BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044N15

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB45810.1|  acetoacetyl-CoA thiolase                                320   8e-108   Salvia miltiorrhiza [Chinese salvia]
emb|CDO99410.1|  unnamed protein product                                323   6e-105   Coffea canephora [robusta coffee]
dbj|BAD95031.1|  3-ketoacyl-CoA thiolase                                319   6e-105   Arabidopsis thaliana [mouse-ear cress]
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               323   7e-105   Petunia x hybrida [garden petunia]
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    322   1e-104   Solanum tuberosum [potatoes]
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    322   3e-104   Nicotiana tomentosiformis
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    321   5e-104   Nicotiana sylvestris
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    321   6e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             320   1e-103   Capsella rubella
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   1e-103   
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             319   2e-103   Arabidopsis thaliana [mouse-ear cress]
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    319   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    319   2e-103   Brassica rapa
emb|CDY37750.1|  BnaA04g19180D                                          319   2e-103   Brassica napus [oilseed rape]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               319   3e-103   Rehmannia glutinosa [Chinese foxglove]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             318   5e-103   Eutrema salsugineum [saltwater cress]
emb|CDY23766.1|  BnaC04g43560D                                          318   6e-103   Brassica napus [oilseed rape]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    318   7e-103   Sesamum indicum [beniseed]
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                318   8e-103   Erythranthe guttata [common monkey flower]
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    317   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    317   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    317   1e-102   Camelina sativa [gold-of-pleasure]
gb|KJB72150.1|  hypothetical protein B456_011G161700                    317   2e-102   Gossypium raimondii
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     317   2e-102   Brassica napus [oilseed rape]
emb|CDY19452.1|  BnaC04g11470D                                          317   3e-102   Brassica napus [oilseed rape]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               317   3e-102   Rehmannia glutinosa [Chinese foxglove]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    316   3e-102   Brassica rapa
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             316   3e-102   
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    315   7e-102   Brassica rapa
emb|CDX84701.1|  BnaA03g15290D                                          315   9e-102   
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    315   1e-101   Tarenaya hassleriana [spider flower]
emb|CDX79511.1|  BnaC03g18470D                                          313   6e-101   
gb|EPS68937.1|  hypothetical protein M569_05826                         312   9e-101   Genlisea aurea
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    312   1e-100   Gossypium arboreum [tree cotton]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    312   1e-100   Sesamum indicum [beniseed]
ref|XP_007034450.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    308   2e-100   
gb|ABK94786.1|  unknown                                                 307   3e-100   Populus trichocarpa [western balsam poplar]
gb|KDO43605.1|  hypothetical protein CISIN_1g012506mg                   307   3e-100   Citrus sinensis [apfelsine]
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    311   3e-100   Cucumis sativus [cucumbers]
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    311   4e-100   Eucalyptus grandis [rose gum]
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    310   7e-100   Vitis vinifera
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                310   8e-100   
emb|CAN81585.1|  hypothetical protein VITISV_023191                     310   9e-100   Vitis vinifera
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   307   1e-99    Citrus sinensis [apfelsine]
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             308   1e-99    
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    309   2e-99    Cucumis melo [Oriental melon]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    309   2e-99    
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    309   2e-99    
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   308   2e-99    Citrus sinensis [apfelsine]
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             309   3e-99    Prunus persica
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   308   3e-99    Citrus sinensis [apfelsine]
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    308   3e-99    Prunus mume [ume]
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         308   4e-99    Jatropha curcas
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    308   5e-99    Fragaria vesca subsp. vesca
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             308   6e-99    Citrus clementina [clementine]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             308   6e-99    Populus trichocarpa [western balsam poplar]
gb|AFW68655.1|  hypothetical protein ZEAMMB73_512974                    299   8e-99    
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    307   1e-98    Pyrus x bretschneideri [bai li]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    307   1e-98    Tarenaya hassleriana [spider flower]
ref|NP_001142099.1|  uncharacterized protein LOC100274263               298   2e-98    
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             306   2e-98    Citrus clementina [clementine]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    306   3e-98 
gb|AFW68656.1|  hypothetical protein ZEAMMB73_512974                    300   4e-98    
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    305   4e-98    Populus euphratica
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    305   5e-98    Nelumbo nucifera [Indian lotus]
gb|AFK34605.1|  unknown                                                 300   6e-98    Lotus japonicus
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    305   6e-98    Malus domestica [apple tree]
gb|AFW68657.1|  hypothetical protein ZEAMMB73_512974                    300   2e-97    
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    303   2e-97    Cicer arietinum [garbanzo]
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        303   6e-97    Cucumis sativus [cucumbers]
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               302   8e-97    Petunia x hybrida [garden petunia]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    301   1e-96    Oryza brachyantha
gb|ACN29136.1|  unknown                                                 300   5e-96    Zea mays [maize]
gb|ACN39947.1|  unknown                                                 299   2e-95    Picea sitchensis
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    299   2e-95    Nicotiana sylvestris
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    300   2e-95    Nicotiana sylvestris
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    299   3e-95    Nicotiana tomentosiformis
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                298   3e-95    Glycine max [soybeans]
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             298   3e-95    
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    298   4e-95    Populus euphratica
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    298   5e-95    Populus euphratica
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     298   5e-95    Medicago truncatula
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          298   5e-95    Amborella trichopoda
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    298   5e-95    Prunus mume [ume]
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    297   6e-95    Helianthus annuus
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    297   6e-95    Elaeis guineensis
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             297   1e-94    Prunus persica
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          296   2e-94    Sorghum bicolor [broomcorn]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                296   2e-94    Helianthus annuus
ref|XP_008349047.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    290   2e-94    
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    296   2e-94    Populus euphratica
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    296   2e-94    Populus euphratica
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          296   3e-94    
gb|EEC67095.1|  hypothetical protein OsI_33888                          296   3e-94    Oryza sativa Indica Group [Indian rice]
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    295   4e-94    Glycine max [soybeans]
ref|NP_001064764.1|  Os10g0457600                                       295   4e-94    
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   295   4e-94    Triticum aestivum [Canadian hard winter wheat]
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                295   6e-94    Erythranthe guttata [common monkey flower]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  295   6e-94    
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             295   7e-94    Phaseolus vulgaris [French bean]
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    295   7e-94    Solanum tuberosum [potatoes]
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    294   8e-94    
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    294   9e-94    Populus euphratica
dbj|BAJ87577.1|  predicted protein                                      294   2e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    294   2e-93    Setaria italica
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    293   3e-93    
gb|ABR16781.1|  unknown                                                 293   4e-93    Picea sitchensis
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                293   4e-93    Ricinus communis
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    293   5e-93    Eucalyptus grandis [rose gum]
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    292   7e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    291   1e-92    Gossypium arboreum [tree cotton]
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  291   1e-92    Triticum urartu
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          291   1e-92    Zea mays [maize]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    291   2e-92    Sesamum indicum [beniseed]
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    290   3e-92    Tarenaya hassleriana [spider flower]
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    290   3e-92    
gb|KJB10128.1|  hypothetical protein B456_001G185200                    290   4e-92    Gossypium raimondii
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    290   6e-92    Tarenaya hassleriana [spider flower]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    290   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    289   1e-91    Brachypodium distachyon [annual false brome]
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             289   1e-91    Selaginella moellendorffii
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    289   1e-91    Elaeis guineensis
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    288   2e-91    Elaeis guineensis
pdb|2C7Y|A  Chain A, Plant Enzyme                                       287   2e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDP03848.1|  unnamed protein product                                288   3e-91    Coffea canephora [robusta coffee]
gb|KJB42403.1|  hypothetical protein B456_007G152600                    285   3e-91    Gossypium raimondii
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    287   4e-91    Pyrus x bretschneideri [bai li]
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             287   4e-91    
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    288   4e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    287   5e-91    Setaria italica
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    287   5e-91    Phoenix dactylifera
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    287   6e-91    Phoenix dactylifera
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    287   8e-91    Phoenix dactylifera
gb|ABR17647.1|  unknown                                                 287   8e-91    Picea sitchensis
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          286   9e-91    Morus notabilis
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    286   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    286   1e-90    Brachypodium distachyon [annual false brome]
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    286   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    286   2e-90    
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             285   2e-90    
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    286   2e-90    Elaeis guineensis
gb|AFK47277.1|  unknown                                                 275   3e-90    Medicago truncatula
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             285   4e-90    Capsella rubella
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    284   4e-90    Camelina sativa [gold-of-pleasure]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    285   5e-90    Gossypium arboreum [tree cotton]
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         285   5e-90    Jatropha curcas
gb|KJB42405.1|  hypothetical protein B456_007G152600                    284   6e-90    Gossypium raimondii
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    284   7e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    284   8e-90    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX86611.1|  BnaC08g00920D                                          283   1e-89    
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             282   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    282   5e-89    Brassica rapa
dbj|BAD94007.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 274   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    281   9e-89    Fragaria vesca subsp. vesca
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    281   9e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    281   2e-88    Cucumis melo [Oriental melon]
ref|XP_008365692.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    271   2e-88    
ref|XP_001762605.1|  predicted protein                                  280   3e-88    
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     279   4e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001764272.1|  predicted protein                                  279   8e-88    
emb|CDY05657.1|  BnaC02g38800D                                          279   9e-88    
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    278   1e-87    Arabidopsis lyrata subsp. lyrata
emb|CDY15520.1|  BnaA08g28040D                                          278   2e-87    Brassica napus [oilseed rape]
gb|KJB42404.1|  hypothetical protein B456_007G152600                    278   3e-87    Gossypium raimondii
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    276   4e-87    Brassica rapa
emb|CDY33940.1|  BnaA02g30470D                                          276   7e-87    Brassica napus [oilseed rape]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    276   9e-87    Brassica rapa
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    276   1e-86    
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 276   1e-86    Vanda hybrid cultivar
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    276   2e-86    Beta vulgaris subsp. vulgaris [field beet]
gb|ACU19231.1|  unknown                                                 266   3e-86    Glycine max [soybeans]
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             273   3e-86    Eutrema salsugineum [saltwater cress]
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    273   4e-86    Camelina sativa [gold-of-pleasure]
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            273   7e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             274   7e-86    Eutrema salsugineum [saltwater cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 272   9e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    273   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    272   1e-85    Camelina sativa [gold-of-pleasure]
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            273   1e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010473862.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    273   2e-85    Cucumis sativus [cucumbers]
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    272   4e-85    
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    272   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    271   5e-85    Oryza brachyantha
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             272   5e-85    Capsella rubella
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             272   5e-85    Populus trichocarpa [western balsam poplar]
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    272   1e-84    
ref|NP_001048523.1|  Os02g0817700                                       270   2e-84    
gb|ADE77908.1|  unknown                                                 270   2e-84    Picea sitchensis
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            268   9e-84    Glycine max [soybeans]
ref|XP_007034451.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    263   3e-83    
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             266   7e-83    Medicago truncatula
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    265   1e-82    
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             265   2e-82    Phaseolus vulgaris [French bean]
gb|AFK40880.1|  unknown                                                 264   3e-82    Medicago truncatula
ref|XP_008382649.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    255   3e-82    
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  264   3e-82    Glycine soja [wild soybean]
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   6e-82    Cicer arietinum [garbanzo]
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    262   7e-82    Camelina sativa [gold-of-pleasure]
ref|NP_001242568.1|  uncharacterized protein LOC100789930               263   1e-81    
gb|KJB72152.1|  hypothetical protein B456_011G161700                    263   1e-81    Gossypium raimondii
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    261   5e-81    Camelina sativa [gold-of-pleasure]
ref|XP_005646163.1|  thiolase                                           260   2e-80    Coccomyxa subellipsoidea C-169
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    259   3e-80    Cicer arietinum [garbanzo]
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              259   3e-80    Mangifera indica
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  259   4e-80    Triticum urartu
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   258   8e-80    Citrus sinensis [apfelsine]
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    258   9e-80    
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    256   5e-79    Arabis alpina [alpine rockcress]
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    255   1e-78    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             252   6e-78    
ref|XP_008678417.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    243   2e-76    
gb|AFK39397.1|  unknown                                                 237   1e-75    Lotus japonicus
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    246   5e-75    
gb|AAK76732.1|  3-ketoacyl-CoA thiolase                                 235   6e-75    Gossypium hirsutum [American cotton]
ref|XP_008355236.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    235   6e-75    
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             243   2e-74    
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     243   1e-73    Eucalyptus grandis [rose gum]
gb|ACA58356.1|  3-ketoacyl-CoA thiolase                                 225   3e-71    Arachis diogoi
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             226   4e-67    Volvox carteri f. nagariensis
gb|ABR25554.1|  peroxisomal 3-ketoacyl-coa thiolase 2 precursor         217   3e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_002500295.1|  acetyl-coa acyltransferase                         219   4e-65    Micromonas commoda
ref|XP_003061899.1|  predicted protein                                  214   4e-64    Micromonas pusilla CCMP1545
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             217   7e-64    Auxenochlorella protothecoides
ref|XP_010172441.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    207   2e-62    Antrostomus carolinensis
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                211   8e-62    Acanthamoeba castellanii str. Neff
ref|XP_010075883.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    209   1e-61    Pterocles gutturalis
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              210   1e-61    Helicosporidium sp. ATCC 50920
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  210   2e-61    Capitella teleta
ref|XP_009505170.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    205   3e-61    Phalacrocorax carbo [common cormorant]
gb|KFV08282.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  206   9e-61    Tauraco erythrolophus
gb|EDL76925.1|  rCG25918, isoform CRA_d                                 200   1e-60    Rattus norvegicus [brown rat]
gb|KFW92214.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  204   1e-60    Phalacrocorax carbo [common cormorant]
gb|KFW09333.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  206   1e-60    Fulmarus glacialis
