMLNGTLRE+GS MSGS
Sbjct  221  EIIDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREDGSHMSGS  273

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  274  VSPFHNNSLGMKRAKTRG  291



>ref|XP_008805546.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Phoenix dactylifera]
Length=286

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  217  EIVDARLMQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+LGMKRAKTRG
Sbjct  270  VSPFRNNLGMKRAKTRG  286



>ref|XP_010676133.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=292

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQDF+KK QLRELAMLNGTLRE+GS MSGS
Sbjct  222  EIIDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREDGSHMSGS  274

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  275  VSPFHNNSLGMKRAKTRG  292



>ref|XP_008353854.1| PREDICTED: KH domain-containing protein At5g56140 [Malus domestica]
Length=299

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QARE+LEDLL+PV       DESQDFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  230  EIIDARLLQAREVLEDLLRPV-------DESQDFYKKQQLRELAILNGTLREEGSPMSGS  282

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  283  VSPFHNSLGMKRAKTRG  299



>ref|XP_008805547.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X6 [Phoenix dactylifera]
Length=285

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  216  EIVDARLMQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  268

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+LGMKRAKTRG
Sbjct  269  VSPFRNNLGMKRAKTRG  285



>ref|XP_004499705.1| PREDICTED: KH domain-containing protein At5g56140-like [Cicer 
arietinum]
Length=294

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 66/78 (85%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAR+ILEDLLKPV       DES DFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  224  EIIDARLMQARDILEDLLKPV-------DESHDFYKKQQLRELAMLNGTLREEGSPMSGS  276

Query  419  VSPF-NNSLGMKRAKTRG  369
            VSPF NNSLGMKRAKTRG
Sbjct  277  VSPFQNNSLGMKRAKTRG  294



>ref|XP_008805544.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Phoenix dactylifera]
Length=292

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  223  EIVDARLMQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+LGMKRAKTRG
Sbjct  276  VSPFRNNLGMKRAKTRG  292



>ref|XP_003598315.1| KH domain-containing protein [Medicago truncatula]
 gb|AES68566.1| RNA-binding KH domain protein [Medicago truncatula]
Length=293

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLL+PV       +ES DFYKK QLRELAM+NGTLREEGS MSGS
Sbjct  224  EIIDARLMQAREILEDLLRPV-------EESHDFYKKQQLRELAMINGTLREEGSPMSGS  276

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  277  VSPFHNSLGMKRAKTRG  293



>ref|XP_008805543.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Phoenix dactylifera]
Length=298

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  229  EIVDARLMQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  281

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+LGMKRAKTRG
Sbjct  282  VSPFRNNLGMKRAKTRG  298



>ref|XP_008805545.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Phoenix dactylifera]
Length=291

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  222  EIVDARLMQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+LGMKRAKTRG
Sbjct  275  VSPFRNNLGMKRAKTRG  291



>ref|XP_008805542.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Phoenix dactylifera]
Length=299

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS MSGS
Sbjct  230  EIVDARLMQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHMSGS  282

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+LGMKRAKTRG
Sbjct  283  VSPFRNNLGMKRAKTRG  299



>ref|XP_010252937.1| PREDICTED: KH domain-containing protein At5g56140-like [Nelumbo 
nucifera]
Length=294

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 67/77 (87%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREILEDLLKP+       DESQDF+KK QLRELAMLNGTLREEGS +SGS
Sbjct  225  EIVDARLLQAREILEDLLKPM-------DESQDFFKKQQLRELAMLNGTLREEGSHLSGS  277

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  278  VSPFHNSLGMKRAKTRG  294



>ref|XP_004953739.1| PREDICTED: KH domain-containing protein At5g56140-like [Setaria 
italica]
Length=286

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DES DF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  217  EIIDARLMQAREILEDLLKPV-------DESHDFFKKQQLRELAMLNGTLREEGMQRSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPFNNSLGMKRAKTRG
Sbjct  270  ASPFNNSLGMKRAKTRG  286



>ref|XP_009379123.1| PREDICTED: KH domain-containing protein At5g56140-like [Pyrus 
x bretschneideri]
Length=299

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QARE+LEDLL+PV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  230  EIIDARLLQAREVLEDLLRPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  282

Query  419  VSPFNNSLGMKRAKTRG  369
            +SPF NSLGMKRAKTRG
Sbjct  283  LSPFRNSLGMKRAKTRG  299



>ref|XP_002454368.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor]
 gb|EES07344.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor]
Length=286

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  217  EIIDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  270  ASPFHNSLGMKRAKTRG  286



>gb|EYU27503.1| hypothetical protein MIMGU_mgv1a011068mg [Erythranthe guttata]
Length=293

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR MQAREILEDLLKP+       DE QDFYKK QLRELA+LNGTLREE SQMSGS
Sbjct  224  DIIDARLMQAREILEDLLKPM-------DECQDFYKKQQLRELALLNGTLREEDSQMSGS  276

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  277  VSPFHNSLGMKRAKTRG  293



>ref|XP_004294880.1| PREDICTED: KH domain-containing protein At5g56140-like [Fragaria 
vesca subsp. vesca]
Length=297

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QARE+LEDLL+PV       DESQDFYKK QLRELAMLNGTLR+EGS MSGS
Sbjct  227  EIIDARLLQAREVLEDLLRPV-------DESQDFYKKQQLRELAMLNGTLRDEGSPMSGS  279

Query  419  VSPFNNSL-GMKRAKTRG  369
            VSPFNNSL GMKRAKTRG
Sbjct  280  VSPFNNSLGGMKRAKTRG  297



>ref|XP_008447796.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Cucumis melo]
Length=238

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKP+       +ES DFYKK QLRELAMLNGTLREEGS MS S
Sbjct  169  EIIDARLMQAREILEDLLKPM-------EESHDFYKKQQLRELAMLNGTLREEGSPMSSS  221

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  222  VSPFHNSLGMKRAKTRG  238



>ref|NP_001132735.1| hypothetical protein [Zea mays]
 gb|ACF81713.1| unknown [Zea mays]
 gb|AFW63658.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=123

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR MQAREIL+DLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q  GS
Sbjct  54   DIIDARLMQAREILQDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRFGS  106

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  107  ASPFHNSLGMKRAKTRG  123



>ref|NP_001141163.1| uncharacterized protein LOC100273249 [Zea mays]
 gb|ACF85597.1| unknown [Zea mays]
 gb|AFW73198.1| nucleic acid binding protein [Zea mays]
Length=286

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQD++KK QLRELAMLNGTLREEG Q SGS
Sbjct  217  EIIDARLMQAREILEDLLKPV-------DESQDYFKKQQLRELAMLNGTLREEGMQRSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  270  ASPFHNSLGMKRAKTRG  286



>gb|ACG35732.1| nucleic acid binding protein [Zea mays]
Length=286

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKPV       DESQD++KK QLRELAMLNGTLREEG Q SGS
Sbjct  217  EIIDARLMQAREILEDLLKPV-------DESQDYFKKQQLRELAMLNGTLREEGMQRSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  270  ASPFHNSLGMKRAKTRG  286



>ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis 
sativus]
 ref|XP_004163285.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis 
sativus]
 gb|KGN44103.1| hypothetical protein Csa_7G188690 [Cucumis sativus]
Length=296

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKP+       +ES DFYKK QLRELAMLNGTLREEGS MS S
Sbjct  227  EIIDARLMQAREILEDLLKPM-------EESHDFYKKQQLRELAMLNGTLREEGSPMSSS  279

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  280  VSPFHNSLGMKRAKTRG  296



>ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Solanum lycopersicum]
Length=295

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 67/78 (86%), Gaps = 9/78 (12%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  224  EIIDARLLQAREILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  276

Query  419  VSPFNN--SLGMKRAKTR  372
            VSPF+N  SLGMKRAKTR
Sbjct  277  VSPFHNSLSLGMKRAKTR  294



>ref|XP_010324228.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Solanum lycopersicum]
Length=291

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 67/78 (86%), Gaps = 9/78 (12%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  220  EIIDARLLQAREILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  272

Query  419  VSPFNN--SLGMKRAKTR  372
            VSPF+N  SLGMKRAKTR
Sbjct  273  VSPFHNSLSLGMKRAKTR  290



>ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Solanum lycopersicum]
Length=299

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 67/78 (86%), Gaps = 9/78 (12%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  228  EIIDARLLQAREILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  280

Query  419  VSPFNN--SLGMKRAKTR  372
            VSPF+N  SLGMKRAKTR
Sbjct  281  VSPFHNSLSLGMKRAKTR  298



>ref|XP_008447797.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Cucumis melo]
Length=296

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLLKP+       +ES DFYKK QLRELAMLNGTLREEGS MS S
Sbjct  227  EIIDARLMQAREILEDLLKPM-------EESHDFYKKQQLRELAMLNGTLREEGSPMSSS  279

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  280  VSPFHNSLGMKRAKTRG  296



>dbj|BAK03295.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLL+P+       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  156  EIIDARLMQAREILEDLLRPM-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  208

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  209  ASPFHNSLGMKRAKTRG  225



>ref|XP_009346681.1| PREDICTED: KH domain-containing protein At5g56140-like [Pyrus 
x bretschneideri]
Length=295

 Score =   119 bits (299),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 66/77 (86%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIID R +QARE+LEDLL+PV       DES+DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  226  EIIDTRLLQAREVLEDLLRPV-------DESRDFYKKQQLRELAILNGTLREEGSPMSGS  278

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  279  VSPFHNSLGMKRAKTRG  295



>ref|XP_010324227.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Solanum lycopersicum]
Length=303

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 67/78 (86%), Gaps = 9/78 (12%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAREILEDLLKP+       DESQDFYKK QLRELAMLNGTLREEGSQMSGS
Sbjct  232  EIIDARLLQAREILEDLLKPM-------DESQDFYKKQQLRELAMLNGTLREEGSQMSGS  284