gb|KFQ33519.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  206   2e-60    Merops nubicus
gb|EOA95880.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  206   2e-60    Anas platyrhynchos [duck]
gb|EMC83181.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  206   2e-60    
gb|AAH26669.1|  Acaa1a protein                                          199   2e-60    Mus musculus [mouse]
ref|XP_009941382.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    205   2e-60    Opisthocomus hoazin [hoatzin]
gb|KFR17430.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  205   2e-60    Opisthocomus hoazin [hoatzin]
ref|XP_008942616.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    205   3e-60    Merops nubicus
ref|XP_009975644.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    206   3e-60    Tauraco erythrolophus
gb|KFW01783.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  204   3e-60    Eurypyga helias
ref|XP_005027361.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    205   3e-60    
ref|XP_005424411.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    206   3e-60    
ref|XP_009963091.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   3e-60    Tyto alba [Schleiereule]
ref|XP_009580990.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    206   4e-60    Fulmarus glacialis
ref|XP_005849380.1|  hypothetical protein CHLNCDRAFT_143854             207   4e-60    Chlorella variabilis
ref|XP_005509181.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    205   4e-60    Columba livia [carrier pigeon]
gb|EDL76924.1|  rCG25918, isoform CRA_c                                 202   5e-60    Rattus norvegicus [brown rat]
ref|XP_010146289.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   5e-60    Eurypyga helias
ref|XP_002199792.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    205   5e-60    
gb|KFV42249.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  204   5e-60    Tyto alba [Schleiereule]
ref|XP_009556582.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   5e-60    Cuculus canorus
ref|XP_009707186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   5e-60    Cariama cristata
gb|EGW00823.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  202   6e-60    Cricetulus griseus [Chinese hamsters]
gb|KFP47895.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  204   6e-60    Cathartes aura
ref|XP_005527826.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    204   6e-60    
gb|KFW87055.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  204   7e-60    Manacus vitellinus
ref|XP_009473628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   7e-60    Nipponia nippon
ref|XP_008929499.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   7e-60    
gb|KFW73684.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  204   7e-60    Pygoscelis adeliae
gb|KFO74220.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  204   7e-60    Cuculus canorus
gb|KFR09032.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  204   8e-60    Nipponia nippon
ref|NP_001184217.1|  acetyl-Coenzyme A acyltransferase 1 (peroxis...    206   8e-60    Gallus gallus [bantam]
gb|KJB72151.1|  hypothetical protein B456_011G161700                    205   8e-60    Gossypium raimondii
gb|KGL97637.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  204   9e-60    Charadrius vociferus
ref|XP_006512177.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   9e-60    Mus musculus [mouse]
ref|XP_010190011.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   9e-60    Mesitornis unicolor
ref|XP_001418570.1|  predicted protein                                  205   1e-59    Ostreococcus lucimarinus CCE9901
ref|XP_009484735.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   1e-59    Pelecanus crispus
ref|XP_006511987.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    201   1e-59    
ref|XP_010114568.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   1e-59    Chlamydotis macqueenii
gb|EDL09222.1|  mCG20972, isoform CRA_b                                 200   1e-59    Mus musculus [mouse]
ref|XP_005442450.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    204   1e-59    
gb|KFM05271.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  203   1e-59    Aptenodytes forsteri
gb|KFP39992.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  203   1e-59    Chlamydotis macqueenii
ref|XP_005241038.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    204   1e-59    
ref|XP_002193705.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    205   1e-59    Taeniopygia guttata
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    205   1e-59    
ref|XP_010710649.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    205   1e-59    
gb|EAW64515.1|  acetyl-Coenzyme A acyltransferase 1 (peroxisomal ...    197   1e-59    
ref|XP_009820505.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   1e-59    
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    205   1e-59    
gb|KFQ63006.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  203   2e-59    
gb|KFO66172.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  203   2e-59    
ref|XP_010311931.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   2e-59    
ref|XP_007615644.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    202   2e-59    
gb|KFV40730.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  203   2e-59    
gb|KFO08431.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  203   2e-59    
ref|XP_009888784.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   2e-59    
ref|XP_007437964.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    199   2e-59    
ref|XP_004662051.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    203   2e-59    
dbj|BAC32386.1|  unnamed protein product                                201   2e-59    
gb|KFQ13333.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  202   2e-59    
ref|XP_010293422.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   2e-59    
ref|XP_008641380.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   2e-59    
ref|XP_009078375.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   3e-59    
gb|ELK29226.1|  3-ketoacyl-CoA thiolase, peroxisomal                    202   3e-59    
gb|KFP20301.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  202   3e-59    
gb|EPQ17921.1|  3-ketoacyl-CoA thiolase, peroxisomal                    202   3e-59    
ref|XP_006109905.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    202   4e-59    
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    204   4e-59    
ref|XP_009084024.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    203   6e-59    
ref|XP_005040594.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    203   6e-59    
gb|EGW00828.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  202   6e-59    
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    203   6e-59    
ref|XP_006749538.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   6e-59    
ref|XP_009642386.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    203   7e-59    
ref|XP_010016183.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   7e-59    
gb|KFV86553.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  202   7e-59    
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    203   8e-59    
ref|XP_009897418.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   8e-59    
ref|XP_009923469.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   8e-59    
ref|XP_003781848.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    203   8e-59    
emb|CEF98532.1|  Thiolase-like, subgroup                                203   8e-59    
gb|KFQ52653.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  201   8e-59    
ref|XP_007910458.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   9e-59    
gb|KFV66334.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  201   9e-59    
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         204   9e-59    
ref|XP_011217239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    201   9e-59    
gb|KFP07326.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  202   9e-59    
ref|XP_004759760.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   9e-59    
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    203   1e-58    
ref|XP_006765161.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   1e-58    
ref|XP_006713186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    198   1e-58    
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   1e-58    
gb|EMP29415.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  201   1e-58    
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    202   1e-58    
ref|XP_011241272.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   1e-58    
ref|XP_004823725.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    202   2e-58    
ref|XP_008153138.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    202   2e-58    
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    202   2e-58    
ref|XP_010144408.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   2e-58    
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   201   2e-58    
ref|XP_003505982.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    202   2e-58    
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    202   2e-58    
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    202   2e-58    
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    202   2e-58    
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    202   2e-58    
ref|XP_005882731.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   2e-58    
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             201   2e-58    
ref|XP_005297193.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    201   2e-58    
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    202   2e-58    
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 202   3e-58    
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  202   3e-58    
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    201   3e-58    
ref|XP_004906796.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    201   3e-58    
ref|XP_005634306.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    199   3e-58    
ref|XP_009683500.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   3e-58    
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    201   3e-58    
gb|EHB16856.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  201   3e-58    
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    201   3e-58    
ref|XP_006120630.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    200   3e-58    
dbj|BAE35878.1|  unnamed protein product                                201   3e-58    
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   4e-58    
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    201   4e-58    
ref|XP_007644623.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   4e-58    
ref|XP_002914680.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    201   4e-58    
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   4e-58    
ref|XP_007066606.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    199   4e-58    
ref|XP_009274247.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    202   4e-58    
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      201   4e-58    
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   4e-58    
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                  198   5e-58    
gb|ELV10533.1|  3-ketoacyl-CoA thiolase, peroxisomal                    199   5e-58    
ref|XP_011217238.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    201   5e-58    
ref|XP_008500452.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   5e-58    
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             201   5e-58    
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      201   5e-58    
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   5e-58    
ref|XP_007081088.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   6e-58    
ref|XP_004315495.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    199   6e-58    
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   6e-58    
ref|XP_009952311.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    202   6e-58    
emb|CAA35825.1|  3-oxoacyl-CoA thiolase                                 198   6e-58    
ref|XP_006023013.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    198   7e-58    
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                201   7e-58    
emb|CBJ49265.1|  3-ketoacyl-CoA thiolase                                199   8e-58    
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  200   8e-58    
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     200   9e-58    
ref|XP_003415748.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    200   9e-58    
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    200   9e-58    
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    200   9e-58    
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    210   1e-57    
ref|XP_004835306.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    201   1e-57    
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     199   1e-57    
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    200   1e-57    
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  199   1e-57    
ref|XP_010004292.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    200   1e-57    
ref|XP_006169029.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    199   1e-57    
ref|XP_008949804.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   2e-57    
dbj|BAG57147.1|  unnamed protein product                                197   2e-57    
ref|XP_008710007.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    201   2e-57    
ref|XP_007127846.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    198   2e-57    
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  199   2e-57    
ref|XP_534222.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    199   2e-57    
ref|XP_004018276.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   2e-57    
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    199   3e-57    
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    199   3e-57    
gb|ETI53494.1|  hypothetical protein F443_03599                         198   3e-57    
gb|ETK93319.1|  hypothetical protein L915_03492                         198   3e-57    
gb|KFO38323.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  198   3e-57    
ref|XP_008900800.1|  hypothetical protein PPTG_08457                    198   3e-57    
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       199   3e-57    
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               199   3e-57    
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    199   3e-57    
dbj|BAE25296.1|  unnamed protein product                                199   3e-57    
ref|XP_007127844.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    198   4e-57    
ref|XP_007462753.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    198   5e-57    
ref|XP_004338982.1|  acetylCoA C-acetyltransferase subfamily protein    201   5e-57    
ref|XP_008066531.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    198   5e-57    
ref|XP_006173724.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    196   5e-57    
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  197   6e-57    
ref|XP_004277954.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    198   6e-57    
ref|XP_004588416.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    198   6e-57    
ref|XP_010616927.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    198   6e-57    
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    197   6e-57    
ref|XP_006890653.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    198   7e-57    
ref|XP_010944140.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    196   7e-57    
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    198   7e-57    
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   9e-57    
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    197   9e-57    
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   9e-57    
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    197   9e-57    
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        197   9e-57    
ref|XP_007943891.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    196   1e-56    
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    197   1e-56    
ref|XP_004412369.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    197   1e-56    
ref|XP_008584769.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    196   1e-56    
ref|XP_010980336.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    196   1e-56    
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    198   1e-56    
ref|XP_006200711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   1e-56    
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             197   1e-56    
ref|XP_005695607.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    195   1e-56    
ref|NP_001029491.1|  3-ketoacyl-CoA thiolase, peroxisomal               197   2e-56    
ref|XP_005383786.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    197   2e-56    
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   2e-56    
ref|XP_005975939.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    197   2e-56    
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    196   3e-56    
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               196   3e-56    
ref|XP_006265991.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    196   3e-56    
ref|XP_010224152.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    197   3e-56    
ref|XP_002802920.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    194   4e-56    
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        196   5e-56    
ref|XP_006077082.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    196   5e-56    
ref|XP_002180190.1|  beta-ketoacyl-coa thiolase                         194   6e-56    
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    196   6e-56    
ref|XP_005901200.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    195   6e-56    
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    195   7e-56    
ref|XP_010833811.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    195   7e-56    
ref|WP_012281246.1|  acetyl-CoA acetyltransferase                       194   7e-56    
ref|XP_004614628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    195   9e-56    
ref|XP_007513169.1|  unknown                                            195   1e-55    
gb|EJK62852.1|  hypothetical protein THAOC_16519                        197   1e-55    
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    195   1e-55    
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    196   1e-55    
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    194   1e-55    
emb|CCA20150.1|  3ketoacylCoA thiolase A putative                       194   2e-55    
gb|ACO51137.1|  acetyl-coenzyme A acyltransferase 1                     191   3e-55    
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    194   3e-55    
dbj|BAE72965.1|  hypothetical protein                                   194   3e-55    
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                          193   3e-55    
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    193   3e-55    
ref|XP_009876634.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    192   4e-55    
ref|XP_011480271.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    192   4e-55    
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    194   5e-55    
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    193   5e-55    
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    194   6e-55    
ref|XP_009833031.1|  hypothetical protein, variant 2                    190   7e-55    
gb|KDO30583.1|  hypothetical protein SPRG_04484                         192   9e-55    
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    193   9e-55    
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    193   9e-55    
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    193   9e-55    
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    193   9e-55    
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    192   1e-54    
ref|XP_004880487.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    192   1e-54    
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                         192   1e-54    
ref|XP_004854312.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    192   2e-54    
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B              191   2e-54    
ref|XP_004880486.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    192   2e-54    
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                       199   3e-54    
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    191   4e-54    
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    190   5e-54    
ref|XP_008276561.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    191   5e-54    
emb|CEI96344.1|  Putative Acetyl-CoA acyltransferase                    190   6e-54    
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    190   6e-54    
ref|XP_009833029.1|  hypothetical protein H257_08703                    189   6e-54    
emb|CEG63739.1|  Putative Acetyl-CoA acyltransferase                    190   7e-54    
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    190   8e-54    
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    190   9e-54    
ref|NP_001187475.1|  peroxisomal 3-ketoacyl-CoA thiolase A              189   9e-54    
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               189   9e-54    
ref|XP_011363629.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    190   1e-53    
ref|XP_008616222.1|  acetyl-CoA acyltransferase 1                       189   1e-53    
dbj|BAJ85217.1|  predicted protein                                      189   1e-53    
ref|XP_001744914.1|  hypothetical protein                               187   1e-53    
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    189   1e-53    
ref|XP_007743041.1|  acetyl-CoA acyltransferase                         189   2e-53    
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    189   2e-53    