Query  419  VSPFNN--SLGMKRAKTR  372
            VSPF+N  SLGMKRAKTR
Sbjct  285  VSPFHNSLSLGMKRAKTR  302



>ref|XP_010913290.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X8 [Elaeis guineensis]
Length=246

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  177  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  229

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  230  VSPFRNNLSMKRAKTRG  246



>gb|ACN25994.1| unknown [Zea mays]
 gb|AFW63659.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=148

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR MQAREIL+DLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q  GS
Sbjct  79   DIIDARLMQAREILQDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRFGS  131

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  132  ASPFHNSLGMKRAKTRG  148



>ref|XP_010913289.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X7 [Elaeis guineensis]
Length=260

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  191  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  243

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  244  VSPFRNNLSMKRAKTRG  260



>dbj|BAJ88160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREILEDLL+P+       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  218  EIIDARLMQAREILEDLLRPM-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  270

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  271  ASPFHNSLGMKRAKTRG  287



>ref|XP_006647814.1| PREDICTED: KH domain-containing protein At5g56140-like [Oryza 
brachyantha]
Length=285

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIID R MQAREILEDLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  216  EIIDTRLMQAREILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  268

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+N+LGMKRAKTRG
Sbjct  269  ASPFHNNLGMKRAKTRG  285



>ref|XP_010913287.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Elaeis guineensis]
Length=286

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  217  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  269

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  270  VSPFRNNLSMKRAKTRG  286



>ref|XP_010913288.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X6 [Elaeis guineensis]
Length=285

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  216  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  268

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  269  VSPFRNNLSMKRAKTRG  285



>ref|XP_010913286.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Elaeis guineensis]
Length=291

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  222  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  275  VSPFRNNLSMKRAKTRG  291



>ref|XP_010913285.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Elaeis guineensis]
Length=292

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  223  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  275

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  276  VSPFRNNLSMKRAKTRG  292



>ref|XP_010913282.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Elaeis guineensis]
Length=299

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  230  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  282

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  283  VSPFRNNLSMKRAKTRG  299



>ref|XP_010913284.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Elaeis guineensis]
Length=298

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS MS S
Sbjct  229  EIVDARLMQAREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHMSAS  281

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF N+L MKRAKTRG
Sbjct  282  VSPFRNNLSMKRAKTRG  298



>gb|EAZ24441.1| hypothetical protein OsJ_08192 [Oryza sativa Japonica Group]
Length=261

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIID R +QAR+ILEDLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  192  EIIDTRLIQARDILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  244

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  245  ASPFHNSLGMKRAKTRG  261



>gb|EAY87341.1| hypothetical protein OsI_08744 [Oryza sativa Indica Group]
 dbj|BAH01623.1| unnamed protein product [Oryza sativa Japonica Group]
Length=286

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIID R +QAR+ILEDLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  217  EIIDTRLIQARDILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  270  ASPFHNSLGMKRAKTRG  286



>ref|XP_003570477.1| PREDICTED: KH domain-containing protein At5g56140-like [Brachypodium 
distachyon]
Length=283

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAR+IL+DLLKP+       DESQDF+KK QLRELA+LNGTLREEG Q SGS
Sbjct  214  EIVDARLMQARDILQDLLKPI-------DESQDFFKKQQLRELALLNGTLREEGMQRSGS  266

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  267  ASPFHNSLGMKRAKTRG  283



>gb|ACN35020.1| unknown [Zea mays]
 gb|AFW63661.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=286

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR MQAREIL+DLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q  GS
Sbjct  217  DIIDARLMQAREILQDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRFGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  270  ASPFHNSLGMKRAKTRG  286



>ref|XP_009407925.1| PREDICTED: KH domain-containing protein At5g56140-like [Musa 
acuminata subsp. malaccensis]
Length=290

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREILED+LKPV       DES DF+KK QLRELAMLNGTLR++GS  SGS
Sbjct  221  EIVDARILQAREILEDMLKPV-------DESVDFFKKQQLRELAMLNGTLRDDGSHTSGS  273

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSLGMKRAKTRG
Sbjct  274  VSPFHNSLGMKRAKTRG  290



>dbj|BAD13019.1| putative KH domain protein [Oryza sativa Japonica Group]
 dbj|BAD13022.1| putative KH domain protein [Oryza sativa Japonica Group]
Length=341

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIID R +QAR+ILEDLLKPV       DESQDF+KK QLRELAMLNGTLREEG Q SGS
Sbjct  272  EIIDTRLIQARDILEDLLKPV-------DESQDFFKKQQLRELAMLNGTLREEGMQRSGS  324

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLGMKRAKTRG
Sbjct  325  ASPFHNSLGMKRAKTRG  341



>ref|XP_010539129.1| PREDICTED: KH domain-containing protein At4g26480 [Tarenaya hassleriana]
Length=236

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 65/78 (83%), Gaps = 8/78 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLL PV       DESQDFYKK QLRELAMLNG+LREEGS MSGS
Sbjct  166  EIVDARLMQAREILEDLLTPV-------DESQDFYKKQQLRELAMLNGSLREEGSPMSGS  218

Query  419  VSPFNN-SLGMKRAKTRG  369
            VSP+N+  +GMKRAKTRG
Sbjct  219  VSPYNSLGMGMKRAKTRG  236



>ref|XP_010063216.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Eucalyptus grandis]
Length=274

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAR+IL+DLLKPV       DESQD YKK QLRELAMLNGTLR+E S MSGS
Sbjct  205  EIIDARLIQARDILQDLLKPV-------DESQDVYKKQQLRELAMLNGTLRDESSPMSGS  257

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFN SLG+KRAKTRG
Sbjct  258  VSPFNTSLGLKRAKTRG  274



>ref|XP_010063215.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW70422.1| hypothetical protein EUGRSUZ_F03650 [Eucalyptus grandis]
Length=287

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR +QAR+IL+DLLKPV       DESQD YKK QLRELAMLNGTLR+E S MSGS
Sbjct  218  EIIDARLIQARDILQDLLKPV-------DESQDVYKKQQLRELAMLNGTLRDESSPMSGS  270

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPFN SLG+KRAKTRG
Sbjct  271  VSPFNTSLGLKRAKTRG  287



>ref|XP_010545297.1| PREDICTED: KH domain-containing protein At4g26480-like [Tarenaya 
hassleriana]
Length=314

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 63/77 (82%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQA EILEDLL PV       DES DFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  246  EIVDARLMQAHEILEDLLTPV-------DESHDFYKKQQLRELAMLNGTLREEGSPMSGS  298

Query  419  VSPFNNSLGMKRAKTRG  369
            VSP+ NSLGMKRAKTRG
Sbjct  299  VSPY-NSLGMKRAKTRG  314



>ref|XP_010928018.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Elaeis guineensis]
Length=286

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +I+DAR MQ REILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS +SGS
Sbjct  217  DIVDARLMQIREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHLSGS  269

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSL MKRAKTRG
Sbjct  270  GSPFRNSLSMKRAKTRG  286



>ref|XP_010928016.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Elaeis guineensis]
Length=292

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +I+DAR MQ REILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS +SGS
Sbjct  223  DIVDARLMQIREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHLSGS  275

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSL MKRAKTRG
Sbjct  276  GSPFRNSLSMKRAKTRG  292



>ref|XP_010928019.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Elaeis guineensis]
Length=285

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +I+DAR MQ REILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS +SGS
Sbjct  216  DIVDARLMQIREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHLSGS  268

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSL MKRAKTRG
Sbjct  269  GSPFRNSLSMKRAKTRG  285



>ref|XP_010928017.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Elaeis guineensis]
Length=291

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 63/77 (82%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +I+DAR MQ REILEDLLKPV       DESQDF+KK QLRELA+LNGTLREEGS +SGS
Sbjct  222  DIVDARLMQIREILEDLLKPV-------DESQDFFKKQQLRELALLNGTLREEGSHLSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF NSL MKRAKTRG
Sbjct  275  GSPFRNSLSMKRAKTRG  291



>ref|XP_009415555.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=272

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+D R MQAREILEDLLKPV       +ESQDF+KK QLRELAM+NGTLREEG  MSGS
Sbjct  203  EIVDTRLMQAREILEDLLKPV-------EESQDFFKKQQLRELAMINGTLREEGGHMSGS  255

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  256  VSPFHSSLSMKRAKTR  271



>ref|XP_009395891.1| PREDICTED: KH domain-containing protein At5g56140-like [Musa 
acuminata subsp. malaccensis]
Length=289

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQ REILED+LKPV       +ESQDF+KK QLRELAM+NGTLRE+G+ MSGS
Sbjct  220  EIVDARLMQVREILEDMLKPV-------EESQDFFKKQQLRELAMINGTLREDGAHMSGS  272

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  273  VSPFHNSLSMKRAKTR  288



>ref|XP_009415554.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+D R MQAREILEDLLKPV       +ESQDF+KK QLRELAM+NGTLREEG  MSGS
Sbjct  207  EIVDTRLMQAREILEDLLKPV-------EESQDFFKKQQLRELAMINGTLREEGGHMSGS  259

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  260  VSPFHSSLSMKRAKTR  275



>ref|XP_009415552.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=292

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+D R MQAREILEDLLKPV       +ESQDF+KK QLRELAM+NGTLREEG  MSGS
Sbjct  223  EIVDTRLMQAREILEDLLKPV-------EESQDFFKKQQLRELAMINGTLREEGGHMSGS  275

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  276  VSPFHSSLSMKRAKTR  291



>ref|XP_009415553.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=291

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 63/76 (83%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+D R MQAREILEDLLKPV       +ESQDF+KK QLRELAM+NGTLREEG  MSGS
Sbjct  222  EIVDTRLMQAREILEDLLKPV-------EESQDFFKKQQLRELAMINGTLREEGGHMSGS  274

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  275  VSPFHSSLSMKRAKTR  290