>gb|ABB45810.1| acetoacetyl-CoA thiolase [Salvia miltiorrhiza]
Length=172

 Score =   320 bits (820),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  2    SQVSDGAGAVLLMKRSVALQKGLPILGVFRTFVAVGVDPAIMGVGPAVAIPAAVKSAGLE  61

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ+LYC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  62   LEDIDLFEINEAFASQFLYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  121

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCRYGVVSMCIGTGMGAA VFERGDACDEL N RKVE   +LSKDAR
Sbjct  122  RRGKDCRYGVVSMCIGTGMGAAAVFERGDACDELCNTRKVEAQNFLSKDAR  172



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC++KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  351  LEDIDLFEINEAFASQFVYCREKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+E +  LSKDAR
Sbjct  411  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKIEANNLLSKDAR  461



>dbj|BAD95031.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=343

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  173  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  232

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  233  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  292

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  293  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  343



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKRSLA+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLE
Sbjct  293  SQVTDGAGAVLLMKRSLAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQY+YC+KKL LDPEKINVNG AMA+GHPLGATGARCVATLLHEMK
Sbjct  353  LEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGSAMALGHPLGATGARCVATLLHEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+++H  LSKDA
Sbjct  413  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNLLSKDA  462



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   322 bits (826),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 167/171 (98%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLE
Sbjct  294  SQVTDGAGAVLLMKRSIAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LEDIDLFEINEAFASQFVYCRKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDA  199
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+++H + LSKDA
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNHLLSKDA  464



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKRSLA+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLE
Sbjct  294  SQVTDGAGAVLLMKRSLAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQY+YC+KKL LDPEKINVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  354  LEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGGAMALGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+ +H  LSKDA
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKIGSHNLLSKDA  463



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLE
Sbjct  294  SQVTDGAGAVLLMKRSIAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQY+YC+KKL LDPEKINVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  354  LEDIDLFEINEAFASQYVYCRKKLELDPEKINVNGGAMALGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+ +H  LSKDA
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELCNARKIGSHNLLSKDA  463



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVTDGAGAVLLMKRSVAMSKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ+LYC+KKL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFLYCRKKLDLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGDA D+L NARKVE+HG LSKDA+
Sbjct  412  RRGKDCRFGVISMCIGTGMGAAAVFERGDAADDLCNARKVESHGLLSKDAK  462



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVET G LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVETQGLLSKDAR  462



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 166/171 (97%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLE
Sbjct  294  SQVTDGAGAVLLMKRSIAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LEDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDA  199
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDEL NARK+++H + LSKDA
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNHLLSKDA  464



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  272  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  331

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  332  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  391

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  392  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  442



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSLATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFLYCRNKLGLDEEKVNVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKDAR  462



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSLATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFLYCRNKLGLDEEKVNVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKDAR  462



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFE+NEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGARCVATLLHEMK
Sbjct  354  LGDIDLFEVNEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGVTGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDELSNAR V TH +LSKDAR
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELSNARTVGTHNFLSKDAR  464



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE HG LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAHGLLSKDAR  462



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFLYCRNKLGLDAEKVNVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKDAR  462



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   318 bits (814),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ++YC+KKL LD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LGDIDLFEINEAFASQFVYCRKKLELDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAAGVFERGD+CDEL N RKVET  +LSKDAR
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAGVFERGDSCDELCNVRKVETQNFLSKDAR  464



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   318 bits (814),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+F AVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  294  SQVSDGAGAVLLMKRSIAMQKGLPILGVFRSFCAVGVDPAIMGIGPAVAIPAAVKAAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ+LYCQKKL LDP KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LGDIDLFEINEAFASQFLYCQKKLELDPAKINVNGGAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+G VSMCIGTGMGAA VFERGD+CDELSNARK+E   +LSKDAR
Sbjct  414  RRGKDCRFGAVSMCIGTGMGAAAVFERGDSCDELSNARKIEAQNFLSKDAR  464



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TGARCVATLLHEMK
Sbjct  354  LDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVET+  LSKDAR
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELCNARKVETNSLLSKDAR  464



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKDAR  462



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  293  SQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  353  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKDAR
Sbjct  413  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKDAR  463



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   317 bits (811),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGARCV TLLHEMK
Sbjct  354  LGDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGVTGARCVVTLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+CDELSN R V TH +LSKDAR
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSCDELSNTRTVGTHNFLSKDAR  464



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKDAR  462



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGL+PEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLNPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NA+KVE  G LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNAKKVEAQGLLSKDAR  462



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  290  SQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKDAR
Sbjct  410  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKDAR  460



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   315 bits (807),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKDAR  462



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVK-SAGL  532
            SQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIP AVK +AGL
Sbjct  292  SQISDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPGAVKQAAGL  351

Query  531  ELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM  352
            ELDDIDLFEINEAFASQ++YC+ KLGLDPE+INVNGGAMAIGHPLGATGARCV TLLHEM
Sbjct  352  ELDDIDLFEINEAFASQFVYCRNKLGLDPERINVNGGAMAIGHPLGATGARCVGTLLHEM  411

Query  351  KRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            KRRG+DCRYGVVSMCIGTGMGAA VFERGD  D+LSNARKVE HG+LSKD+R
Sbjct  412  KRRGRDCRYGVVSMCIGTGMGAAAVFERGDGVDDLSNARKVEAHGFLSKDSR  463



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A +KGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMRRSVATRKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKDAR
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKDAR  462



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   312 bits (800),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A QKGLPILGVFR+FAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  288  SQVSDGAGAVLLMKRSVAAQKGLPILGVFRSFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDL+EINEAFASQ++YC+KKL LDPEKINVNGGA+AIGHPLGATGARCV TLLHEMK
Sbjct  348  ISDIDLYEINEAFASQFVYCRKKLELDPEKINVNGGAIAIGHPLGATGARCVGTLLHEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GV+SMCIGTGMGAA VFERGD+CDELSNARK+E H +LS+DA
Sbjct  408  RRGRDCRFGVISMCIGTGMGAAAVFERGDSCDELSNARKIERHNFLSRDA  457



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMCKGLPILGVFRTFCAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA V ERGD  DEL NARKVET+  LSKDAR
Sbjct  414  RRGKDCRFGVVSMCIGTGMGAAAVLERGDCVDELCNARKVETNSLLSKDAR  464



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QK LPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAAAVLLMKRSVAMQKRLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGARCVATLLHEMK
Sbjct  354  LGDIDLFEINEAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGTTGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+CDEL N R V+TH +LSKDAR
Sbjct  414  RRGKDCRFGVISMCIGTGMGAAAVFERGDSCDELCNVRTVQTHNFLSKDAR  464



>ref|XP_007034450.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOY05376.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=355

 Score =   308 bits (789),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  185  SQVSDGAGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  244

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDL+EINEAFASQ++YC+KKL LDP+KINVNG AMAIGHPLGATGARCVATLLHEMK
Sbjct  245  LDDIDLYEINEAFASQFVYCRKKLELDPKKINVNGAAMAIGHPLGATGARCVATLLHEMK  304

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKDA
Sbjct  305  RRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKDA  354



>gb|ABK94786.1| unknown [Populus trichocarpa]
Length=346

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  175  SQISDGAGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  234

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  235  LEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMK  294

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSKDAR  196
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+D+R
Sbjct  295  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSRDSR  346



>gb|KDO43605.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43606.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43607.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=345

 Score =   307 bits (787),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+
Sbjct  175  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQ  234

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  235  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMK  294

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  295  RRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  343



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AI+KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAIKKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRNKLELDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   311 bits (797),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/171 (87%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  294  SQVSDGAGAVLLMKRSLAMEKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGL+PEK+NVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  354  LDDIDLFEINEAFASQFVYCRNKLGLEPEKVNVNGGAMAMGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA V ERGD+ DELSNARKV T+  LSKDAR
Sbjct  414  RRGKDCRFGVISMCIGTGMGAAAVLERGDSVDELSNARKVGTNSLLSKDAR  464



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   310 bits (794),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGARCV TLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRKKLDLDPEKINVNGGAMAIGHPLGATGARCVGTLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NAR  E +  LSKDA+
Sbjct  411  RRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELRNARTAENNNLLSKDAQ  461



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   310 bits (794),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKR +A+ KGLPILGVFR+FAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  290  SQVSDGAGAVLLMKRCVAMHKGLPILGVFRSFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LDPE+INVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  LNDIDLFEINEAFASQFVYCRKKLELDPERINVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GVVSMCIGTGMGAA VFERGDACD+L NARKVET   LSKDA
Sbjct  410  RRGRDCRFGVVSMCIGTGMGAAAVFERGDACDDLCNARKVETSNLLSKDA  459



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   310 bits (793),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGARCV TLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRKKLDLDPEKINVNGGAMAIGHPLGATGARCVGTLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NAR  E +  LSKDA+
Sbjct  411  RRGKDCRFGVVSMCIGTGMGAAAVFERGDCVDELRNARTAENNNLLSKDAQ  461



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+
Sbjct  218  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQ  277

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  278  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMK  337

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  338  RRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  386



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A +KGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  259  SQVSDGAGAVLLMKRSIAERKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  318

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMK
Sbjct  319  LDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMK  378

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKDAR
Sbjct  379  RRGKDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKVESLNHLSKDAR  429



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMKKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KL L+PEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRNKLELNPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDL+EINEAFASQ++YC+KKL LDP+KINVNG AMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LDDIDLYEINEAFASQFVYCRKKLELDPKKINVNGAAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKDA
Sbjct  414  RRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKDA  463



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A +KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAXKKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRNKLELDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+
Sbjct  268  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQ  327

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  328  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMK  387

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  388  RRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  436



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A +KGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSIAERKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKDAR
Sbjct  412  RRGKDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKVESLNHLSKDAR  462



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+
Sbjct  275  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQ  334

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  335  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMK  394

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  395  RRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  443



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 163/171 (95%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A +KGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSIAERKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKDAR
Sbjct  412  RRGRDCRFGVISMCIGTGMGAAAVFERGDSTDELCNARKVESPNHLSKDAR  462



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ+TDGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  292  SQITDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ++YC+KKL LD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LGDIDLFEINEAFASQFVYCRKKLELDSEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARK ET   LSKDA
Sbjct  412  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNARKAETDKLLSKDA  461



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   308 bits (788),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A QKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLE
Sbjct  288  SQVSDGAGAVLLMKRSVADQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  348  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCRYGV+SMCIGTGMGAA VFERGD  DEL NARKV++  +LSKDAR
Sbjct  408  RRGKDCRYGVISMCIGTGMGAAAVFERGDRTDELCNARKVDSLNFLSKDAR  458



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+
Sbjct  292  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQ  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  412  RRGRDCRFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  460



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 164/172 (95%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  290  SQISDGAGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  LEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSKDAR  196
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+D+R
Sbjct  410  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSRDSR  461



>gb|AFW68655.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=230

 Score =   299 bits (766),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  60   SQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  119

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  120  MDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMK  179

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  180  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  229



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A QKGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  288  SQVSDGAGAVLLMKRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQYLYC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMK
Sbjct  348  LDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARTVATLLHEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D L NARKVETH + LSKDAR
Sbjct  408  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDGLCNARKVETHIHLLSKDAR  459



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVET--HGYLSKDA  199
            RRGKDCRYGVVSMCIGTGMGAA VFERGDA D LSNAR+VE      LSKD+
Sbjct  412  RRGKDCRYGVVSMCIGTGMGAAAVFERGDAVDSLSNARRVEAAHSSLLSKDS  463



>ref|NP_001142099.1| uncharacterized protein LOC100274263 [Zea mays]
 gb|ACF87638.1| unknown [Zea mays]
Length=230

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  60   SQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  119

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC +KL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  120  MDDIDLFEINEAFASQYVYCCRKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMK  179

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  180  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  229



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP+VMGIGPAVAIPAAVKSAGL+
Sbjct  291  SQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAAVGVDPSVMGIGPAVAIPAAVKSAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDI+LFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL EMK
Sbjct  351  LDDINLFEINEAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA V ERGD  DEL NAR V TH +LSKDA+
Sbjct  411  RRGKDCRFGVISMCIGSGMGAAAVLERGDCVDELCNARMVPTHTHLSKDAK  461



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   306 bits (783),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  351  LNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGTTGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KVE    LSKDAR
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKVEGINLLSKDAR  461



>gb|AFW68656.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=295

 Score =   300 bits (768),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  125  SQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  184

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  185  MDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMK  244

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  245  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  294



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   305 bits (782),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  291  SQISDGAGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  351  LEDIDLFEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSKDA  199
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+D+
Sbjct  411  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSRDS  461



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  290  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  LDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  D L NAR+V T+  LSKD
Sbjct  410  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDPLCNARQVGTNNLLSKD  458



>gb|AFK34605.1| unknown [Lotus japonicus]
Length=296

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPAVMG+GPA AIP AVK+AGLE
Sbjct  125  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPAVMGVGPAAAIPVAVKAAGLE  184

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  185  LDDIDLFEINEAFASQFVYCRNKLGLDLEKINVNGGAMAIGHPLGATGARCVATLLHEMK  244

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+   +LSKDA
Sbjct  245  RRGRDCRFGVISMCIGTGMGAAAVFERGDGVDELRNARKVDNL-HLSKDA  293



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   305 bits (781),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A QKGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  288  SQVSDGAGAVLLMKRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQYLYC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMK
Sbjct  348  LDDIDLFEINEAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D L NARKVE+H + LSKDAR
Sbjct  408  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDGLCNARKVESHIHLLSKDAR  459



>gb|AFW68657.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=345

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  175  SQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  234

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  235  MDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMK  294

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  295  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  344



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 160/171 (94%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AIQKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLE
Sbjct  289  SQVSDGAGAVLLMKRSIAIQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLE  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  349  LDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGARCVATLLHEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ DEL NARKV+   YLSKDAR
Sbjct  409  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELRNARKVDDL-YLSKDAR  458



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  LNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETH-GYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KVE     LSKDAR
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKVEGGVNLLSKDAR  462



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIP AVKSAGL+
Sbjct  292  SQVSDGAAAVLLMKRSVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPPAVKSAGLD  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDL+EINEAFASQ++YCQKKL LDPEK+NVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLYEINEAFASQFVYCQKKLNLDPEKVNVNGGAMALGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  412  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVSNNNSFLSKDAK  462



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKGLP+LGVFR+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+
Sbjct  289  SQVSDGAGAVLLMRRDIAMQKGLPVLGVFRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQ  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DD+DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  349  IDDVDLFEINEAFASQYVYCCKKLGLDPTKVNVNGGAMALGHPLGATGARCVSTLLNEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + +H +LSKDA
Sbjct  409  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGIPSHNWLSKDA  458



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  291  SQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  351  MDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  411  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  460