>ref|XP_009399821.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=291

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREIL+D+LKPV       DES DF+KK QLRELAMLNGTLR+EGS  SGS
Sbjct  222  EIVDARLLQAREILKDMLKPV-------DESVDFFKKQQLRELAMLNGTLRDEGSHTSGS  274

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLG+KRAKTRG
Sbjct  275  ASPFHNSLGLKRAKTRG  291



>ref|XP_009399829.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREIL+D+LKPV       DES DF+KK QLRELAMLNGTLR+EGS  SGS
Sbjct  207  EIVDARLLQAREILKDMLKPV-------DESVDFFKKQQLRELAMLNGTLRDEGSHTSGS  259

Query  419  VSPFNNSLGMKRAKTRG  369
             SPF+NSLG+KRAKTRG
Sbjct  260  ASPFHNSLGLKRAKTRG  276



>gb|ADE77960.1| unknown [Picea sitchensis]
Length=286

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 8/77 (10%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR MQAR+ILE+LLKPV       DESQDF+KK QLRELA+LNGTLRE+GS M+GSV
Sbjct  217  IIDARLMQARDILEELLKPV-------DESQDFFKKQQLRELAILNGTLREDGSSMAGSV  269

Query  416  SPFNNS-LGMKRAKTRG  369
            SPFN+S LGMKRAKTRG
Sbjct  270  SPFNSSNLGMKRAKTRG  286



>ref|XP_010539351.1| PREDICTED: KH domain-containing protein At5g56140 [Tarenaya hassleriana]
 ref|XP_010539352.1| PREDICTED: KH domain-containing protein At5g56140 [Tarenaya hassleriana]
Length=310

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLL P+       +E+ DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  242  EIVDARLMQAREILEDLLTPM-------EETHDFYKKQQLRELALLNGTLREEGSPMSGS  294

Query  419  VSPFNNSLGMKRAKTRG  369
            VSP+ NSLGMKRAKTRG
Sbjct  295  VSPY-NSLGMKRAKTRG  310



>ref|XP_010929006.1| PREDICTED: KH domain-containing protein At5g56140-like [Elaeis 
guineensis]
Length=291

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 62/77 (81%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAR ILEDLLKPV       DES DF+KK QLRELAMLNGTLREEG+  S S
Sbjct  222  EIVDARLMQARGILEDLLKPV-------DESLDFFKKQQLRELAMLNGTLREEGAHTSPS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF+NSL MKRAKTRG
Sbjct  275  VSPFHNSLSMKRAKTRG  291



>ref|XP_004973255.1| PREDICTED: KH domain-containing protein At4g26480-like [Setaria 
italica]
Length=282

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 63/77 (82%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+D R MQAREIL+D+LKPV       DES DF+KK QLRELAMLNGTLR++ SQ SGS
Sbjct  213  EIVDIRLMQAREILDDMLKPV-------DESMDFFKKQQLRELAMLNGTLRDDSSQKSGS  265

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF NS+GMKRAKTRG
Sbjct  266  VSPFRNSMGMKRAKTRG  282



>ref|XP_009410310.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREILEDLLKPV       +ES DF+K+ QLRELAM+NGTLR+EG+ MSGS
Sbjct  171  EIVDARLLQAREILEDLLKPV-------EESHDFFKQQQLRELAMINGTLRDEGTHMSGS  223

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  224  VSPFHSSLSMKRAKTR  239



>ref|XP_007020328.1| RNA-binding KH domain-containing protein [Theobroma cacao]
 gb|EOY11853.1| RNA-binding KH domain-containing protein [Theobroma cacao]
Length=312

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 60/70 (86%), Gaps = 7/70 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREILEDLLKPV       DESQDFYKK QLRELAMLNGTLREEGS MSGS
Sbjct  230  EIVDARLMQAREILEDLLKPV-------DESQDFYKKQQLRELAMLNGTLREEGSPMSGS  282

Query  419  VSPFNNSLGM  390
            VSPF+NSLG+
Sbjct  283  VSPFHNSLGV  292



>ref|XP_009410308.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=283

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREILEDLLKPV       +ES DF+K+ QLRELAM+NGTLR+EG+ MSGS
Sbjct  214  EIVDARLLQAREILEDLLKPV-------EESHDFFKQQQLRELAMINGTLRDEGTHMSGS  266

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  267  VSPFHSSLSMKRAKTR  282



>ref|XP_009410309.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR +QAREILEDLLKPV       +ES DF+K+ QLRELAM+NGTLR+EG+ MSGS
Sbjct  213  EIVDARLLQAREILEDLLKPV-------EESHDFFKQQQLRELAMINGTLRDEGTHMSGS  265

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF++SL MKRAKTR
Sbjct  266  VSPFHSSLSMKRAKTR  281



>ref|NP_194378.2| RNA-binding KH domain-containing protein [Arabidopsis thaliana]
 sp|Q0WLR1.1|QKIL1_ARATH RecName: Full=KH domain-containing protein At4g26480; AltName: 
Full=Quaking-like protein 1 [Arabidopsis thaliana]
 dbj|BAF01946.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85206.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana]
Length=308

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  240  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  292

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  293  ISPY-NSLGMKRAKTRG  308



>ref|XP_006284180.1| hypothetical protein CARUB_v10005327mg [Capsella rubella]
 gb|EOA17078.1| hypothetical protein CARUB_v10005327mg [Capsella rubella]
Length=306

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  238  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  290

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  291  ISPY-NSLGMKRAKTRG  306



>ref|XP_010448266.1| PREDICTED: KH domain-containing protein At4g26480 [Camelina sativa]
Length=307

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  239  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  291

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  292  ISPY-NSLGMKRAKTRG  307



>ref|XP_010438749.1| PREDICTED: KH domain-containing protein At4g26480-like [Camelina 
sativa]
Length=308

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  240  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  292

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  293  ISPY-NSLGMKRAKTRG  308



>ref|XP_006413178.1| hypothetical protein EUTSA_v10025796mg [Eutrema salsugineum]
 gb|ESQ54631.1| hypothetical protein EUTSA_v10025796mg [Eutrema salsugineum]
Length=309

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  241  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  293

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  294  ISPY-NSLGMKRAKTRG  309



>gb|KFK29165.1| hypothetical protein AALP_AA7G098000 [Arabis alpina]
Length=312

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  244  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  296

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  297  ISPY-NSLGMKRAKTRG  312



>ref|XP_008782987.1| PREDICTED: KH domain-containing protein At5g56140 [Phoenix dactylifera]
Length=291

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 62/77 (81%), Gaps = 7/77 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAR ILEDLLKPV       DES DF+KK QLRELAMLNGTLREEG+  S S
Sbjct  222  EIVDARLMQARGILEDLLKPV-------DESLDFFKKQQLRELAMLNGTLREEGAHTSPS  274

Query  419  VSPFNNSLGMKRAKTRG  369
            VSPF++SL MKRAKTRG
Sbjct  275  VSPFHSSLSMKRAKTRG  291



>ref|XP_006401374.1| hypothetical protein EUTSA_v10014150mg [Eutrema salsugineum]
 gb|ESQ42827.1| hypothetical protein EUTSA_v10014150mg [Eutrema salsugineum]
Length=314

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 63/76 (83%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  245  EIVDARLMQAREILDDLLTPM-------EETHDFYKKQQLRELALLNGTLREEGSPMSGS  297

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  298  VSPY-NSLGMKRAKTR  312



>ref|XP_010433498.1| PREDICTED: KH domain-containing protein At4g26480-like [Camelina 
sativa]
Length=308

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQA EIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  240  EIVDARLMQAHEILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  292

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  293  ISPY-NSLGMKRAKTRG  308



>ref|XP_002452631.1| hypothetical protein SORBIDRAFT_04g029426 [Sorghum bicolor]
 gb|EES05607.1| hypothetical protein SORBIDRAFT_04g029426 [Sorghum bicolor]
Length=98

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 60/77 (78%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAML-NGTLREEGSQMSG  423
            EIIDAR MQ REILEDLLK +       DES DF+KK QLRELAML NGTLREEG Q SG
Sbjct  28   EIIDARLMQTREILEDLLKAL-------DESLDFFKKQQLRELAMLHNGTLREEGMQRSG  80

Query  422  SVSPFNNSLGMKRAKTR  372
            S SPF+N LGMKRAKTR
Sbjct  81   SASPFHNHLGMKRAKTR  97



>gb|AAM14070.1| unknown protein [Arabidopsis thaliana]
Length=308

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  240  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  292

Query  419  VSPFNNSLGMKRAKTR  372
            +SP+ NSLGMKRAKTR
Sbjct  293  ISPY-NSLGMKRAKTR  307



>emb|CDY42731.1| BnaA03g48080D [Brassica napus]
Length=302

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  234  EIVDARLMQAREILADLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  286

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  287  VSPY-NSLGMKRAKTR  301



>ref|XP_009137598.1| PREDICTED: KH domain-containing protein At4g26480-like [Brassica 
rapa]
Length=309

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  241  EIVDARLMQAREILADLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  293

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  294  VSPY-NSLGMKRAKTR  308



>gb|AFB34202.1| hypothetical protein CL3054Contig1_01, partial [Larix decidua]
Length=80

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 60/74 (81%), Gaps = 7/74 (9%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDA+  QAR+I+ED+LKPV       DES D++KK QLRELA+LNGTLREE  +MSGSV
Sbjct  12   IIDAKLKQARDIIEDMLKPV-------DESHDYFKKQQLRELALLNGTLREESPRMSGSV  64

Query  416  SPFNNSLGMKRAKT  375
            SPF+NS GMKRAKT
Sbjct  65   SPFSNSGGMKRAKT  78



>emb|CAA18222.1| putative protein [Arabidopsis thaliana]
 emb|CAB79503.1| putative protein [Arabidopsis thaliana]
Length=555

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 64/77 (83%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  487  EIVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  539

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  540  ISPY-NSLGMKRAKTRG  555



>emb|CDX92817.1| BnaC07g40750D [Brassica napus]
Length=301

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL DLL PV       +E+ DFYKK QLRELA+LNG++REEGS MSGS
Sbjct  233  EIVDARLMQAREILADLLTPV-------EETHDFYKKQQLRELALLNGSIREEGSPMSGS  285

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  286  VSPY-NSLGMKRAKTR  300



>emb|CDY66744.1| BnaAnng22840D [Brassica napus]
Length=314

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            E++DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  246  ELVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  298

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  299  VSPY-NSLGMKRAKTR  313



>ref|XP_009142357.1| PREDICTED: KH domain-containing protein At4g26480 [Brassica rapa]
Length=314

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            E++DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG LREEGS MSGS
Sbjct  246  ELVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGNLREEGSPMSGS  298

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  299  VSPY-NSLGMKRAKTR  313



>emb|CDY11960.1| BnaC03g13860D [Brassica napus]
Length=301

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQARE+L++LL P+       +E+ DFYKK QLRELA+LNGTLREEGS MSGS
Sbjct  232  EIVDARLMQAREVLDELLTPM-------EETHDFYKKQQLRELALLNGTLREEGSPMSGS  284

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  285  VSPY-NSLGMKRAKTR  299



>ref|XP_006280844.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
 gb|EOA13742.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
Length=311

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLREEGS MSGS
Sbjct  242  EIVDARLMQAREILDDLLTPM-------EETHDLYKKQQLRELALLNGTLREEGSPMSGS  294

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  295  VSPY-NSLGMKRAKTR  309



>ref|XP_002864436.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40695.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=308

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLREEGS MSGS
Sbjct  239  EIVDARLMQAREILDDLLTPM-------EETHDLYKKQQLRELALLNGTLREEGSPMSGS  291

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  292  VSPY-NSLGMKRAKTR  306



>ref|NP_200425.1| KH domain-containing protein [Arabidopsis thaliana]
 sp|Q9FKT4.1|QKIL2_ARATH RecName: Full=KH domain-containing protein At5g56140; AltName: 
Full=Quaking-like protein 2 [Arabidopsis thaliana]
 dbj|BAB09296.1| RNA-binding protein-like [Arabidopsis thaliana]
 gb|AAN41273.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AED96725.1| KH domain-containing protein [Arabidopsis thaliana]
Length=315

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLREEGS MSGS
Sbjct  246  EIVDARLMQAREILDDLLTPM-------EETHDMYKKQQLRELALLNGTLREEGSPMSGS  298

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  299  VSPY-NSLGMKRAKTR  313



>ref|XP_009120127.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Brassica rapa]
Length=251

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  181  EIIDARLMQAREILDDLLTPM-------EETHDVYKKQQLRELALLNGTLRDEGSPMSGS  233

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF N LGMKRAKTR
Sbjct  234  VSPF-NGLGMKRAKTR  248



>emb|CDX94326.1| BnaC01g18580D [Brassica napus]
Length=312

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            E++DAR MQAREIL+DLL PV       +E+ DFYKK QLRELA+LNG+LREEGS MSGS
Sbjct  244  ELVDARLMQAREILDDLLTPV-------EETHDFYKKQQLRELALLNGSLREEGSPMSGS  296

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ +SLGMKRAKTR
Sbjct  297  VSPY-DSLGMKRAKTR  311



>ref|XP_010942516.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Elaeis guineensis]
Length=239

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAR+ILEDL+KPV       DES DF+KK QLRELAMLNGT+RE+    S S
Sbjct  170  EIIDARLMQARDILEDLVKPV-------DESLDFFKKQQLRELAMLNGTIREDVPHTSPS  222

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  223  VSPFHNSLSMKRAKTR  238



>ref|XP_010942514.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Elaeis guineensis]
Length=276

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAR+ILEDL+KPV       DES DF+KK QLRELAMLNGT+RE+    S S
Sbjct  207  EIIDARLMQARDILEDLVKPV-------DESLDFFKKQQLRELAMLNGTIREDVPHTSPS  259

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  260  VSPFHNSLSMKRAKTR  275



>ref|XP_010942515.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Elaeis guineensis]
Length=274

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAR+ILEDL+KPV       DES DF+KK QLRELAMLNGT+RE+    S S
Sbjct  205  EIIDARLMQARDILEDLVKPV-------DESLDFFKKQQLRELAMLNGTIREDVPHTSPS  257

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  258  VSPFHNSLSMKRAKTR  273



>ref|XP_010443253.1| PREDICTED: KH domain-containing protein At5g56140-like [Camelina 
sativa]
Length=310

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  241  EIVDARLMQAREILDDLLTPM-------EETHDLYKKQQLRELALLNGTLRDEGSPMSGS  293

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  294  VSPY-NSLGMKRAKTR  308



>ref|XP_002867563.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43822.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=565

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (82%), Gaps = 8/77 (10%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL PV       +E+ D YKK QLRELA+LNG+LREEGS MSGS
Sbjct  497  EIVDARLMQAREILDDLLTPV-------EETHDLYKKQQLRELALLNGSLREEGSPMSGS  549

Query  419  VSPFNNSLGMKRAKTRG  369
            +SP+ NSLGMKRAKTRG
Sbjct  550  ISPY-NSLGMKRAKTRG  565



>ref|XP_010483081.1| PREDICTED: KH domain-containing protein At5g56140-like [Camelina 
sativa]
Length=314

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  245  EIVDARLMQAREILDDLLTPM-------EETHDLYKKQQLRELALLNGTLRDEGSPMSGS  297

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  298  VSPY-NSLGMKRAKTR  312



>ref|XP_009120126.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Brassica rapa]
Length=304

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  234  EIIDARLMQAREILDDLLTPM-------EETHDVYKKQQLRELALLNGTLRDEGSPMSGS  286

Query  419  VSPFNNSLGMKRAKTR  372
            VSPFN  LGMKRAKTR
Sbjct  287  VSPFNG-LGMKRAKTR  301



>ref|XP_010450699.1| PREDICTED: KH domain-containing protein At5g56140 [Camelina sativa]
Length=318

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  249  EIVDARLMQAREILDDLLTPM-------EETHDLYKKQQLRELALLNGTLRDEGSPMSGS  301

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  302  VSPY-NSLGMKRAKTR  316



>ref|XP_010942513.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Elaeis guineensis]
Length=289

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAR+ILEDL+KPV       DES DF+KK QLRELAMLNGT+RE+    S S
Sbjct  220  EIIDARLMQARDILEDLVKPV-------DESLDFFKKQQLRELAMLNGTIREDVPHTSPS  272

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  273  VSPFHNSLSMKRAKTR  288



>ref|XP_010942512.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Elaeis guineensis]
Length=291

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAR+ILEDL+KPV       DES DF+KK QLRELAMLNGT+RE+    S S
Sbjct  222  EIIDARLMQARDILEDLVKPV-------DESLDFFKKQQLRELAMLNGTIREDVPHTSPS  274

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  275  VSPFHNSLSMKRAKTR  290



>emb|CDY17395.1| BnaA10g10290D [Brassica napus]
Length=304

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  234  EIIDARLMQAREILDDLLTPM-------EETHDVYKKQQLRELALLNGTLRDEGSPMSGS  286

Query  419  VSPFNNSLGMKRAKTR  372
            VSPFN  LGMKRAKTR
Sbjct  287  VSPFNG-LGMKRAKTR  301



>gb|AAL87326.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=260

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI++AR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLREEGS MSGS
Sbjct  191  EIVNARLMQAREILDDLLTPM-------EETHDMYKKQQLRELALLNGTLREEGSPMSGS  243

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  244  VSPY-NSLGMKRAKTR  258



>ref|XP_009132341.1| PREDICTED: KH domain-containing protein At5g56140-like [Brassica 
rapa]
 emb|CDY36777.1| BnaA03g11090D [Brassica napus]
Length=304

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQARE+L++LL P+       +E+ DFYKK QLRELA+LNG LREEGS MSGS
Sbjct  235  EIVDARLMQAREVLDELLTPM-------EETHDFYKKQQLRELALLNGALREEGSPMSGS  287

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  288  VSPY-NSLGMKRAKTR  302



>emb|CDY51960.1| BnaCnng21440D [Brassica napus]
Length=306

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ D YKK QLRELA+LNGTLR+EGS MSGS
Sbjct  236  EIVDARLMQAREILDDLLTPM-------EETHDVYKKQQLRELALLNGTLRDEGSPMSGS  288

Query  419  VSPFNNSLGMKRAKTR  372
            VSPFN  LGMKRAKTR
Sbjct  289  VSPFNG-LGMKRAKTR  303



>gb|AFB34203.1| hypothetical protein CL3054Contig1_01, partial [Pinus mugo]
 gb|AFB34204.1| hypothetical protein CL3054Contig1_01, partial [Pinus mugo]
 gb|AFB34205.1| hypothetical protein CL3054Contig1_01, partial [Pinus mugo]
Length=79

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 60/74 (81%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDA+  QAR+I+ D+LKPV       DESQD++KK QLRELA+LNGTLREE  +MSGSV
Sbjct  12   IIDAKLKQARDIIGDMLKPV-------DESQDYFKKQQLRELALLNGTLREESPRMSGSV  64

Query  416  SPFNNSLGMKRAKT  375
            SPF+NS GMKRAKT
Sbjct  65   SPFSNS-GMKRAKT  77



>gb|KFK27184.1| hypothetical protein AALP_AA8G346800 [Arabis alpina]
Length=320

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAREIL+DLL P+       +E+ DFYKK QLRELA+LNG LR+EG  MSGS
Sbjct  251  EIVDARLMQAREILDDLLTPM-------EETHDFYKKQQLRELALLNGNLRQEGPPMSGS  303

Query  419  VSPFNNSLGMKRAKTR  372
            VSP+ NSLGMKRAKTR
Sbjct  304  VSPY-NSLGMKRAKTR  318



>ref|XP_008794733.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Phoenix dactylifera]
Length=273