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKR++A+QKGLPILGVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRTVAMQKGLPILGVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  352  IDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGALALGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERG A D+L NAR ++ H  LSKDA+
Sbjct  412  RRGKDCRFGVISMCIGTGMGAAAVFERGSAVDQLCNARPIKDHTSLSKDAQ  462



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  292  SQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  352  LDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  412  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKDAK  462



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  316  SQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  375

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  376  LDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGARCVATLLHEMK  435

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  436  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKDAK  486



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  324  SQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  383

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  384  LDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGARCVATLLHEMK  443

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  444  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKDAK  494



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 158/171 (92%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGA AVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLE
Sbjct  292  SQVTDGASAVLLMKRSVALQKGLPILGVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLG+TGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGSTGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV+    LSKDAR
Sbjct  412  KRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKDAR  461



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKRS+A++KGLPILGVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  285  SQISDGAAAVLLMKRSVAMRKGLPILGVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLE  344

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGARCVAT+LHEMK
Sbjct  345  LEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGARCVATILHEMK  404

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD+R
Sbjct  405  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNARKVESNNLLSKDSR  455



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKRS+A+ KGLPILGVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  285  SQISDGAAAVLLMKRSVAMHKGLPILGVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLE  344

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGARCVAT+LHEMK
Sbjct  345  LEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGARCVATILHEMK  404

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD+R
Sbjct  405  RRGRDCRFGVVSMCIGTGMGAAAVFERGDDCDELCNARKVESNNLLSKDSR  455



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKRS+A+ KGLPILGVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  285  SQISDGAAAVLLMKRSVAMHKGLPILGVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLE  344

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGARCVAT+LHEMK
Sbjct  345  LEDIDLFEINEAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGARCVATILHEMK  404

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD+R
Sbjct  405  RRGRDCRFGVVSMCIGTGMGAAAVFERGDDCDELCNARKVESNNLLSKDSR  455



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 159/171 (93%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLE
Sbjct  293  SQVSDGAGAVLLMKRSIAMQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  353  LDDIDLFEINEAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGARCVATLLHEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RGKDCRYGV+SMCIGTGMGAA VFERGD+ DEL NARK +   +LSKDAR
Sbjct  413  KRGKDCRYGVISMCIGTGMGAAAVFERGDSVDELCNARKGDNL-FLSKDAR  462



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+RS+A+QKGLPI GVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE
Sbjct  290  SQVSDGAGAVLLMRRSVALQKGLPIFGVFRSFVAVGVDPAVMGVGPAVAIPAAVKAAGLE  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAF SQ++YC+ KLGLDPEK+NVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  LNDIDLFEINEAFGSQFVYCRNKLGLDPEKVNVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            R+GKDCR+GV+SMCIGTGMGAA VFERGD  D L+NARK+     LSKDA
Sbjct  410  RQGKDCRFGVISMCIGTGMGAAAVFERGDGVDPLNNARKIGASNLLSKDA  459



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   298 bits (762),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPA AIP AVKSAGLE
Sbjct  297  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAAAIPVAVKSAGLE  356

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  357  LDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMK  416

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKD R+GV+SMCIG+GMGAA VFERGD+ DEL N R VE +  LS DAR
Sbjct  417  RRGKDHRFGVISMCIGSGMGAAAVFERGDSVDELCNVRTVERNNLLSNDAR  467



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGV P++MGIGPAVAIPAAVK+AGL+
Sbjct  275  SQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQ  334

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++YCQKKL +DP+KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  335  IDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMK  394

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+DCR+GVVSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  395  RRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAK  432



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   297 bits (761),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  290  SQVSDGAGAVLLMRRDVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA GHPLGATGARCV+TLL+EMK
Sbjct  350  IDDIDLFEINEAFASQYVYCCKKLELDPSKVNVNGGAMAFGHPLGATGARCVSTLLNEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+++++  LSKDA
Sbjct  410  RRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIQSNNQLSKDA  459



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPA AIP AVKSAGLE
Sbjct  297  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAAAIPVAVKSAGLE  356

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  357  LDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMK  416

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKD R+GV+SMCIG+GMGAA VFERGD+ DEL N R VE +  LS DAR
Sbjct  417  RRGKDHRFGVISMCIGSGMGAAAVFERGDSVDELCNVRTVERNNLLSNDAR  467



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  292  SQVSDGAGAVLLMRRDVAMKKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLG TGARCV+TLL+EMK
Sbjct  352  MDDIDLFEINEAFASQYVYCCKKLELDPAKVNVNGGAMALGHPLGCTGARCVSTLLNEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+N+R + TH +LSKDA
Sbjct  412  RRGKDCRFGVISMCIGSGMGAAAVFERGDCVDELTNSRGIPTHNWLSKDA  461



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGV P++MGIGPAVAIPAAVK+AGL+
Sbjct  290  SQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQ  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++YCQKKL +DP+KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  IDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+DCR+GVVSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  410  RRGRDCRFGVVSMCIGTGMGAAAVFERGDACDELCNAK  447



>ref|XP_008349047.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Malus domestica]
Length=292

 Score =   290 bits (743),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP VMG+GPA AIP AVKSAGLE
Sbjct  122  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPTVMGVGPAAAIPVAVKSAGLE  181

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  182  LDDIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMK  241

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V ++  +S DA+
Sbjct  242  RRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNARTVXSNNLVSNDAK  292



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGL 
Sbjct  290  SQVSDGAGAVLLMKRSVAMHKGLPILGVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLA  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LD +KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  350  LEDIDLFEINEAFASQFVYCRKKLELDSQKINVNGGAMAIGHPLGATGARCVATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSK  205
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N RKVE++  LS 
Sbjct  410  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGRKVESNNLLSN  457



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGL 
Sbjct  292  SQVSDGAGAVLLMKRSVAMHKGLPILGVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLA  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+KKL LD +KINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LEDIDLFEINEAFASQFVYCRKKLELDSQKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSK  205
            RRG+DCR+GVVSMCIGTGMGAA VFERGD CDEL N RKVE++  LS 
Sbjct  412  RRGRDCRFGVVSMCIGTGMGAAAVFERGDGCDELCNGRKVESNNLLSN  459



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A +KGLPILG+FR F AVGVDPA+MG+GPA AIPAAVK+AGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAEKKGLPILGIFRNFVAVGVDPAIMGVGPAFAIPAAVKAAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  354  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFER    DEL NAR   T+  LSKDAR
Sbjct  414  RRGKDCRFGVISMCIGTGMGAAAVFERAGHTDELCNARVAATNSLLSKDAR  464



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKGLPI+GVFR+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+
Sbjct  291  SQVSDGAGAVLLMRRDIAMQKGLPIVGVFRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DD+DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGAR V+TLL+EMK
Sbjct  351  IDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGARSVSTLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + TH  LSKDA
Sbjct  411  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKDA  460



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLE
Sbjct  292  SQVSDGAAAVLLMKRSVALQKGLPILGVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+  LGLDPEKINVNGGAMAIGHPLG+TGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNNLGLDPEKINVNGGAMAIGHPLGSTGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV+    LSKDAR
Sbjct  412  KRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKDAR  461



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKGLPI+GVFR+FAAVGVDPA+MG+GPAVAIPAAVK+AGL+
Sbjct  291  SQVSDGAGAVLLMRRDIAMQKGLPIVGVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DD+DLFEINEAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGAR V+TLL+EMK
Sbjct  351  IDDVDLFEINEAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGARSVSTLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR + TH  LSKDA
Sbjct  411  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKDA  460



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  288  SQVSDGAGAVLLMKRSVAVSKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMK
Sbjct  348  IDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  408  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  457



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLAIQKGLPILG+FR+FAAVGVDP VMGIGPAVAIPAAV SAGLE
Sbjct  296  SQISDGAGAVLLMKRSLAIQKGLPILGIFRSFAAVGVDPGVMGIGPAVAIPAAVNSAGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQ++YC KKL LDPEK+NVNGGAMA+GHPLGATGARCVATLL+EMK
Sbjct  356  IADIDLFEINEAFASQFVYCCKKLDLDPEKVNVNGGAMALGHPLGATGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA V ERGD  DELSNA+ +    +LSKDA
Sbjct  416  RRGKDCRFGVISMCIGSGMGAAAVLERGDCVDELSNAQAISAQNFLSKDA  465



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLP+LGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  288  SQVSDGAGAVLLMKRSVAVSKGLPVLGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMK
Sbjct  348  IDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  408  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  457



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A QKGLPILGVFRTF AVGVDPA+MG+GPA AIP AVK+AGLE
Sbjct  289  SQVSDGAAAVLLMKRSVAQQKGLPILGVFRTFTAVGVDPAIMGVGPAAAIPVAVKAAGLE  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ+LYC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM+
Sbjct  349  LDDIDLFEINEAFASQFLYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMR  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RG+DCR+GV+SMCIGTGMGAA VFE GD  DEL NARKV+    LSKDAR
Sbjct  409  KRGRDCRFGVISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKDAR  458



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   295 bits (754),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  286  SQVSDGAAAVLLMKRSIAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  345

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L++IDLFEINEAFASQY+YCQKKL LDPE +NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  346  LNNIDLFEINEAFASQYVYCQKKLNLDPENVNVNGGALALGHPLGATGARCVATLLHEMK  405

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  406  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARANNNNNFLSKDAK  456



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   294 bits (753),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  286  SQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  345

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L++IDLFEINEAFASQY+YCQKKL LDPE +NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  346  LNNIDLFEINEAFASQYVYCQKKLNLDPENVNVNGGALALGHPLGATGARCVATLLHEMK  405

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  406  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARANNNNNFLSKDAK  456



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   294 bits (753),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA QKGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAV+SAGLE
Sbjct  287  SQVSDGAGAVLLMKRSLAAQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPAAVQSAGLE  346

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  347  LNDIDLFEINEAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLNEMK  406

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKD R+GV+SMCIG+GMGAA VFERGD  D L N RKVE++  LSKDAR
Sbjct  407  RRGKDSRFGVISMCIGSGMGAAAVFERGDCVDALCNVRKVESNDLLSKDAR  457



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFR+F AVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  289  SQVSDGAGAVLLMKRSVAVSKGLPILGVFRSFVAVGVDPAVMGIGPAVAIPAAVKSAGLE  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMK
Sbjct  349  IDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  409  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  458



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  351  IEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCVATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVV+MCIG+GMGAA VFERGD  DELSN R +++H +LS+DA+
Sbjct  411  RRGRDCRFGVVTMCIGSGMGAAAVFERGDTVDELSNVRDIQSHNFLSRDAK  461



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+E
Sbjct  300  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIE  359

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  360  LADIDLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIALGHPLGATGARCVGTLLYEMK  419

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DE  N R V+ + +LSKDAR
Sbjct  420  RRGKDCRFGVISMCIGSGMGAAAVFERGDCVDEFCNVRAVKYNEFLSKDAR  470



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKR +A+QKGLPILGVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRVVAMQKGLPILGVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  352  IDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGAIALGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFER  A D+L NAR ++ H  LS+DA+
Sbjct  412  RRGKDCRFGVISMCIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRDAQ  462



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   293 bits (749),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLL KRS+A+QKGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAVK+AGLE
Sbjct  297  SQVSDGAGAVLLAKRSVAVQKGLPILGVFRSFAAVGVDPAVMGVGPAFAIPAAVKAAGLE  356

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LD+IDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  357  LDNIDLFEINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLHEMK  416

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            R GKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V  +  LSKDA
Sbjct  417  RCGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARPVNGNDLLSKDA  466



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL 
Sbjct  296  SQVSDGAGAVLLMKRSVAVQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLT  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDL EINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  356  LDDIDLLEINEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            R+G+D R+GV+SMCIG+GMGAA VFERGD  DEL NAR ++ +  LS+DA+
Sbjct  416  RQGRDSRFGVISMCIGSGMGAAAVFERGDCADELCNARPIKINNLLSRDAQ  466



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   292 bits (747),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKG PILGVFR+FAAVGVDPAVMG+GPA+AIPAAVKSAGL+
Sbjct  289  SQVSDGAGAVLLMRRDVAMQKGFPILGVFRSFAAVGVDPAVMGVGPAIAIPAAVKSAGLQ  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++D+DLFEINEAFASQ++YC+KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  349  IEDVDLFEINEAFASQFVYCRKKLELDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA D L+NAR++ +H  LS+DA
Sbjct  409  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDGLTNARQIHSHNLLSEDA  458



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  354  LDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGATGARCVGTLLNEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DE  NAR V  +  LSKDA
Sbjct  414  RRGKDCRFGVISMCIGSGMGAASVFERGDCVDEFCNARAVHKNELLSKDA  463



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A QKGLPILG++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+
Sbjct  265  SQVSDGAGAVLLMRRDVATQKGLPILGIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQ  324

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++D+DLFEINEAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  325  INDVDLFEINEAFASQYVYCSKKLDLDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMK  384

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR V +  +LSKD
Sbjct  385  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGVPSLNWLSKD  433



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  351  IGDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVV+MCIG+GMGAA VFERGDA D LSN R ++ H +LSKDA+
Sbjct  411  RRGRDCRFGVVTMCIGSGMGAAAVFERGDAVDGLSNVRDIQAHNFLSKDAK  461



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILG+FR+FAAVGVDP VMGIGPAVAIP AVKSAGLE
Sbjct  293  SQVSDGAGAVLLMKRSLAMQKGLPILGIFRSFAAVGVDPGVMGIGPAVAIPPAVKSAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ++YC KKL LD EK+NVNGGAMA+GHPLGATGARCVATLL+EMK
Sbjct  353  LSDIDLFEINEAFASQFVYCCKKLDLDREKVNVNGGAMALGHPLGATGARCVATLLNEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA V ERGD  D+L NAR V  + +LSKDA
Sbjct  413  RRGKDCRFGVISMCIGSGMGAAAVLERGDCVDDLCNARAVSENNFLSKDA  462