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAR+ILE+LLKPV       DES DF+KK QLRELAMLNGTLRE+  Q S S
Sbjct  205  EIVDARLMQARDILEELLKPV-------DESLDFFKKQQLRELAMLNGTLREDVPQ-SPS  256

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  257  VSPFHNSLSMKRAKTR  272



>ref|XP_008794732.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Phoenix dactylifera]
Length=288

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 61/76 (80%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EI+DAR MQAR+ILE+LLKPV       DES DF+KK QLRELAMLNGTLRE+  Q S S
Sbjct  220  EIVDARLMQARDILEELLKPV-------DESLDFFKKQQLRELAMLNGTLREDVPQ-SPS  271

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+NSL MKRAKTR
Sbjct  272  VSPFHNSLSMKRAKTR  287



>gb|ABK25791.1| unknown [Picea sitchensis]
Length=294

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR  QA EI++DLLKPV       DES DF+KK QLRELAMLNGTLREE   MSGSV
Sbjct  227  IIDARMKQAFEIIDDLLKPV-------DESHDFFKKQQLRELAMLNGTLREESPHMSGSV  279

Query  416  SPFNNSLGMKRAKT  375
            SPFNN+ GMKR KT
Sbjct  280  SPFNNA-GMKRPKT  292



>ref|XP_008786388.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Phoenix dactylifera]
Length=296

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 59/76 (78%), Gaps = 8/76 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +++DAR  QA  ILEDLLKPV       DES+D+YKK QLRELA+LNGTLREE  QMS S
Sbjct  228  DVVDARLSQAVGILEDLLKPV-------DESKDYYKKQQLRELALLNGTLREESPQMSPS  280

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF NS GMKRAKTR
Sbjct  281  VSPF-NSTGMKRAKTR  295



>gb|ABR16439.1| unknown [Picea sitchensis]
Length=289

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            +IDA+  QAR+I+ED+LKPV       DES D++KK QLRELA+LNGTLREE  +MSGSV
Sbjct  222  VIDAKLKQARDIIEDMLKPV-------DESHDYFKKQQLRELALLNGTLREESPRMSGSV  274

Query  416  SPFNNSLGMKRAKT  375
            SPF+NS GMKRAKT
Sbjct  275  SPFSNS-GMKRAKT  287



>ref|XP_010930408.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X2 [Elaeis guineensis]
Length=299

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 57/75 (76%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            ++IDAR  QA  ILEDLLKPV       DES+D+YKK QLRELAMLNGTLREE  QMS S
Sbjct  231  DMIDARLSQAVGILEDLLKPV-------DESKDYYKKQQLRELAMLNGTLREESPQMSPS  283

Query  419  VSPFNNSLGMKRAKT  375
             SPF NS GMKRAKT
Sbjct  284  ASPF-NSTGMKRAKT  297



>ref|XP_003573788.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Brachypodium distachyon]
Length=283

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 7/74 (9%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            EIIDAR MQ +EIL+D+LKPV       DE+ +F+K  QLRELAM+NGTL ++GSQ SGS
Sbjct  214  EIIDARLMQTQEILDDMLKPV-------DETMEFFKTQQLRELAMINGTLIDDGSQNSGS  266

Query  419  VSPFNNSLGMKRAK  378
            VSPF   LGMKRAK
Sbjct  267  VSPFRGDLGMKRAK  280



>ref|XP_009414641.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Musa 
acuminata subsp. malaccensis]
Length=295

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 57/75 (76%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE  Q+S S
Sbjct  227  DIIDARLNQAVAILEDLLKPV-------DESVDYYKKQQLRELAILNGTLREESPQLSPS  279

Query  419  VSPFNNSLGMKRAKT  375
            +SPF NS GMKRAKT
Sbjct  280  LSPF-NSTGMKRAKT  293



>ref|XP_010278944.1| PREDICTED: KH domain-containing protein At2g38610 [Nelumbo nucifera]
Length=281

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDFYK+ QLRELAMLN  LREE  + SGSV
Sbjct  214  IVDTRLRQAQEIIEELLKPV-------DESQDFYKRQQLRELAMLNSNLREESPRPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPF NS GMKRAKT
Sbjct  267  SPF-NSTGMKRAKT  279



>ref|XP_010930407.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X1 [Elaeis guineensis]
Length=329

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 61/98 (62%), Gaps = 24/98 (24%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYL-----------------------LLMQDESQDFYKK  489
            ++IDAR  QA  ILEDLLKPV +                        +L QDES+D+YKK
Sbjct  231  DMIDARLSQAVGILEDLLKPVVHKRNSNTLSSLSLSLAHACTSTANEILFQDESKDYYKK  290

Query  488  HQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMKRAKT  375
             QLRELAMLNGTLREE  QMS S SPF NS GMKRAKT
Sbjct  291  QQLRELAMLNGTLREESPQMSPSASPF-NSTGMKRAKT  327



>ref|XP_010245420.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Nelumbo nucifera]
Length=298

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            ++ID+R  QA  ILEDLLKPV       DES D+YKK QLRELAMLNGTLREE   MS S
Sbjct  230  DVIDSRLNQAVAILEDLLKPV-------DESLDYYKKQQLRELAMLNGTLREESPHMSPS  282

Query  419  VSPFNNSLGMKRAKT  375
            +SPF NS GMKRAKT
Sbjct  283  MSPF-NSTGMKRAKT  296



>ref|XP_010245421.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X2 [Nelumbo nucifera]
Length=293

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 56/75 (75%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            ++ID+R  QA  ILEDLLKPV       DES D+YKK QLRELAMLNGTLREE   MS S
Sbjct  225  DVIDSRLNQAVAILEDLLKPV-------DESLDYYKKQQLRELAMLNGTLREESPHMSPS  277

Query  419  VSPFNNSLGMKRAKT  375
            +SPF NS GMKRAKT
Sbjct  278  MSPF-NSTGMKRAKT  291



>gb|EMT02598.1| hypothetical protein F775_43967 [Aegilops tauschii]
Length=197

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = -2

Query  515  DESQDFYKKHQLRELAMLNGTLREEGSQMSGSVSPFNNSLGMKRAKTRG  369
            DESQDF+KK QLRELAMLNGTLREEG Q SGS SPF+NSLGMKRAKTRG
Sbjct  92   DESQDFFKKQQLRELAMLNGTLREEGMQRSGSASPFHNSLGMKRAKTRG  140



>gb|AAO60031.1| unknown protein, 5'-partial [Oryza sativa Japonica Group]
Length=95

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+E++E+LLKPV       DESQDFYK+ QLRELAMLN TLRE+ S   GSV
Sbjct  29   IIDARLRHAQEVIEELLKPV-------DESQDFYKRQQLRELAMLNSTLRED-SPHPGSV  80

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  81   SPFSNG-GMKRAKT  93



>ref|XP_008775562.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X2 [Phoenix dactylifera]
Length=277

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR  QA  +LEDLLKPV       DE+ D+YKK QLRELA+LNGTLREE   MS S
Sbjct  209  DIIDARLNQAVRVLEDLLKPV-------DETIDYYKKQQLRELAILNGTLREESPHMSPS  261

Query  419  VSPFNNSLGMKRAKT  375
             SPF NS GMKRAKT
Sbjct  262  ASPF-NSTGMKRAKT  275



>ref|XP_008775561.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Phoenix dactylifera]
Length=293

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR  QA  +LEDLLKPV       DE+ D+YKK QLRELA+LNGTLREE   MS S
Sbjct  225  DIIDARLNQAVRVLEDLLKPV-------DETIDYYKKQQLRELAILNGTLREESPHMSPS  277

Query  419  VSPFNNSLGMKRAKT  375
             SPF NS GMKRAKT
Sbjct  278  ASPF-NSTGMKRAKT  291



>ref|XP_006842569.1| hypothetical protein AMTR_s00077p00149420 [Amborella trichopoda]
 gb|ERN04244.1| hypothetical protein AMTR_s00077p00149420 [Amborella trichopoda]
Length=279

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 56/75 (75%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IID+R  QAREI+E+LLKPV       DESQD YK+ QLRELA LN T RE+    SGS
Sbjct  211  DIIDSRLRQAREIIEELLKPV-------DESQDHYKRQQLRELAFLNSTFREDSPCPSGS  263

Query  419  VSPFNNSLGMKRAKT  375
            +SPFNNS GMKRAKT
Sbjct  264  LSPFNNS-GMKRAKT  277



>ref|XP_010927868.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Elaeis guineensis]
Length=293

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 54/75 (72%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR  QA  +LEDLLKPV       DES D+YKK QLRELA+LNGTLREE   MS S
Sbjct  225  DIIDARLNQAVAVLEDLLKPV-------DESMDYYKKQQLRELAILNGTLREESPHMSPS  277

Query  419  VSPFNNSLGMKRAKT  375
             SPF NS  MKRAKT
Sbjct  278  ASPF-NSTAMKRAKT  291



>ref|XP_010931399.1| PREDICTED: KH domain-containing protein SPIN1-like [Elaeis guineensis]
Length=258

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQD+YK+ QLRELAMLN +LRE+    SGSV
Sbjct  191  VVDVRLRQAQEIIEELLKPV-------DESQDYYKRQQLRELAMLNSSLREDSPHPSGSV  243

Query  416  SPFNNSLGMKRAKT  375
            SPF NS GMKRAKT
Sbjct  244  SPFGNS-GMKRAKT  256



>ref|XP_006858588.1| hypothetical protein AMTR_s00071p00192730 [Amborella trichopoda]
 gb|ERN20055.1| hypothetical protein AMTR_s00071p00192730 [Amborella trichopoda]
Length=298

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR  +A  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE  +MS S+
Sbjct  231  IIDARMNEAVGILEDLLKPV-------DESLDYYKKQQLRELALLNGTLREESPRMSPSL  283

Query  416  SPFNNSLGMKRAKT  375
            SPFN + GMKRAKT
Sbjct  284  SPFNTT-GMKRAKT  296



>ref|XP_010908089.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Elaeis 
guineensis]
Length=293

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +II+AR  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLR+E   MS S
Sbjct  225  DIINARLNQAVAILEDLLKPV-------DESMDYYKKQQLRELAILNGTLRDESPHMSPS  277

Query  419  VSPFNNSLGMKRAKT  375
             SPF NS GMKRAKT
Sbjct  278  ASPF-NSTGMKRAKT  291



>ref|XP_010244588.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X1 [Nelumbo nucifera]
Length=281

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDFYK+ QLRELAMLN   REE  + SGSV
Sbjct  214  IVDIRLRQAQEIIEELLKPV-------DESQDFYKRQQLRELAMLNSNFREESPRPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN++ GMKRAKT
Sbjct  267  SPFNSN-GMKRAKT  279



>ref|XP_006645141.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Oryza brachyantha]
Length=290

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 56/77 (73%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +IIDAR  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  220  DIIDARLNQAVTILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  272

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  273  PSVSPF-NSTGMKRAKT  288



>ref|XP_004962052.1| PREDICTED: KH domain-containing protein At1g09660-like isoform 
X2 [Setaria italica]
Length=251

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 55/75 (73%), Gaps = 10/75 (13%)
 Frame = -2

Query  593  IDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMSGS  420
            +DAR  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE   S +S S
Sbjct  183  VDARLNQAVAILEDLLKPV-------DESMDYYKKQQLRELAILNGTLREESPSSHLSPS  235

Query  419  VSPFNNSLGMKRAKT  375
            VSPF NS GMKRAKT
Sbjct  236  VSPF-NSTGMKRAKT  249



>ref|XP_002441114.1| hypothetical protein SORBIDRAFT_09g020640 [Sorghum bicolor]
 gb|EES19544.1| hypothetical protein SORBIDRAFT_09g020640 [Sorghum bicolor]
Length=292

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 56/77 (73%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQ--MS  426
            +I+DAR  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  222  DIVDARLNQAVAILEDLLKPV-------DESMDYYKKQQLRELAILNGTLREESPSPYLS  274

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  275  PSVSPF-NSTGMKRAKT  290



>ref|XP_004981292.1| PREDICTED: KH domain-containing protein SPIN1-like [Setaria italica]
Length=279

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+EI+E+LLKPV       DESQDFYK+ QLRELAMLN TLRE+ S   GSV
Sbjct  213  IIDARLRHAQEIIEELLKPV-------DESQDFYKRQQLRELAMLNSTLRED-SPHPGSV  264

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  265  SPFSNG-GMKRAKT  277



>ref|XP_002466215.1| hypothetical protein SORBIDRAFT_01g003680 [Sorghum bicolor]
 gb|EER93213.1| hypothetical protein SORBIDRAFT_01g003680 [Sorghum bicolor]
Length=279

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+EI+E+LLKPV       DESQDFYK+ QLRELAMLN TLRE+ S   GSV
Sbjct  213  IIDARLRHAQEIIEELLKPV-------DESQDFYKRQQLRELAMLNSTLRED-SPHPGSV  264

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  265  SPFSNG-GMKRAKT  277



>ref|XP_002456759.1| hypothetical protein SORBIDRAFT_03g042090 [Sorghum bicolor]
 gb|EES01879.1| hypothetical protein SORBIDRAFT_03g042090 [Sorghum bicolor]
Length=293

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 56/77 (73%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +++DAR  QA  ILEDLLKP+       DES DFYKK QLRELA+LNGTLREE     +S
Sbjct  223  DMVDARLNQAVSILEDLLKPI-------DESMDFYKKQQLRELAILNGTLREESPSPHLS  275

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  276  PSVSPF-NSTGMKRAKT  291



>ref|XP_002533340.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29039.1| nucleic acid binding protein, putative, partial [Ricinus communis]
Length=274

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QAREI+E+LLKPV       DESQD YK+ QLRELAMLN   REE  + SGSV
Sbjct  207  IVDMRLRQAREIIEELLKPV-------DESQDIYKRQQLRELAMLNSNYREESPRPSGSV  259

Query  416  SPFNNSLGMKRAKT  375
            SPF +S GMKRAKT
Sbjct  260  SPFTSS-GMKRAKT  272



>gb|KHN18643.1| KH domain-containing protein [Glycine soja]
Length=283

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R MQA+EI+++LLKPV       DESQDFYK+ QLRELAMLN   REE  Q+SGSV
Sbjct  216  VVDVRLMQAQEIIQELLKPV-------DESQDFYKRQQLRELAMLNSNFREESPQLSGSV  268

Query  416  SPFNNSLGMKRAKT  375
            SPF ++  +KRAKT
Sbjct  269  SPFTSN-EIKRAKT  281



>ref|XP_003553178.1| PREDICTED: KH domain-containing protein At3g08620-like [Glycine 
max]
Length=283

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R MQA+EI+++LLKPV       DESQDFYK+ QLRELAMLN   REE  Q+SGSV
Sbjct  216  VVDVRLMQAQEIIQELLKPV-------DESQDFYKRQQLRELAMLNSNFREESPQLSGSV  268

Query  416  SPFNNSLGMKRAKT  375
            SPF ++  +KRAKT
Sbjct  269  SPFTSN-EIKRAKT  281



>ref|XP_004962051.1| PREDICTED: KH domain-containing protein At1g09660-like isoform 
X1 [Setaria italica]
Length=290

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 55/75 (73%), Gaps = 10/75 (13%)
 Frame = -2

Query  593  IDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMSGS  420
            +DAR  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE   S +S S
Sbjct  222  VDARLNQAVAILEDLLKPV-------DESMDYYKKQQLRELAILNGTLREESPSSHLSPS  274

Query  419  VSPFNNSLGMKRAKT  375
            VSPF NS GMKRAKT
Sbjct  275  VSPF-NSTGMKRAKT  288



>ref|NP_001051685.1| Os03g0815700 [Oryza sativa Japonica Group]
 sp|Q75GR5.1|SPIN1_ORYSJ RecName: Full=KH domain-containing protein SPIN1; AltName: Full=SPL11-interacting 
protein 1 [Oryza sativa Japonica Group]
 gb|AAR01750.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99540.1| KH domain-containing protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13599.1| Os03g0815700 [Oryza sativa Japonica Group]
 dbj|BAG89507.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76407.1| hypothetical protein OsI_14057 [Oryza sativa Indica Group]
 gb|EEE60169.1| hypothetical protein OsJ_13097 [Oryza sativa Japonica Group]
Length=281

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+E++E+LLKPV       DESQDFYK+ QLRELAMLN TLRE+ S   GSV
Sbjct  215  IIDARLRHAQEVIEELLKPV-------DESQDFYKRQQLRELAMLNSTLRED-SPHPGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  267  SPFSNG-GMKRAKT  279



>ref|XP_006650789.1| PREDICTED: KH domain-containing protein SPIN1-like [Oryza brachyantha]
Length=280

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+E++E+LLKPV       DESQDFYK+ QLRELA+LN TLRE+ S   GSV
Sbjct  214  IIDARLRHAQEVIEELLKPV-------DESQDFYKRQQLRELAVLNSTLRED-SPHPGSV  265

Query  416  SPFNNSLGMKRAKT  375
            SPF+NS GMKRAKT
Sbjct  266  SPFSNS-GMKRAKT  278



>ref|XP_010922800.1| PREDICTED: KH domain-containing protein SPIN1-like [Elaeis guineensis]
Length=281

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQD+YK+ QLRELAMLN  LRE+    SGSV
Sbjct  214  VVDIRLRQAQEIIEELLKPV-------DESQDYYKRQQLRELAMLNSGLREDSLHPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPF NS GMKRAKT
Sbjct  267  SPFGNS-GMKRAKT  279



>ref|XP_008803015.1| PREDICTED: LOW QUALITY PROTEIN: KH domain-containing protein 
SPIN1-like [Phoenix dactylifera]
Length=281

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKP+       DESQD+YK+ QLRELAMLN  LRE+    SGSV
Sbjct  214  VVDVRLRQAQEIIEELLKPI-------DESQDYYKRQQLRELAMLNSGLREDSLHPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPF NS GMKRAKT
Sbjct  267  SPFGNS-GMKRAKT  279



>ref|XP_009411877.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Musa acuminata subsp. malaccensis]
Length=295

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 54/75 (72%), Gaps = 8/75 (11%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGS  420
            +IIDAR  QA  ILEDLLKPV       +ES D+YKK QLRELA+LNG+LREE   MS S
Sbjct  227  DIIDARINQAVAILEDLLKPV-------EESVDYYKKQQLRELAILNGSLREESPHMSPS  279

Query  419  VSPFNNSLGMKRAKT  375
             SPF NS  MKRAKT
Sbjct  280  ASPF-NSTSMKRAKT  293



>ref|XP_011095178.1| PREDICTED: KH domain-containing protein At2g38610 [Sesamum indicum]
Length=282

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  215  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  267

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  268  SPFNTS-GMKRAKT  280



>ref|XP_009772459.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana sylvestris]
Length=258

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D +  QAREI+E+LLKPV       DESQD YK+HQLRELA+LN   REE  Q  GS+
Sbjct  191  IVDTQLKQAREIIEELLKPV-------DESQDLYKRHQLRELALLNNNFREESPQPRGSL  243

Query  416  SPFNNSLGMKRAKT  375
            SPF++S GMKRAKT
Sbjct  244  SPFSSS-GMKRAKT  256



>ref|NP_001045029.1| Os01g0886300 [Oryza sativa Japonica Group]
 dbj|BAD82237.1| QUAKING isoform 5-like [Oryza sativa Japonica Group]
 dbj|BAD82121.1| QUAKING isoform 5-like [Oryza sativa Japonica Group]
 dbj|BAF06943.1| Os01g0886300 [Oryza sativa Japonica Group]
 gb|EAY76753.1| hypothetical protein OsI_04709 [Oryza sativa Indica Group]
 gb|EAZ14414.1| hypothetical protein OsJ_04338 [Oryza sativa Japonica Group]
 dbj|BAG89356.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +IID R  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  220  DIIDTRLNQAVTILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  272