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPAVMG+GPA AIPAA K AGL 
Sbjct  256  SQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLR  315

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  316  VSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGARCVATLLHEMK  375

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKDA+
Sbjct  376  RRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKDAK  426



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  351  IGDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVV+MCIG+GMGAA VFERGDA D LSN R ++ H +LSKDA+
Sbjct  411  RRGRDCRFGVVTMCIGSGMGAAAVFERGDAVDGLSNVRDMQAHNFLSKDAK  461



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGA LLMKRSLA+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLE
Sbjct  295  SQVSDGAGAALLMKRSLAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLE  354

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  355  LDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGATGARCVGTLLNEMK  414

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  D+  NAR V+ +  LSKDAR
Sbjct  415  RRGKDCRFGVISMCIGSGMGAAAVFERGDCVDDFCNARAVQKNDLLSKDAR  465



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPAVMG+GPA AIPAA K AGL 
Sbjct  298  SQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLR  357

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  358  VSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGARCVATLLHEMK  417

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKDA+
Sbjct  418  RRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKDAK  468



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPAVMG+GPA AIPAA K AGL 
Sbjct  304  SQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLR  363

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  364  VSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGARCVATLLHEMK  423

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKDA+
Sbjct  424  RRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKDAK  474



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R++A+ KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  291  SQVSDGAGAVLLMRRAVAMSKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFE+NEAFASQ++YC K LGLD  K+NVNGGA+A+GHPLGATGARC+ATLL+EMK
Sbjct  351  IDDIDLFELNEAFASQFVYCCKTLGLDRSKVNVNGGAIAMGHPLGATGARCIATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R V +  +LS+DA+
Sbjct  411  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHVPSQNFLSRDAK  461



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AIQ+GLPILGVFR+FAAVGVDPAVMGIGPAVAIP AVK AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAIQRGLPILGVFRSFAAVGVDPAVMGIGPAVAIPKAVKDAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFE+NEAFASQ+ Y  KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEM 
Sbjct  352  ISDIDLFELNEAFASQFTYSCKKLDLDIEKVNVNGGAMALGHPLGATGARCVATLLHEMS  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RGKDCR+GV+SMCIG+GMGAA VFERG+A D LSNAR V+ +  LSKDAR
Sbjct  412  KRGKDCRFGVISMCIGSGMGAAAVFERGNAVDNLSNARPVQNNSLLSKDAR  462



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+
Sbjct  291  SQVSDGAGAVLLMRRDVAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  351  IEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGARCVGTLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GVV+MCIG+GMGAA VFERGD  DEL N RK+++   LSKDA
Sbjct  411  RRGKDCRFGVVTMCIGSGMGAAAVFERGDGVDELCNTRKIQSQNLLSKDA  460



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKGLPILGVFR+F AVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  290  SQVSDGAGAVLLMRRDVAMQKGLPILGVFRSFGAVGVDPAVMGIGPAVAIPAAVKAAGLQ  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  350  IDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGAIALGHPLGATGARCVITLLNEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGK CR+GV+SMCIG+GMGAA VFERGD  D+LSNAR++++   LSKDA
Sbjct  410  RRGKKCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIQSTSLLSKDA  459



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/149 (92%), Positives = 147/149 (99%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLE
Sbjct  255  SQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLE  314

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  315  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  374

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  375  RRGKDCRFGVVSMCIGTGMGAAAVFERGD  403



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILG+FR+F+  GVDPAVMGIGPAVAIPAA KSAGL 
Sbjct  296  SQISDGAGAVLLMKRSLAMEKGLPILGIFRSFSVAGVDPAVMGIGPAVAIPAAAKSAGLG  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMK
Sbjct  356  VDDIDLFEINEAFASQYVYCCKKLELDMEKVNVNGGAMALGHPLGATGARCVATLLHEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRG+DCR+GV+SMCIG+GMGAAGVFERGD+ D+L NAR V     LSKD +
Sbjct  416  RRGRDCRFGVISMCIGSGMGAAGVFERGDSTDDLCNARPVSKVNLLSKDVK  466



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  211  SQVSDGAGAVLLMKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  270

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMK
Sbjct  271  IDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMK  330

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVET  223
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+ 
Sbjct  331  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVKN  372



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFE+NEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  354  LDDIDLFEMNEAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKD R+GV+SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  414  RRGKDNRFGVISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AIQ+GLPILGVFR+FAAVGVDPAVMGIGPAVAIP AVK AGLE
Sbjct  284  SQVSDGAGAVLLMKRSVAIQRGLPILGVFRSFAAVGVDPAVMGIGPAVAIPKAVKDAGLE  343

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFE+NEAFASQ+ Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEM 
Sbjct  344  ISDIDLFELNEAFASQFTYSCKKLDLDMEKVNVNGGAIALGHPLGATGARCVATLLHEMS  403

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RGKDCR+GV+SMCIG+GMGAA VFERG+A D LSNAR V+ +  LSKDAR
Sbjct  404  KRGKDCRFGVISMCIGSGMGAAAVFERGNAVDNLSNARPVQNNSLLSKDAR  454



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+QKGLPILGVFR+FAAVGV+P VMGIGPAVAIPAAV++AGL+
Sbjct  289  SQVSDGAGAVLLMRRDVAMQKGLPILGVFRSFAAVGVEPGVMGIGPAVAIPAAVRAAGLQ  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
             DDID+FEINEAFASQ++YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  349  PDDIDIFEINEAFASQFVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVSTLLNEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFE GD  D+L+NAR+VE + +LSKDA
Sbjct  409  RRGKDCRFGVISMCIGSGMGAAAVFEHGDVVDQLTNARQVEANSFLSKDA  458



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAV++AGL+
Sbjct  291  SQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVQAAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  351  IGDIDLFEINEAFASQYVYCCKKLELDPTKVNVNGGAIALGHPLGATGARCVSTLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + +  +LSKDA
Sbjct  411  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARDIPSLNWLSKDA  460



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLM+R +AI+KG PI GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+
Sbjct  291  SQVSDGAAAVLLMRRDVAIKKGFPIFGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  351  IEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGARCVATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            R+GKDCR+GVV+MCIG+GMGAA VFERGD  DEL NARK+++   LSKDA
Sbjct  411  RKGKDCRFGVVTMCIGSGMGAAAVFERGDGVDELCNARKIQSQNLLSKDA  460



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAV +AGL+
Sbjct  290  SQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVNAAGLQ  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
             DDIDLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLG TGARCV+TLL+EMK
Sbjct  350  TDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGALALGHPLGDTGARCVSTLLNEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR++ ++  LSKDA
Sbjct  410  RRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNARRIRSNNLLSKDA  459



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM++ +A+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  290  SQVSDGAGAVLLMRKDVAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGAR V+TLL+EMK
Sbjct  350  IDDIDLFEINEAFASQFVYCCKKLELDPSKVNVNGGAIALGHPLGATGARSVSTLLNEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSN R+++++  LSKDA
Sbjct  410  RRGKDCRFGVISMCIGSGMGAAAVFERGDVVDQLSNVRRIQSNNLLSKDA  459



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKR +A+QKGLPILGVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRVVAMQKGLPILGVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGA CVATLLHEMK
Sbjct  352  IDDIDLFEINEAFASQFTYCSQKLELDPEKVNVNGGAIALGHPLGATGALCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
             RGKDCR+GV+SMCIGTGMGAA VFER  A D+L NAR ++ H  LS+DA+
Sbjct  412  LRGKDCRFGVISMCIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRDAQ  462



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   286 bits (733),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DG+GAVLLMKRSLAI+KGLP+LGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  293  SQVSDGSGAVLLMKRSLAIKKGLPVLGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGAR V+TLL+EMK
Sbjct  353  LNDIDLFEINEAFASQYVYCIKKLGLDPEKVNVNGGALALGHPLGATGARSVSTLLNEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+G++SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  413  RRGKDCRFGIISMCIGSGMGAAAVLERGDSVDELRNAR  450



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDP +MG+GPAVAIPAAVK+AGLE
Sbjct  281  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPEIMGVGPAVAIPAAVKAAGLE  340

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLGL+PEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  341  LDDIDLFEINEAFASQYVYCRNKLGLNPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  400

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  238
            RRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N+
Sbjct  401  RRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNS  437



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A QKGLPILG++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+
Sbjct  283  SQVSDGAGAVLLMRRDVATQKGLPILGIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQ  342

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++D+DLFEINEAFASQ++YC KKL LDP KINVNGGAMA+GHPLGATGARCV+TLL+EMK
Sbjct  343  INDVDLFEINEAFASQFVYCAKKLELDPVKINVNGGAMALGHPLGATGARCVSTLLNEMK  402

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  202
            RRGKDCR+GV+SMCIG+GMGAA VFERGDA DEL+NAR   +   LSKD
Sbjct  403  RRGKDCRFGVISMCIGSGMGAAAVFERGDAVDELTNARGTPSLNLLSKD  451



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDP +MG+GPAVAIPAAVK+AGLE
Sbjct  287  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPEIMGVGPAVAIPAAVKAAGLE  346

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLGL+PEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  347  LDDIDLFEINEAFASQYVYCRNKLGLNPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  406

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  238
            RRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N+
Sbjct  407  RRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNS  443



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA QKGLPI GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSLAXQKGLPIXGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  354  IDDIDLFEINEAFASQYVYCVKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKD R+GV+SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  414  RRGKDNRFGVISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  258  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  317

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+ KLG+DPEK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  318  LNDIDLFEINEAFASQFVYCRNKLGIDPEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  377

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  378  RRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  417



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLM+R +AI+KG PI GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+
Sbjct  291  SQVSDGAAAVLLMRRDVAIKKGFPIFGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  351  IEDIDLFELNEAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKDCR+GVV+MCIG+GMGAA VFERGD  D L NARK+ +   LSKDAR
Sbjct  411  RRGKDCRFGVVTMCIGSGMGAAAVFERGDGVDALCNARKIPSQNLLSKDAR  461



>gb|AFK47277.1| unknown [Medicago truncatula]
Length=158

 Score =   275 bits (703),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 147/159 (92%), Gaps = 1/159 (1%)
 Frame = -2

Query  672  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  493
            MKRS+A+QKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEINEA
Sbjct  1    MKRSIAMQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEINEA  60

Query  492  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  313
            FASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGARCVATLLHEMK+RGKDCRYGV+S
Sbjct  61   FASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGARCVATLLHEMKKRGKDCRYGVIS  120

Query  312  MCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            MCIGTGMGAA VFERGD+ DEL NARK +   +LSKDAR
Sbjct  121  MCIGTGMGAAAVFERGDSVDELCNARKGDNL-FLSKDAR  158



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+RS+A++KGLPILGVFRTFAAVGVDPA+MGIGPAVAIP AVK+A LE
Sbjct  284  SQLSDGAGAVLLMRRSVAMEKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPTAVKAASLE  343

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLG++PEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  344  LDDIDLFEINEAFASQFVYCRNKLGINPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  403

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  241
            RRGKDCR+GVVSMCIG+GMGAA VFERGD+ DEL N
Sbjct  404  RRGKDCRFGVVSMCIGSGMGAAAVFERGDSVDELRN  439



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDPA+MG+GPA+AIPAAVK+AGLE
Sbjct  281  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPAIMGVGPALAIPAAVKAAGLE  340

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLGL+PE INVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  341  LDDIDLFEINEAFASQYVYCRNKLGLNPENINVNGGAIAIGHPLGATGARCVATLLHEMK  400

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  232
            RRGKDCR+GVVSMCIG+GMGAA VFERG + DEL N  +
Sbjct  401  RRGKDCRFGVVSMCIGSGMGAAAVFERGGSVDELPNVSR  439



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  293  SQVSDGAGAVLLMKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMK
Sbjct  353  IDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLNEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVET  223
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+ 
Sbjct  413  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVKN  454



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAVK+AGLE
Sbjct  296  SQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAYAIPAAVKAAGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DI LFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCV+T+LHEMK
Sbjct  356  LNDISLFEINEAFASQYVYCIKKLGLDPEKVNVNGGALALGHPLGATGARCVSTILHEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  238
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  DELS+A
Sbjct  416  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELSSA  452



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   284 bits (727),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  293  SQVSDGAGAVLLMKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMK
Sbjct  353  IDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVET  223
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+ 
Sbjct  413  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVKN  454



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   284 bits (726),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+RS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  280  SQLSDGAGAVLLMRRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  339

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC+ KLG++PEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  340  LDDIDLFEINEAFASQYVYCRNKLGINPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  399

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  226
            RRGK CR+GVVSMCIG+GMGAA VFERG + DEL N  K E
Sbjct  400  RRGKYCRFGVVSMCIGSGMGAAAVFERGGSVDELRNVSKGE  440



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   284 bits (727),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A+Q G PILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGL+
Sbjct  292  SQVSDGAGAVLLMRRDVAMQNGFPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQ  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFEINEAFASQ++YC KKL LD  K+NVNGGA+A+GHPLGATGAR V+TLL+EMK
Sbjct  352  IEDIDLFEINEAFASQFVYCCKKLELDATKVNVNGGAIALGHPLGATGARSVSTLLNEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR GV+SMCIGTGMGAA VFERGDA D L+NAR++++H  LSKDA
Sbjct  412  RRGKDCRLGVISMCIGTGMGAAAVFERGDATDGLTNARRMQSHNLLSKDA  461



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  226
            RRGKDCR+GVV+MCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  411  RRGKDCRFGVVTMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  284  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  343

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+D+DLFEINEAFASQ++YC+ KLGLD EKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  344  LNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMK  403

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  404  RRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  443



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AI+KGLPILGVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAIKKGLPILGVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++YC+ KLGLDP+KINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  VDDIDLFEINEAFASQFVYCRNKLGLDPQKINVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  226
            RRGKDCR+GVVSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  411  RRGKDCRFGVVSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>dbj|BAD94007.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=213