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  273  PSVSPF-NSTGMKRAKT  288



>gb|EMT27361.1| KH domain-containing protein [Aegilops tauschii]
Length=242

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   AREILE+LLKPV       DE+QD YK+ QLRELAMLN TLRE+ S   GSV
Sbjct  176  IIDARLRHAREILEELLKPV-------DETQDIYKRQQLRELAMLNSTLRED-SPHPGSV  227

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  228  SPFSNG-GMKRAKT  240



>ref|XP_011006271.1| PREDICTED: KH domain-containing protein At2g38610 [Populus euphratica]
Length=281

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  267  SPFNTS-GMKRAKT  279



>ref|XP_006381264.1| hypothetical protein POPTR_0006s11210g [Populus trichocarpa]
 gb|ERP59061.1| hypothetical protein POPTR_0006s11210g [Populus trichocarpa]
Length=238

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  171  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  223

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  224  SPFNTS-GMKRAKT  236



>ref|XP_002323686.2| KH domain-containing family protein [Populus trichocarpa]
 gb|EEF05447.2| KH domain-containing family protein [Populus trichocarpa]
Length=281

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  267  SPFNTS-GMKRAKT  279



>ref|XP_009600354.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana tomentosiformis]
Length=258

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D +  QAREI+E+LLKPV       DESQD YK+HQLRELA+LN   REE  Q  GS+
Sbjct  191  IVDTQLKQAREIIEELLKPV-------DESQDLYKRHQLRELALLNNNFREESPQPRGSL  243

Query  416  SPFNNSLGMKRAKT  375
            SPF++S GMKRAKT
Sbjct  244  SPFSSS-GMKRAKT  256



>ref|XP_006654416.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X2 [Oryza brachyantha]
Length=251

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +I+D R  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  181  DIVDVRLNQAVAILEDLLKPV-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  233

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  234  PSVSPF-NSTGMKRAKT  249



>ref|NP_001148920.1| nucleic acid binding protein [Zea mays]
 gb|ACG33490.1| nucleic acid binding protein [Zea mays]
Length=279

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR  QA+EI+E+LLKPV       DESQD YK+ QLRELAMLN TLRE+ S   GSV
Sbjct  213  IIDARLRQAQEIIEELLKPV-------DESQDLYKRQQLRELAMLNSTLRED-SPHPGSV  264

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  265  SPFSNG-GMKRAKT  277



>gb|EYU42056.1| hypothetical protein MIMGU_mgv1a011431mg [Erythranthe guttata]
Length=282

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  215  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  267

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  268  SPFNTS-GMKRAKT  280



>ref|XP_009600353.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana tomentosiformis]
Length=288

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D +  QAREI+E+LLKPV       DESQD YK+HQLRELA+LN   REE  Q  GS+
Sbjct  221  IVDTQLKQAREIIEELLKPV-------DESQDLYKRHQLRELALLNNNFREESPQPRGSL  273

Query  416  SPFNNSLGMKRAKT  375
            SPF++S GMKRAKT
Sbjct  274  SPFSSS-GMKRAKT  286



>ref|XP_003564796.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Brachypodium 
distachyon]
Length=288

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 56/77 (73%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +IIDAR  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  218  DIIDARLNQAVTILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  270

Query  425  GSVSPFNNSLGMKRAKT  375
             S+SPF NS GMKRAKT
Sbjct  271  PSLSPF-NSTGMKRAKT  286



>ref|XP_009772457.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana sylvestris]
Length=288

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D +  QAREI+E+LLKPV       DESQD YK+HQLRELA+LN   REE  Q  GS+
Sbjct  221  IVDTQLKQAREIIEELLKPV-------DESQDLYKRHQLRELALLNNNFREESPQPRGSL  273

Query  416  SPFNNSLGMKRAKT  375
            SPF++S GMKRAKT
Sbjct  274  SPFSSS-GMKRAKT  286



>ref|XP_006381266.1| KH domain-containing family protein [Populus trichocarpa]
 gb|ERP59063.1| KH domain-containing family protein [Populus trichocarpa]
Length=281

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  267  SPFNTS-GMKRAKT  279



>ref|XP_011018950.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X1 [Populus euphratica]
Length=284

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  217  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  269

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  270  SPFNTS-GMKRAKT  282



>ref|XP_011018951.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X2 [Populus euphratica]
Length=281

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  267  SPFNTS-GMKRAKT  279



>gb|KDP21840.1| hypothetical protein JCGZ_00627 [Jatropha curcas]
Length=281

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  IVDMRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  267  SPFNTS-GMKRAKT  279



>ref|XP_004970832.1| PREDICTED: KH domain-containing protein At1g09660-like [Setaria 
italica]
Length=291

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +I+D R  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  221  DIVDGRLNQAVSILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  273

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  274  PSVSPF-NSTGMKRAKT  289



>ref|XP_009617855.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana tomentosiformis]
Length=258

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+DAR  QA +I+E+LL+PV       DESQD YK+ QLRELA+LN   REE  Q  GSV
Sbjct  191  IVDARLKQASQIIEELLRPV-------DESQDLYKRQQLRELAVLNNNFREESPQPRGSV  243

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  244  SPFNSS-GMKRAKT  256



>ref|XP_006654415.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X1 [Oryza brachyantha]
Length=290

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +I+D R  QA  ILEDLLKPV       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  220  DIVDVRLNQAVAILEDLLKPV-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  272

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  273  PSVSPF-NSTGMKRAKT  288



>ref|XP_009793498.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana sylvestris]
Length=258

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+DAR  QA +I+E+LL+PV       DESQD YK+ QLRELA+LN   REE  Q  GSV
Sbjct  191  IVDARLKQASQIIEELLRPV-------DESQDLYKRQQLRELAVLNNNFREESPQPRGSV  243

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  244  SPFNSS-GMKRAKT  256



>ref|XP_009617854.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana tomentosiformis]
Length=288

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+DAR  QA +I+E+LL+PV       DESQD YK+ QLRELA+LN   REE  Q  GSV
Sbjct  221  IVDARLKQASQIIEELLRPV-------DESQDLYKRQQLRELAVLNNNFREESPQPRGSV  273

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  274  SPFNSS-GMKRAKT  286



>ref|XP_009793497.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana sylvestris]
Length=288

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+DAR  QA +I+E+LL+PV       DESQD YK+ QLRELA+LN   REE  Q  GSV
Sbjct  221  IVDARLKQASQIIEELLRPV-------DESQDLYKRQQLRELAVLNNNFREESPQPRGSV  273

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  274  SPFNSS-GMKRAKT  286



>ref|XP_010683433.1| PREDICTED: KH domain-containing protein At3g08620-like [Beta 
vulgaris subsp. vulgaris]
Length=283

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D +  QA+EILE+LLKPV       DESQDFYK+ QLRELA+LN   RE+    SGSV
Sbjct  216  MVDIKLHQAKEILEELLKPV-------DESQDFYKRQQLRELALLNSNFREDSPGPSGSV  268

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  269  SPFNTS-GMKRAKT  281



>gb|KDO64189.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
Length=167

 Score = 84.7 bits (208),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQD+ K+ QLRELAMLN   RE+    SGSV
Sbjct  100  IVDIRLRQAQEIIEELLKPV-------DESQDYIKRQQLRELAMLNSNFREDSPGPSGSV  152

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  153  SPFNSS-GMKRAKT  165



>ref|XP_007033461.1| RNA-binding KH domain-containing protein [Theobroma cacao]
 gb|EOY04387.1| RNA-binding KH domain-containing protein [Theobroma cacao]
Length=281

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  IVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKR KT
Sbjct  267  SPFNSS-GMKRPKT  279



>ref|XP_004955829.1| PREDICTED: KH domain-containing protein SPIN1-like [Setaria italica]
Length=281

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IID R  QA+E++E+LLKPV       DESQDFYK+ QLRELAMLN TLRE+ S   GSV
Sbjct  215  IIDTRLRQAQEVMEELLKPV-------DESQDFYKRQQLRELAMLNSTLRED-SPHPGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAK 
Sbjct  267  SPFSNG-GMKRAKP  279



>ref|XP_003552330.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine 
max]
Length=281

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQD+ K+ QLRELAMLN   REE    SGSV
Sbjct  214  VVDIRLRQAQEIIEELLKPV-------DESQDYIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  267  SPFNSS-GMKRAKT  279



>ref|XP_002268790.1| PREDICTED: KH domain-containing protein At2g38610 [Vitis vinifera]
 emb|CBI31159.3| unnamed protein product [Vitis vinifera]
Length=281

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELA+LN   REE    SGSV
Sbjct  214  IVDMRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELALLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN S GMKRAKT
Sbjct  267  SPFNTS-GMKRAKT  279



>gb|KHG17170.1| hypothetical protein F383_07324 [Gossypium arboreum]
Length=218

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   RE+    SGSV
Sbjct  151  IVDTRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREDSPGPSGSV  203

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKR KT
Sbjct  204  SPFNSS-GMKRPKT  216



>gb|EMS59864.1| KH domain-containing protein SPIN1 [Triticum urartu]
Length=242

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+EILE+LLKPV       DE+QD YK+ QLRELAMLN TLRE+ S   GSV
Sbjct  176  IIDARLRHAQEILEELLKPV-------DETQDIYKRQQLRELAMLNSTLRED-SPHPGSV  227

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  228  SPFSNG-GMKRAKT  240



>gb|KHN40599.1| KH domain-containing protein [Glycine soja]
Length=333

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQD+ K+ QLRELAMLN   REE    SGSV
Sbjct  266  VVDIRLRQAQEIIEELLKPV-------DESQDYIKRQQLRELAMLNSNFREESPGPSGSV  318