 Score =   274 bits (700),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIPAA K AGL 
Sbjct  49   SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLN  108

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  109  VSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  168

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  169  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  206



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AIQKGLPI+GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLE
Sbjct  296  SQVSDGAGAVLLMKRSVAIQKGLPIIGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQY+YCQKKL LD +K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  356  LGDIDLFEINEAFASQYVYCQKKLELDSDKVNVNGGAIALGHPLGATGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+GV+SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  416  RRGKDCRFGVISMCIGSGMGAAAVLERGDSVDELCNAR  453



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  301  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  360

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+D+DLFEINEAFASQ++YC+ KLGLD EKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  361  LNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMK  420

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  421  RRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  460



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTF+AVGVDPA+MG+GPA AIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFSAVGVDPAIMGVGPAAAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC++KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  LNDIDLFEINEAFASQFVYCREKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETH-GYLSKDAR  196
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NA+KVE     LSKDAR
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNAKKVEGGVNLLSKDAR  462



>ref|XP_008365692.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like, partial 
[Malus domestica]
Length=162

 Score =   271 bits (692),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDP VMG+GPA AIP AVKSAGLE
Sbjct  3    SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPTVMGVGPAAAIPVAVKSAGLE  62

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKL LDPEK+N NGGA+A+GHPLGATGARCVAT L+EMK
Sbjct  63   LDDIDLFEINEAFASQYVYCCKKLELDPEKVNXNGGAIALGHPLGATGARCVATXLNEMK  122

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  123  RRGRDHXFGVXSMCIGSGMXAAAVFERGDSVDELCNARTV  162



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKR  A++K LP+LGVFR+FAAVGVDP+VMGIGPAVAIPAAVK+AGLE
Sbjct  285  SQVSDGAAAVLLMKRRTALEKNLPVLGVFRSFAAVGVDPSVMGIGPAVAIPAAVKAAGLE  344

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQ+ YC ++LGLD EK+NVNGGAMA+GHPLGATGARC ATLLHEMK
Sbjct  345  LSDIDLFEINEAFASQFTYCAQELGLDEEKVNVNGGAMALGHPLGATGARCTATLLHEMK  404

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RGKDCR+G+VSMCIG+GMGAA VFE+G A D LSNAR V  +  LS+DA+
Sbjct  405  KRGKDCRFGIVSMCIGSGMGAAAVFEQGGAIDPLSNARAVGQNNLLSRDAK  455



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  284  SQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLE  343

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+D+DLFEINEAFASQ++YC+ KLG D EKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  344  LNDVDLFEINEAFASQFVYCRNKLGQDAEKINVNGGAIAIGHPLGATGARCVATLLHEMK  403

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  404  RRGKDCRFGVVSMCIGSGMGAAAVFERGGDVDELCDVRKV  443



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   279 bits (714),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKR  A+++ LPILGVFR+FAAVGVDPAVMGIGPAVAIPAA+K+AGLE
Sbjct  290  SQVSDGAGAVLLMKRKTALERNLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKAAGLE  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFEINEAFASQ+ YC ++LGLD EKINVNGGA+A+GHPLGATGARC ATLLHEMK
Sbjct  350  INDIDLFEINEAFASQFTYCAQELGLDEEKINVNGGAIALGHPLGATGARCTATLLHEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            +RGKDCR+GV+SMCIG+GMGAA VFE+G A D LSN R V  +  LS+DA+
Sbjct  410  KRGKDCRFGVISMCIGSGMGAAAVFEQGGAIDPLSNVRAVGQNNLLSRDAK  460



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   279 bits (713),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GVDPAVMGIGPA AIPAA   AGL+
Sbjct  297  SQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLK  356

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  357  VSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  416

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHG  217
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR VET+G
Sbjct  417  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNAR-VETNG  459



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA K AGL 
Sbjct  293  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATKLAGLN  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  353  VSDIDLFEINEAFASQYVYCCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  413  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+AI+K LPILGVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLE
Sbjct  291  SQVSDGAGAVLLMKRSVAIKKELPILGVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGL PEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  LDDIDLFEINEAFASQFVYCRNKLGLVPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE  226
            RRGKDCR+GVVSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  411  RRGKDCRFGVVSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVF +FAAVGVDPAVMGIGPAVAIPAAVKSAGLE
Sbjct  293  SQVSDGAGAVLLMKRSLALQKGLPILGVF-SFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFEINEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMK
Sbjct  352  IDDIDLFEINEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVET  223
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NAR V+ 
Sbjct  412  RRGKDCRFGVISMCIGTGMGAAAVFERGDCVDELCNARAVKN  453



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   276 bits (706),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPAVMGIGPA AIPAA   AGL+
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLK  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  370  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  409



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPAVMGIGPA AIPAA   AGL+
Sbjct  291  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLK  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  VSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   276 bits (706),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPAVMGIGPA AIPAA   AGL+
Sbjct  291  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLK  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  351  VSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  411  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAA+GVDPAVMG+GPA AIP AVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAIGVDPAVMGVGPAAAIPVAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGAT    VATLL+EMK
Sbjct  354  LDDIDLFEINEAFASQYVYCCKKLGLDPEKVNVNGGAIALGHPLGATXXXXVATLLNEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRG+D R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  414  RRGRDHRFGVISMCIGSGMGAAAVFERGDSVDELCNARTV  453



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +AIQKGLPILG+FR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL+
Sbjct  289  SQVSDGAGAVLLMRRDVAIQKGLPILGIFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQ  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDL+EINEAFASQ++YC K+LGLDPEK+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  349  IKDIDLYEINEAFASQFVYCIKELGLDPEKVNVNGGAIALGHPLGATGARCVSTLLNEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG DCR+G++SMCIG+GMGAA VFERGD  D LSN +
Sbjct  409  RRGNDCRFGIISMCIGSGMGAAAVFERGDVADRLSNVQ  446



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA  KGLPILGVFR+FAAVGVDPAVMGIGPA AIPAAVKSAGL+
Sbjct  290  SQISDGAGAVLLMKRSLATNKGLPILGVFRSFAAVGVDPAVMGIGPAFAIPAAVKSAGLK  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDI+LFEINEAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGARCVATLL+EM 
Sbjct  350  LDDINLFEINEAFASQYVYCCKKLNLDPAKVNVNGGALALGHPLGATGARCVATLLNEMN  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETH  220
            RRG DCR+GV+SMCIG+GMGAA VFERGD  + L+N R  +T+
Sbjct  410  RRGTDCRFGVISMCIGSGMGAAAVFERGDHANGLTNTRAAQTN  452



>gb|ACU19231.1| unknown [Glycine max]
Length=198

 Score =   266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKS GLE
Sbjct  49   SQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSVGLE  108

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL EMK
Sbjct  109  LGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLSEMK  168

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  169  RRGKDCRYGVISMCIGSGMGAAAVFERGD  197



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GV+PAVMG+GPA AIPAA   AGL+
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVEPAVMGVGPAYAIPAATNLAGLK  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+     G+
Sbjct  370  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVANGDGH  414



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA   AGL 
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLN  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  370  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  414



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIPAA K AGL 
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLN  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  370  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   274 bits (701),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GV+PAVMG+GPA AIPAA   AGL+
Sbjct  296  SQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVEPAVMGVGPAYAIPAATNLAGLK  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  356  VSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+     G+
Sbjct  416  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVANGDGH  460



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   272 bits (696),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIPAA K AGL 
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLN  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  370  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA   AGL 
Sbjct  292  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLN  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  352  VSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  412  RRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  456



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGV R+FA  GVDP+VMGIGPAVAIPAA   AGL 
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGVLRSFAVTGVDPSVMGIGPAVAIPAATNLAGLN  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  370  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  414



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIPAA K AGL 
Sbjct  293  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLN  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  353  VSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  413  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>ref|XP_010473862.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=157

 Score =   263 bits (672),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -2

Query  621  RTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPE  442
            RTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPE
Sbjct  16   RTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPE  75

Query  441  KINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            KINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  76   KINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGD  135

Query  261  ACDELSNARKVETHGYLSKDAR  196
              DEL NARKVE  G LSKDAR
Sbjct  136  GVDELRNARKVEAQGLLSKDAR  157



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   273 bits (697),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL 
Sbjct  291  SQVSDGAAAVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLT  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLG TGARCVATLL EMK
Sbjct  351  LQDIDLFEINEAFASQYVYCCKKLNLDTEKVNVNGGAIALGHPLGTTGARCVATLLSEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+D R+GV+SMCIGTGMGAA V ERGD  DEL NAR
Sbjct  411  RRGRDSRFGVISMCIGTGMGAAAVIERGDYVDELRNAR  448



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL 
Sbjct  300  SQVSDGAAAVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLT  359

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCVATLL EMK
Sbjct  360  LQDIDLFEINEAFASQYVYCCKKLKLDTEKVNVNGGAIALGHPLGATGARCVATLLSEMK  419

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+D R+GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  420  RRGRDSRFGVISMCIGTGMGAAAVIERGDYVDEFCNAR  457



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGV R+FA  GVDP+VMGIGPAVAIPAA   AGL 
Sbjct  294  SQISDGAGAVLLMKRSLAMKKGLPILGVLRSFAVTGVDPSVMGIGPAVAIPAATNLAGLN  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  354  VSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  414  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  458



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+
Sbjct  290  SQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQ  349

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  350  IEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMK  409

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  410  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDQFSNVR  447



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLL+KRSLA++KGLPILGVFR+FA  GVDP+VMGIGP+VAIPAA   AGL 
Sbjct  293  SQISDGAGAVLLIKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPSVAIPAATNLAGLN  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  353  VSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  413  RRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGDGH  457



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA QKGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAV++AGLE
Sbjct  287  SQVSDGAGAVLLMKRSLAAQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPAAVQAAGLE  346

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  347  LNDIDLFEINEAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLNEMK  406

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGKD R+GV+SMCIG+GMGAA VFERGD  D L N RKV ++  LSKDAR
Sbjct  407  RRGKDSRFGVISMCIGSGMGAAAVFERGDCVDALCNVRKVGSNDLLSKDAR  457



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL 
Sbjct  341  SQVSDGAAAVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLT  400

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCVATLL EMK
Sbjct  401  LQDIDLFEINEAFASQYVYCCKKLKLDTEKVNVNGGAIALGHPLGATGARCVATLLSEMK  460

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+D R+GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  461  RRGRDSRFGVISMCIGTGMGAAAVIERGDYVDEFCNAR  498



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R +A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGL+
Sbjct  289  SQVSDGAGAVLLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQ  348

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  349  IEDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMK  408

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  235
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  409  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDQFSNVR  446



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 146/160 (91%), Gaps = 6/160 (4%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGAGAVLLMKR +A+QKGLPILGVFR+FAAVG DPAVMGIGPAVAIPAAVK+AGL+
Sbjct  291  SQVTDGAGAVLLMKRKMAMQKGLPILGVFRSFAAVGCDPAVMGIGPAVAIPAAVKAAGLQ  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC +KL LDPEK+NVNGGA+A+GHPLGATGARCV TLLHEMK
Sbjct  351  IGDIDLFEINEAFASQYVYCCQKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLHEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GVVSMCIGTGMGAA VFERG      SNAR +
Sbjct  411  RRGKDCRFGVVSMCIGTGMGAAAVFERG------SNARPI  444



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   268 bits (685),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKS GLE
Sbjct  296  SQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSVGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL+EMK
Sbjct  356  LGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  416  RRGKDCRYGVISMCIGSGMGAAAVFERGD  444



>ref|XP_007034451.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOY05377.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=326

 Score =   263 bits (672),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 144/170 (85%), Gaps = 19/170 (11%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  175  SQVSDGAGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  234

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDL+EINEAFASQ++YC+KKL LDP                   GARCVATLLHEMK
Sbjct  235  LDDIDLYEINEAFASQFVYCRKKLELDP-------------------GARCVATLLHEMK  275

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRGKDCR+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKDA
Sbjct  276  RRGKDCRFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKDA  325



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILG+FR+F+AVGVDPAVMG+GPA AIPAAVKSAGLE
Sbjct  286  SQVSDGAAAVLLMKRSVAVQKGLPILGIFRSFSAVGVDPAVMGVGPAFAIPAAVKSAGLE  345

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDL+EINEAFASQ++Y  KKLGLDP K+NVNGGAMA GHPLGATGARCVATLL+EMK
Sbjct  346  LSNIDLYEINEAFASQFVYSCKKLGLDPTKVNVNGGAMAFGHPLGATGARCVATLLNEMK  405

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCR+GV+SMCIG+GMGAA VFERGD
Sbjct  406  RRGKDCRFGVISMCIGSGMGAAAVFERGD  434



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  690  AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  511
            AG    +KRSLA+QKGLPILGVFR+FAAVGVDPAVMG+GPA AIP AVKS GLELDDIDL
Sbjct  290  AGNASQVKRSLAMQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSPGLELDDIDL  349

Query  510  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  331
            FEINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+D 
Sbjct  350  FEINEAFASQYVYCCKKLGLDPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDH  409

Query  330  RYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            R+GV+SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  410  RFGVISMCIGSGMGAAAVFERGDSVDELCNARTV  443



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  296  SQISDGAGAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +I L+EINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  356  LGNIGLYEINEAFASQYVYCCKKLGLDPRKVNVNGGAIALGHPLGATGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            R GKDCRYGV+SMCIG+GMGAA VFERG+
Sbjct  416  RHGKDCRYGVISMCIGSGMGAAAVFERGE  444



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILG+FR+F+AVGVDPAVMG+GPA AIPAAVKSAGLE
Sbjct  286  SQVSDGAAAVLLMKRSVAVQKGLPILGIFRSFSAVGVDPAVMGVGPAFAIPAAVKSAGLE  345

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDL+EINEAFASQ++Y  KKLGLDP K+NVNGGAMA GHPLGATGARCVATLL+EMK
Sbjct  346  LSNIDLYEINEAFASQFVYSCKKLGLDPTKVNVNGGAMAFGHPLGATGARCVATLLNEMK  405

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCR+GV+SMCIG GMGAA VFERGD
Sbjct  406  RRGKDCRFGVISMCIGFGMGAAAVFERGD  434



>ref|XP_008382649.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
 ref|XP_008382651.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=181

 Score =   255 bits (652),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+D AGAVLLMKRSL +QKGLPILGVF +FAA+GVDPAVMG+GPA AIP AVKSAGLE
Sbjct  23   SQVSDDAGAVLLMKRSLTMQKGLPILGVFGSFAAIGVDPAVMGVGPAAAIPVAVKSAGLE  82

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+ C KKL LDPEK+N NGGA+A+GH LGATGARCVAT+L+EMK
Sbjct  83   LDDIDLFEINEAFASQYVXCCKKLELDPEKVNANGGAIALGH-LGATGARCVATVLNEMK  141

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRG+D  +GV SMCIG+GM AA VFERGD+ DEL NAR V
Sbjct  142  RRGRDHSFGVTSMCIGSGMEAAAVFERGDSVDELCNARTV  181



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  296  SQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL+EMK
Sbjct  356  LGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            R GKDCR+GV+SMCIG+GMGAA VFERGD
Sbjct  416  RGGKDCRFGVISMCIGSGMGAAAVFERGD  444



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLLMKRS+A+QKGLPILG+FR+FAAVGVDPAVMG+GPA AIPAAVKSAGLE
Sbjct  291  SQVSDGAAAVLLMKRSVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAFAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDLFEINEAFASQ++Y  KKLGLDP K+NVNGGA+A+GHPLGATGAR VATLL+EMK
Sbjct  351  LGNIDLFEINEAFASQFVYSCKKLGLDPSKVNVNGGAIALGHPLGATGARTVATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  411  RRGKDCRYGVISMCIGSGMGAAAVFERGD  439



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA   AGL 
Sbjct  250  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLN  309

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  310  VSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  369

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+     G+
Sbjct  370  RRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVANGEGH  414



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE
Sbjct  296  SQISDGAAAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLE  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDLFEINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL+EMK
Sbjct  356  LGNIDLFEINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            R GKDCR+GV+SMCIG+GMGA  VFERGD
Sbjct  416  RGGKDCRFGVISMCIGSGMGATAVFERGD  444



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLE
Sbjct  294  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLE  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDD+DLFEINEAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TGARCVATLLHEMK
Sbjct  354  LDDVDLFEINEAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGT  298
            RRGKDCR+GVVSMCIGT
Sbjct  414  RRGKDCRFGVVSMCIGT  430



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA   AGL 
Sbjct  294  SQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLN  353

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  354  VSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMK  413

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            RRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+     G+
Sbjct  414  RRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVANGEGH  458



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKR  A ++GLP+LG+FR+FAAVGVDPAVMGIGPAVAIPAAV+ AGL 
Sbjct  299  SQISDGAAAVLLMKRREAAKRGLPVLGIFRSFAAVGVDPAVMGIGPAVAIPAAVQKAGLS  358

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDID+FE+NEAFASQ  YC KKLGLDPE++N NGGA+A+GHPLG TGARC ATLLHEM 
Sbjct  359  IDDIDVFELNEAFASQATYCVKKLGLDPERVNPNGGAVALGHPLGCTGARCTATLLHEMN  418

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            +RGK  R+GVVSMCIG+GMGAA VFERG   D L NA      G+LS DA
Sbjct  419  KRGKASRFGVVSMCIGSGMGAAAVFERGGEVDALRNAAPTHAQGFLSHDA  468



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGA AVLLMKRS+A+QKGLPILG+FR+FAAVGVDPAVMG+GPA AIPAAVKSAGLE
Sbjct  291  SQISDGAAAVLLMKRSVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAFAIPAAVKSAGLE  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L +IDLFEINEAFASQ++Y  KKLGLD  K+NVNGGA+A+GHPLGATGAR VATLL+EMK
Sbjct  351  LGNIDLFEINEAFASQFVYSCKKLGLDRSKVNVNGGAIALGHPLGATGARSVATLLNEMK  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCRYGV+SMCIG+GMGAA VFERGD
Sbjct  411  RRGKDCRYGVISMCIGSGMGAAAVFERGD  439



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 134/135 (99%), Gaps = 0/135 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLE
Sbjct  292  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLE  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCI  304
            RRG+DCR+GV+SMCI
Sbjct  412  RRGRDCRFGVISMCI  426



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 146/170 (86%), Gaps = 15/170 (9%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS               FAAVGVDPAVMG+GPAVAIPAAVKSAGL+
Sbjct  297  SQVSDGAGAVLLMKRS---------------FAAVGVDPAVMGVGPAVAIPAAVKSAGLD  341

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMK
Sbjct  342  IDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMK  401

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  402  RRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  451



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+
Sbjct  292  SQVSDGAGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQ  351

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMK
Sbjct  352  LDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMK  411

Query  348  RRGKDCRYGVVSMCIG  301
            RRG+DCR+GV+SMCIG
Sbjct  412  RRGRDCRFGVISMCIG  427



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAG  LLMKRSLA+++GLPILG+FR++AAVGV+P VMG+GPAVAIP A K+AGLE
Sbjct  293  SQVSDGAGGALLMKRSLAMKRGLPILGLFRSYAAVGVEPGVMGVGPAVAIPIAAKNAGLE  352

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFEINEAFASQY+YC KKL LDP+K+NVNGGA+A+GHPLGATGARCV+TLL+EMK
Sbjct  353  VADIDLFEINEAFASQYVYCCKKLDLDPKKVNVNGGALALGHPLGATGARCVSTLLYEMK  412

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDA  259
            RRGKDCRYGV+SMCIG+GMGAA VFERGD+
Sbjct  413  RRGKDCRYGVISMCIGSGMGAAAVFERGDS  442



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 146/149 (98%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ++DGAGAVLLM+RS+A++KGLPIL VFRTFAAVGVDPA+MG+GPA AIPAAVK+AGLE
Sbjct  287  SQLSDGAGAVLLMRRSVAMRKGLPILCVFRTFAAVGVDPAIMGVGPAAAIPAAVKAAGLE  346

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMK
Sbjct  347  LNDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMK  406

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RRGKDCR+GVVSMCIG+GMGAAGVFERGD
Sbjct  407  RRGKDCRFGVVSMCIGSGMGAAGVFERGD  435



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGA AVLLM+R  A++KGLP+LGVFR+F AVGV+P +MGIGP  AIPAAVK+AGLE
Sbjct  288  SQVTDGAAAVLLMRRDAAMKKGLPVLGVFRSFVAVGVEPNIMGIGPVAAIPAAVKAAGLE  347

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLG TGARCV+TLL+EMK
Sbjct  348  LDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGCTGARCVSTLLYEMK  407

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  229
            RRGKDCR+GV+SMCIG+GMGAA VFERGD  D+LSNAR+V
Sbjct  408  RRGKDCRFGVISMCIGSGMGAAAVFERGDGVDQLSNARQV  447



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS A Q+GLP+LG FR+FA VGV+P VMGIGPAVAIP A+K AGLE
Sbjct  259  SQVSDGAGAVLLMKRSCASQRGLPVLGAFRSFAVVGVEPGVMGIGPAVAIPKAIKDAGLE  318

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DI LFEINEAFASQY YC KKL LDP K+NVNGGA+A+GHPLGATGARCVATLLHEM 
Sbjct  319  ISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALGHPLGATGARCVATLLHEMA  378

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  379  KRGSACRYGVVSMCIGTGMGAAAVFERGD  407



>ref|XP_008678417.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Zea mays]
Length=230

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 139/156 (89%), Gaps = 0/156 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A++KGLPILGVFR+FAAVGVDPA MG+GPAVAIPAAVK AGLE
Sbjct  35   SQVSDGAGAVLLMKRSVALKKGLPILGVFRSFAAVGVDPADMGVGPAVAIPAAVKFAGLE  94

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DIDLFE+NE FASQ++YC  KLGLD  K+NVNGGA+A+GHPL ATGARC+ATLL+EMK
Sbjct  95   IGDIDLFELNEPFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLDATGARCMATLLNEMK  154

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  241
            R+G DCR+GVV+MCIG+GMGAA VFE   A  E+S 
Sbjct  155  RQGIDCRFGVVTMCIGSGMGAAAVFELCSARLEVST  190



>gb|AFK39397.1| unknown [Lotus japonicus]
Length=138

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -2

Query  672  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  493
            MKR +A+QKGLPILG+FR+FAAVGVDP+VMG+GPA AIPAAVKSAGLEL +IDLFEINEA
Sbjct  1    MKRRVAVQKGLPILGIFRSFAAVGVDPSVMGVGPAFAIPAAVKSAGLELGNIDLFEINEA  60

Query  492  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  313
            FASQ++Y  KKLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKDCR+G +S
Sbjct  61   FASQFVYSCKKLGLDTRKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDCRFGAIS  120

Query  312  MCIGTGMGAAGVFERGD  262
            MCIG+GMGAA VFERGD
Sbjct  121  MCIGSGMGAAAVFERGD  137



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+E
Sbjct  300  SQVSDGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIE  359

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCV TLL+EMK
Sbjct  360  LADIDLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIALGHPLGATGARCVGTLLYEMK  419

Query  348  RRGKDCRYGVVSMCI  304
            RRGKDCR+GV+SMCI
Sbjct  420  RRGKDCRFGVISMCI  434



>gb|AAK76732.1| 3-ketoacyl-CoA thiolase [Gossypium hirsutum]
Length=133

 Score =   235 bits (599),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = -2

Query  672  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  493
            MKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEA
Sbjct  1    MKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEA  60

Query  492  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  313
            FASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMKRRGKDCR+GV+S
Sbjct  61   FASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVIS  120

Query  312  MCIGTGMGAAGVF  274
            MCIGTGMG +  F
Sbjct  121  MCIGTGMGGSSCF  133



>ref|XP_008355236.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=145

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = -2

Query  672  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  493
            MKRSLA+QKGLPILGVFR+FAA+GVDPAVMG+GPA AIP AVKSAGLELDDIDLFEINEA
Sbjct  1    MKRSLAMQKGLPILGVFRSFAAIGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEINEA  60

Query  492  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  313
            FASQY+ C KKL LDPEK+N NGGA+A+G   GATGARCVAT L+EMKRRG+D  +GV S
Sbjct  61   FASQYVSCCKKLELDPEKVNANGGAIALG---GATGARCVATXLNEMKRRGRDHSFGVTS  117

Query  312  MCIGTGMGAAGVFERGDACDELSNARKV  229
            MCIG+GM AA VFERGD+ DEL NAR V
Sbjct  118  MCIGSGMEAAAVFERGDSVDELCNARTV  145



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 3/149 (2%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS A Q+GLP+LG FR+FA VGV+P VMGIGPAVAIP AVK AGLE
Sbjct  249  SQVSDGAGAVLLMKRSCATQRGLPVLGAFRSFAVVGVEPGVMGIGPAVAIPKAVKDAGLE  308

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + DI LFEINEAFASQY YC KKL LDP K+NVNGGA+A+GHPL   GARCVATLLHEM 
Sbjct  309  ISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALGHPL---GARCVATLLHEMA  365

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  366  KRGSACRYGVVSMCIGTGMGAAAVFERGD  394



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL 
Sbjct  296  SQVSDGAGAVLLMKRSVAVQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLT  355

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDIDL EINEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMK
Sbjct  356  LDDIDLLEINEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGARCVATLLNEMK  415

Query  348  RRGKDCRYGVVSMCIGTGMG  289
            R+G+D R+GV+S+ I + +G
Sbjct  416  RQGRDSRFGVISILITSCLG  435



>gb|ACA58356.1| 3-ketoacyl-CoA thiolase [Arachis diogoi]
Length=127

 Score =   225 bits (574),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  573  PAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLG  394
            PA AIP AVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMA+GHPLG
Sbjct  2    PAAAIPVAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAMALGHPLG  61

Query  393  ATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  214
            ATGARC ATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD  DELSNARKV T+  
Sbjct  62   ATGARCTATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDGVDELSNARKVATNNL  121

Query  213  LSKDAR  196
            LSKDAR
Sbjct  122  LSKDAR  127



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQVTDGA AVL+M R+ A ++GLPILG+FR+FAAVGVDP++MGIGPAVAIP AV  AGL 
Sbjct  291  SQVTDGAAAVLMMTRAEAHRRGLPILGIFRSFAAVGVDPSIMGIGPAVAIPEAVARAGLS  350

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDID++EINEAFASQ  YC  KLG+D  K+N NGGA+A+GHPLGATGARC ATLLHE++
Sbjct  351  LDDIDVYEINEAFASQASYCVAKLGIDENKVNPNGGAIAMGHPLGATGARCTATLLHELR  410

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  199
            RRG+  R+GVVSMCIG+GMGAA VFE G   D+   AR V+    LSKDA
Sbjct  411  RRGRGSRFGVVSMCIGSGMGAAAVFETGGEVDKFMTARAVKGQVLLSKDA  460



>gb|ABR25554.1| peroxisomal 3-ketoacyl-coa thiolase 2 precursor [Oryza sativa 
Indica Group]
Length=243

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAGAVLLM+R + +  GLPILGVF++FAAVGV PAVMG+GPAVAIPAAV SAGL+
Sbjct  104  SQVSDGAGAVLLMRRDIPMNNGLPILGVFKSFAAVGVHPAVMGVGPAVAIPAAVNSAGLQ  163

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DIDLFE+NEAFASQ +YC  KLGLD  K+NVNGGA+A+GHPLGAT A+CVATLL+EM 
Sbjct  164  IEDIDLFELNEAFASQLVYCCNKLGLDRSKVNVNGGAIALGHPLGATRAQCVATLLNEMN  223