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  319  SPFNSS-GMKRAKT  331



>ref|XP_007205691.1| hypothetical protein PRUPE_ppa009701mg [Prunus persica]
 ref|XP_008244492.1| PREDICTED: KH domain-containing protein At3g08620 [Prunus mume]
 gb|EMJ06890.1| hypothetical protein PRUPE_ppa009701mg [Prunus persica]
Length=281

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQDF K+ QLRELA+LN   REE    SGSV
Sbjct  214  VVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELALLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  267  SPFNSS-GMKRAKT  279



>ref|NP_001130116.1| uncharacterized protein LOC100191210 [Zea mays]
 gb|ACF78251.1| unknown [Zea mays]
 gb|AFW67206.1| nucleic acid binding protein [Zea mays]
Length=279

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+EI+E+LLKPV       DES DFYK+ QLRELA+LN TLRE+ S   GSV
Sbjct  213  IIDARLRHAQEIIEELLKPV-------DESHDFYKRQQLRELALLNSTLRED-SPHPGSV  264

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  265  SPFSNG-GMKRAKT  277



>gb|KHG12649.1| hypothetical protein F383_20322 [Gossypium arboreum]
 gb|KJB61345.1| hypothetical protein B456_009G352600 [Gossypium raimondii]
 gb|KJB61346.1| hypothetical protein B456_009G352600 [Gossypium raimondii]
Length=281

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   REE    SGSV
Sbjct  214  VVDIRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKR KT
Sbjct  267  SPFNSS-GMKRPKT  279



>dbj|BAJ96236.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=282

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR   A+EILE+LLKPV       DE+QD YK+ QLRELAMLN TLRE+ S   GSV
Sbjct  216  IIDARLRHAQEILEELLKPV-------DETQDIYKRQQLRELAMLNSTLRED-SPHPGSV  267

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAKT
Sbjct  268  SPFSNG-GMKRAKT  280



>ref|XP_010228217.1| PREDICTED: KH domain-containing protein SPIN1-like isoform X2 
[Brachypodium distachyon]
Length=281

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR  QA+EI+E+LL+PV       DESQDFYK+ QLRELA+LN TLRE+ S   GSV
Sbjct  215  IIDARLKQAQEIMEELLRPV-------DESQDFYKRQQLRELAVLNSTLRED-SPHPGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAK 
Sbjct  267  SPFSNG-GMKRAKP  279



>ref|NP_001142049.1| hypothetical protein [Zea mays]
 gb|ACF87541.1| unknown [Zea mays]
 tpg|DAA56470.1| TPA: hypothetical protein ZEAMMB73_282873 [Zea mays]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +++D R  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  215  DMVDVRLNQAVSILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  267

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  268  PSVSPF-NSTGMKRAKT  283



>ref|XP_008672524.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=290

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +++D R  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  220  DMVDVRLNQAVSILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  272

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  273  PSVSPF-NSTGMKRAKT  288



>ref|XP_008672523.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA56469.1| TPA: hypothetical protein ZEAMMB73_282873 [Zea mays]
Length=293

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 55/77 (71%), Gaps = 10/77 (13%)
 Frame = -2

Query  599  EIIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREE--GSQMS  426
            +++D R  QA  ILEDLLKP+       DES D+YKK QLRELA+LNGTLREE     +S
Sbjct  223  DMVDVRLNQAVSILEDLLKPI-------DESMDYYKKQQLRELAILNGTLREESPSPHLS  275

Query  425  GSVSPFNNSLGMKRAKT  375
             SVSPF NS GMKRAKT
Sbjct  276  PSVSPF-NSTGMKRAKT  291



>ref|XP_009370879.1| PREDICTED: KH domain-containing protein At3g08620-like [Pyrus 
x bretschneideri]
Length=281

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQDF K+ QLRELA+LN   REE    SGSV
Sbjct  214  VVDLRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELALLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  267  SPFNSS-GMKRAKT  279



>ref|XP_003557365.1| PREDICTED: KH domain-containing protein SPIN1-like isoform X1 
[Brachypodium distachyon]
Length=285

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 9/74 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            IIDAR  QA+EI+E+LL+PV       DESQDFYK+ QLRELA+LN TLRE+ S   GSV
Sbjct  219  IIDARLKQAQEIMEELLRPV-------DESQDFYKRQQLRELAVLNSTLRED-SPHPGSV  270

Query  416  SPFNNSLGMKRAKT  375
            SPF+N  GMKRAK 
Sbjct  271  SPFSNG-GMKRAKP  283



>ref|XP_008355743.1| PREDICTED: KH domain-containing protein At3g08620 [Malus domestica]
Length=281

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQDF K+ QLRELA+LN   REE    SGSV
Sbjct  214  VVDLRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELALLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  267  SPFNSS-GMKRAKT  279



>ref|XP_002974032.1| hypothetical protein SELMODRAFT_100146, partial [Selaginella 
moellendorffii]
 ref|XP_002983460.1| hypothetical protein SELMODRAFT_118528, partial [Selaginella 
moellendorffii]
 gb|EFJ15361.1| hypothetical protein SELMODRAFT_118528, partial [Selaginella 
moellendorffii]
 gb|EFJ24987.1| hypothetical protein SELMODRAFT_100146, partial [Selaginella 
moellendorffii]
Length=260

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 9/76 (12%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEG-SQMSGS  420
            +ID    +A+EILEDLL+PV       DE+ D  KK QLRELA+LNGTLREE  S MSGS
Sbjct  192  VIDFYLTKAKEILEDLLRPV-------DETVDLVKKAQLRELALLNGTLREESPSHMSGS  244

Query  419  VSPFNNSLGMKRAKTR  372
            VSPF+N+ G+KRAKTR
Sbjct  245  VSPFSNA-GLKRAKTR  259



>ref|XP_003616063.1| KH domain-containing protein [Medicago truncatula]
Length=330

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 7/74 (9%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQD YK+ QLRELAMLN + REE  Q+SGS+
Sbjct  262  VVDLRLRQAQEIIEELLKPV-------DESQDIYKRQQLRELAMLNSSFREESPQLSGSL  314

Query  416  SPFNNSLGMKRAKT  375
            SPF ++  +KRAKT
Sbjct  315  SPFTSNEMIKRAKT  328



>gb|KJB71497.1| hypothetical protein B456_011G125700 [Gossypium raimondii]
Length=249

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   RE+    SGSV
Sbjct  182  IVDTRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREDSPGPSGSV  234

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKR KT
Sbjct  235  SPFNSS-GMKRPKT  247



>ref|XP_009337813.1| PREDICTED: KH domain-containing protein At3g08620 [Pyrus x bretschneideri]
Length=281

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQDF K+ QLRELA+LN   REE    SGSV
Sbjct  214  VVDLRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELALLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  267  SPFNSS-GMKRAKT  279



>ref|XP_008359840.1| PREDICTED: KH domain-containing protein At3g08620-like [Malus 
domestica]
Length=281

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQDF K+ QLRELA+LN   REE    SGSV
Sbjct  214  VVDLRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELALLNSNFREESPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  267  SPFNSS-GMKRAKT  279



>gb|KDO64187.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
 gb|KDO64188.1| hypothetical protein CISIN_1g023068mg [Citrus sinensis]
Length=218

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQD+ K+ QLRELAMLN   RE+    SGSV
Sbjct  151  IVDIRLRQAQEIIEELLKPV-------DESQDYIKRQQLRELAMLNSNFREDSPGPSGSV  203

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  204  SPFNSS-GMKRAKT  216



>ref|XP_003626661.1| KH domain-containing protein [Medicago truncatula]
 gb|AET01137.1| RNA-binding KH domain protein [Medicago truncatula]
 gb|KEH17806.1| RNA-binding KH domain protein [Medicago truncatula]
 gb|KEH17809.1| RNA-binding KH domain protein [Medicago truncatula]
Length=276

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DES+DF K+ QLRELA+LN  LREE    SGSV
Sbjct  209  VVDMRLRQAQEIIEELLKPV-------DESEDFIKRQQLRELALLNSNLREESPGPSGSV  261

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  262  SPFNSS-GMKRAKT  274



>gb|KJB71496.1| hypothetical protein B456_011G125700 [Gossypium raimondii]
Length=281

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            I+D R  QA+EI+E+LLKPV       DESQDF K+ QLRELAMLN   RE+    SGSV
Sbjct  214  IVDTRLRQAQEIIEELLKPV-------DESQDFIKRQQLRELAMLNSNFREDSPGPSGSV  266

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKR KT
Sbjct  267  SPFNSS-GMKRPKT  279



>gb|AES99021.2| RNA-binding KH domain protein [Medicago truncatula]
Length=266

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 7/74 (9%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DESQD YK+ QLRELAMLN + REE  Q+SGS+
Sbjct  198  VVDLRLRQAQEIIEELLKPV-------DESQDIYKRQQLRELAMLNSSFREESPQLSGSL  250

Query  416  SPFNNSLGMKRAKT  375
            SPF ++  +KRAKT
Sbjct  251  SPFTSNEMIKRAKT  264



>gb|AET01129.2| RNA-binding KH domain protein [Medicago truncatula]
Length=275

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 55/74 (74%), Gaps = 8/74 (11%)
 Frame = -2

Query  596  IIDARXMQAREILEDLLKPVRYLLLMQDESQDFYKKHQLRELAMLNGTLREEGSQMSGSV  417
            ++D R  QA+EI+E+LLKPV       DES+DF K+ QLRELA+LN  LREE    SGSV
Sbjct  208  VVDMRLRQAQEIIEELLKPV-------DESEDFIKRQQLRELALLNSNLREESPGPSGSV  260

Query  416  SPFNNSLGMKRAKT  375
            SPFN+S GMKRAKT
Sbjct  261  SPFNSS-GMKRAKT  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940