Query  348  RRGKDCRYGVVSMCIGTGMG  289
            RRG DC + VV+MCI +GMG
Sbjct  224  RRGTDCIFSVVTMCIVSGMG  243



>ref|XP_002500295.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
 gb|ACO61553.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
Length=425

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 126/147 (86%), Gaps = 3/147 (2%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGAG V+L KRS A+ KGLPI+G F +FAAVGVDP VMGIGPAVAIP A++ AGL 
Sbjct  278  SQVSDGAGCVVLAKRSYALAKGLPIMGRFVSFAAVGVDPKVMGIGPAVAIPVAIEKAGLR  337

Query  528  -LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM  352
             + D+DLFE+NEAFASQ  YC  KLGLD EK+NVNGGA+A+GHPLGATGARCVATL+HEM
Sbjct  338  SVADVDLFELNEAFASQATYCATKLGLDVEKVNVNGGAIALGHPLGATGARCVATLMHEM  397

Query  351  KRRGKDCRYGVVSMCIGTGMGAAGVFE  271
            +RRG   R GVVSMCIG+GMGAAGVFE
Sbjct  398  QRRG--ARNGVVSMCIGSGMGAAGVFE  422



>ref|XP_003061899.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53611.1| predicted protein [Micromonas pusilla CCMP1545]
Length=332

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG-L  532
            SQV+DGAG VLL  R+ A +  LPI+G F +FAAVGVDP VMGIGPAVAIP A+K AG L
Sbjct  185  SQVSDGAGCVLLASRAYAQRHNLPIMGTFVSFAAVGVDPIVMGIGPAVAIPEALKRAGNL  244

Query  531  ELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM  352
             +DD+DLFE+NEAFASQ  YC +KLGLD EK+NVNGGA+A+GHPLGATGARCVATL+HEM
Sbjct  245  SVDDVDLFELNEAFASQATYCAEKLGLDSEKVNVNGGAIALGHPLGATGARCVATLMHEM  304

Query  351  KRRGKDCRYGVVSMCIGTGMGAAGVFER  268
             RR  D   GVVSMCIG+GMGAAGVF R
Sbjct  305  HRRRSDV--GVVSMCIGSGMGAAGVFAR  330



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ TDGA AVL+M R  A ++GLP+L +FR+FAAVGV PA+MGIGP  AIP AV+ AGL 
Sbjct  283  SQTTDGAAAVLMMTRREARRRGLPVLAIFRSFAAVGVPPAIMGIGPVAAIPEAVRRAGLG  342

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDD+D+FEINEAFASQ LY  KKLGLD E++N NGGA+A+GHPLG TGAR  ATL++EM+
Sbjct  343  LDDVDVFEINEAFASQALYTVKKLGLDLERVNPNGGAIALGHPLGCTGARQAATLINEMQ  402

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVE-THGYLSK  205
            RRGK  R+GV+SMCIG+GMGAA V ER  + D   +AR     H  LS+
Sbjct  403  RRGKAARFGVISMCIGSGMGAAAVLERDFSDDAERSARPATGVHAGLSR  451



>ref|XP_010172441.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Caprimulgus 
carolinensis]
Length=272

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  124  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  183

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLLHE+K
Sbjct  184  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLHELK  243

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  244  RRGKRA-YGVVSMCIGTGMGAAAVFE  268



>ref|XP_004339798.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17785.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
Length=430

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA A ++ KRS+A + GLPI GVFR+FAAVGV+PAVMGIGPAVAIPAAV+ AG+ 
Sbjct  284  SQVSDGAAACIVTKRSVAQKLGLPIFGVFRSFAAVGVEPAVMGIGPAVAIPAAVQKAGIS  343

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L D+D++EINEAFASQ +YC +KLG+  EK+N NGGA+A+GHPLG TGAR  ATLL+E+K
Sbjct  344  LQDVDVYEINEAFASQAVYCVQKLGIPVEKVNPNGGAIALGHPLGCTGARQTATLLNELK  403

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGD  262
            RR  + R+GVVSMCIG+GMGAA V+ER +
Sbjct  404  RR--NARFGVVSMCIGSGMGAAAVYEREN  430



>ref|XP_010075883.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Pterocles 
gutturalis]
Length=367

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLPILGV R+FA VGV P VMGIGPA AIPAAV++AGL 
Sbjct  219  SQVSDGAAAVLLAKRSKAAQLGLPILGVLRSFAVVGVPPDVMGIGPAYAIPAAVENAGLT  278

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            LDDID+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  279  LDDIDVFEINEAFASQALYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  338

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VF+
Sbjct  339  RRGKRA-YGVVSMCIGTGMGAAAVFK  363



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 127/171 (74%), Gaps = 0/171 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQ TDGA AV+LM R  A ++GL ++GVFR+FAAVGV P +MGIGPA AIPAAVK AGL 
Sbjct  257  SQTTDGAAAVMLMTRREAQRRGLAVMGVFRSFAAVGVPPRIMGIGPAFAIPAAVKLAGLG  316

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            + D+D++EINEAFASQ  Y    L +DP K+N NGGA+A+GHPLG TGAR  ATLL+EM 
Sbjct  317  VQDVDVYEINEAFASQASYSVDTLKIDPAKVNPNGGAIALGHPLGCTGARQTATLLYEMA  376

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  196
            RRGK  R+GVVSMCIG+GMGAA VFER  + D  S A        LS DA+
Sbjct  377  RRGKTARFGVVSMCIGSGMGAAAVFEREGSEDRTSFAAPATARTGLSADAQ  427



>gb|ELU09588.1| hypothetical protein CAPTEDRAFT_229355 [Capitella teleta]
Length=428

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVL+ +RS A + GLPILGVFR+FA VGV P VMGIGPAVAIPAA+K AGL 
Sbjct  279  SQVSDGAAAVLMARRSAAKKHGLPILGVFRSFAVVGVPPDVMGIGPAVAIPAALKKAGLA  338

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            +DDID++EINEAFASQ  YC +KLG+  EK+N  GGA+A+GHPLG TGAR +ATLLHEMK
Sbjct  339  VDDIDVYEINEAFASQARYCVEKLGIPMEKVNPKGGAIALGHPLGCTGARQMATLLHEMK  398

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK    GV+SMCIGTGMGAA V E
Sbjct  399  RRGKKRSNGVISMCIGTGMGAAAVIE  424



>ref|XP_009505170.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Phalacrocorax 
carbo]
Length=272

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  124  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  183

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  184  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  243

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  244  RRGKRA-YGVVSMCIGTGMGAAAVFE  268



>gb|KFV08282.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Tauraco erythrolophus]
Length=369

 Score =   206 bits (525),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  221  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  280

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLLHE+K
Sbjct  281  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLHELK  340

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  341  RRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|EDL76925.1| rCG25918, isoform CRA_d [Rattus norvegicus]
Length=171

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL 
Sbjct  23   SQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLT  82

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DID+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  83   VNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  142

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRG+   YGVVSMCIGTGMGAA VFE
Sbjct  143  RRGRRA-YGVVSMCIGTGMGAAAVFE  167



>gb|KFW92214.1| 3-ketoacyl-CoA thiolase A, peroxisomal, partial [Phalacrocorax 
carbo]
Length=292

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  144  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  203

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  204  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  263

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  264  RRGKRA-YGVVSMCIGTGMGAAAVFE  288



>gb|KFW09333.1| 3-ketoacyl-CoA thiolase A, peroxisomal, partial [Fulmarus glacialis]
Length=367

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  219  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  278

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  279  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  338

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  339  RRGKRA-YGVVSMCIGTGMGAAAVFE  363



>gb|KFQ33519.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Merops nubicus]
Length=369

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL +RS A Q GLP+LGV R+FA VGV PAVMGIGPA AIPAAV+ AGL 
Sbjct  221  SQVSDGAAAVLLARRSKAAQLGLPVLGVLRSFAVVGVPPAVMGIGPAYAIPAAVEKAGLT  280

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TG R V TLL+E+K
Sbjct  281  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGTRQVVTLLNELK  340

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  341  RRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|EOA95880.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Anas platyrhynchos]
Length=369

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV ++FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  221  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLKSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  280

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  281  LNDIDIFEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  340

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  341  RRGKRA-YGVVSMCIGTGMGAAAVFE  365



>gb|EMC83181.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Columba livia]
Length=367

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAA++ AGL 
Sbjct  219  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAALEKAGLT  278

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL E+K
Sbjct  279  LNDIDIFEINEAFASQAMYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLSELK  338

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  339  RRGKRA-YGVVSMCIGTGMGAAAVFE  363



>gb|AAH26669.1| Acaa1a protein [Mus musculus]
 gb|EDL09237.1| mCG21883, isoform CRA_b [Mus musculus]
Length=171

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL +RS A + GLPILGV R++A VGV P VMGIGPA AIPAA++ AGL 
Sbjct  23   SQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLT  82

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  83   VNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  142

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRG+   YGVVSMCIGTGMGAA VFE
Sbjct  143  RRGRRA-YGVVSMCIGTGMGAAAVFE  167



>ref|XP_009941382.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Opisthocomus 
hoazin]
Length=356

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  208  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  267

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  268  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  327

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  328  RRGKRA-YGVVSMCIGTGMGAAAVFE  352



>gb|KFR17430.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Opisthocomus 
hoazin]
Length=367

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  219  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  278

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  279  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  338

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  339  RRGKRA-YGVVSMCIGTGMGAAAVFE  363



>ref|XP_008942616.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal, partial [Merops 
nubicus]
Length=375

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL +RS A Q GLP+LGV R+FA VGV PAVMGIGPA AIPAAV+ AGL 
Sbjct  227  SQVSDGAAAVLLARRSKAAQLGLPVLGVLRSFAVVGVPPAVMGIGPAYAIPAAVEKAGLT  286

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TG R V TLL+E+K
Sbjct  287  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGTRQVVTLLNELK  346

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  347  RRGKRA-YGVVSMCIGTGMGAAAVFE  371



>ref|XP_009975644.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Tauraco erythrolophus]
Length=396

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  248  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  307

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLLHE+K
Sbjct  308  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLHELK  367

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  368  RRGKRA-YGVVSMCIGTGMGAAAVFE  392



>gb|KFW01783.1| 3-ketoacyl-CoA thiolase B, peroxisomal, partial [Eurypyga helias]
Length=336

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  188  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  247

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  248  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  307

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  308  RRGKRA-YGVVSMCIGTGMGAAAVFE  332



>ref|XP_005027361.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like, partial 
[Anas platyrhynchos]
Length=379

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV ++FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  231  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLKSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  290

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  291  LNDIDIFEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  350

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  351  RRGKRA-YGVVSMCIGTGMGAAAVFE  375



>ref|XP_005424411.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Geospiza 
fortis]
Length=416

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIP AV+ AGL 
Sbjct  268  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPVAVEKAGLT  327

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLLHE+K
Sbjct  328  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLHELK  387

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  388  RRGKRA-YGVVSMCIGTGMGAAAVFE  412



>ref|XP_009963091.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Tyto alba]
Length=356

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  208  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  267

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  268  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  327

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRG+   YGVVSMCIGTGMGAA VFE
Sbjct  328  RRGRRA-YGVVSMCIGTGMGAAAVFE  352



>ref|XP_009580990.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Fulmarus glacialis]
Length=396

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAAV+ AGL 
Sbjct  248  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAAVEKAGLT  307

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID++EINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  308  LNDIDIYEINEAFASQAVYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  367

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  368  RRGKRA-YGVVSMCIGTGMGAAAVFE  392



>ref|XP_005849380.1| hypothetical protein CHLNCDRAFT_143854 [Chlorella variabilis]
 gb|EFN57278.1| hypothetical protein CHLNCDRAFT_143854 [Chlorella variabilis]
Length=453

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 120/148 (81%), Gaps = 3/148 (2%)
 Frame = -2

Query  705  QVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLEL  526
            Q TDGA AV+LM+R  A ++GLPIL   ++FAAVGV+PAVMGIGPAVAIPAA++ AGL  
Sbjct  297  QTTDGAAAVMLMRRGEAERRGLPILATLKSFAAVGVEPAVMGIGPAVAIPAALEKAGLSK  356

Query  525  DDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKR  346
            DDID+FE+NEAFASQ+ YC K+LGLD EK+N NGGA+A+GHP+G TGAR   TLLHEM R
Sbjct  357  DDIDVFELNEAFASQFAYCLKELGLDEEKVNPNGGAIALGHPIGCTGARQTVTLLHEMAR  416

Query  345  R---GKDCRYGVVSMCIGTGMGAAGVFE  271
            R   G+   YGVVSMC G+GMGAA VFE
Sbjct  417  RNSNGRGAHYGVVSMCTGSGMGAAAVFE  444



>ref|XP_005509181.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Columba 
livia]
Length=389

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL KRS A Q GLP+LGV R+FA VGV P VMGIGPA AIPAA++ AGL 
Sbjct  241  SQVSDGAAAVLLAKRSKAAQLGLPVLGVLRSFAVVGVPPDVMGIGPAYAIPAALEKAGLT  300

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            L+DID+FEINEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL E+K
Sbjct  301  LNDIDIFEINEAFASQAMYCVEKLGIPMEKVNPLGGAIALGHPLGCTGARQVVTLLSELK  360

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRGK   YGVVSMCIGTGMGAA VFE
Sbjct  361  RRGKRA-YGVVSMCIGTGMGAAAVFE  385



>gb|EDL76924.1| rCG25918, isoform CRA_c [Rattus norvegicus]
Length=272

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  708  SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  529
            SQV+DGA AVLL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL 
Sbjct  124  SQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLT  183

Query  528  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  349
            ++DID+FEINEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+K
Sbjct  184  VNDIDIFEINEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELK  243

Query  348  RRGKDCRYGVVSMCIGTGMGAAGVFE  271
            RRG+   YGVVSMCIGTGMGAA VFE
Sbjct  244  RRGRRA-YGVVSMCIGTGMGAAAVFE  268



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365