BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044M02

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618593.1|  PREDICTED: transcription factor bHLH122-like       172   8e-47   
ref|XP_009785469.1|  PREDICTED: transcription factor bHLH122-like       169   8e-46   Nicotiana sylvestris
emb|CBI16416.3|  unnamed protein product                                164   2e-45   Vitis vinifera
ref|XP_006365809.1|  PREDICTED: transcription factor bHLH128-like...    166   1e-44   Solanum tuberosum [potatoes]
ref|XP_010651262.1|  PREDICTED: transcription factor bHLH130-like...    165   2e-44   Vitis vinifera
ref|XP_009793127.1|  PREDICTED: uncharacterized protein LOC104240...    165   3e-44   Nicotiana sylvestris
ref|XP_009793126.1|  PREDICTED: uncharacterized protein LOC104240...    165   3e-44   Nicotiana sylvestris
ref|XP_009620427.1|  PREDICTED: uncharacterized protein LOC104112...    164   4e-44   Nicotiana tomentosiformis
ref|XP_010314674.1|  PREDICTED: transcription factor bHLH130-like       164   4e-44   Solanum lycopersicum
ref|XP_010651260.1|  PREDICTED: transcription factor bHLH130-like...    164   4e-44   Vitis vinifera
ref|XP_009620426.1|  PREDICTED: uncharacterized protein LOC104112...    164   4e-44   Nicotiana tomentosiformis
emb|CDP17403.1|  unnamed protein product                                164   7e-44   Coffea canephora [robusta coffee]
gb|KDO57266.1|  hypothetical protein CISIN_1g0180071mg                  156   4e-43   Citrus sinensis [apfelsine]
gb|KDO57265.1|  hypothetical protein CISIN_1g0180071mg                  156   5e-43   Citrus sinensis [apfelsine]
ref|XP_006490036.1|  PREDICTED: transcription factor bHLH130-like       158   2e-42   Citrus sinensis [apfelsine]
ref|XP_006421491.1|  hypothetical protein CICLE_v10005233mg             158   2e-42   Citrus clementina [clementine]
ref|XP_007014949.1|  DNA binding protein, putative isoform 1            159   3e-42   
ref|XP_007014950.1|  DNA binding protein, putative isoform 2            159   3e-42   
ref|XP_002513457.1|  DNA binding protein, putative                      159   3e-42   
ref|XP_007205257.1|  hypothetical protein PRUPE_ppa006295mg             159   4e-42   Prunus persica
ref|XP_011090494.1|  PREDICTED: transcription factor bHLH130-like       157   4e-42   Sesamum indicum [beniseed]
ref|XP_004295210.1|  PREDICTED: transcription factor bHLH122-like       158   9e-42   Fragaria vesca subsp. vesca
ref|XP_008219331.1|  PREDICTED: transcription factor bHLH130-like       157   1e-41   Prunus mume [ume]
ref|XP_011033269.1|  PREDICTED: transcription factor bHLH130-like       155   2e-41   Populus euphratica
ref|XP_010265785.1|  PREDICTED: transcription factor bHLH130-like...    157   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010265791.1|  PREDICTED: transcription factor bHLH130-like...    157   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010265790.1|  PREDICTED: transcription factor bHLH130-like...    157   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_002323299.2|  hypothetical protein POPTR_0016s05100g             155   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002532405.1|  DNA binding protein, putative                      154   5e-41   
ref|XP_006364245.1|  PREDICTED: transcription factor bHLH122-like       156   5e-41   Solanum tuberosum [potatoes]
gb|KJB55342.1|  hypothetical protein B456_009G071900                    156   5e-41   Gossypium raimondii
gb|AAL87667.1|  transcription factor RAU1                               148   7e-41   Oryza sativa [red rice]
gb|KHG02416.1|  Transcription factor protein                            154   8e-41   Gossypium arboreum [tree cotton]
gb|KHG06292.1|  Transcription factor protein                            155   9e-41   Gossypium arboreum [tree cotton]
ref|XP_011037862.1|  PREDICTED: transcription factor bHLH122-like...    155   1e-40   Populus euphratica
ref|XP_010091980.1|  hypothetical protein L484_007964                   155   1e-40   Morus notabilis
gb|KDP20187.1|  hypothetical protein JCGZ_07907                         154   2e-40   Jatropha curcas
emb|CDY47961.1|  BnaA04g24390D                                          153   2e-40   Brassica napus [oilseed rape]
ref|XP_008392106.1|  PREDICTED: transcription factor bHLH130-like       152   2e-40   Malus domestica [apple tree]
ref|XP_004250857.1|  PREDICTED: transcription factor bHLH81             154   2e-40   Solanum lycopersicum
ref|XP_009142051.1|  PREDICTED: transcription factor bHLH130-like       152   2e-40   Brassica rapa
gb|EYU46294.1|  hypothetical protein MIMGU_mgv1a008008mg                153   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_009345105.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    152   3e-40   
ref|XP_002881830.1|  basic helix-loop-helix family protein              152   3e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_008373739.1|  PREDICTED: transcription factor bHLH130-like       152   4e-40   
ref|NP_181757.2|  transcription factor bHLH130                          152   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KJB16402.1|  hypothetical protein B456_002G228900                    152   4e-40   Gossypium raimondii
ref|XP_009374647.1|  PREDICTED: transcription factor bHLH122-like...    153   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_009374670.1|  PREDICTED: transcription factor bHLH122-like...    153   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_008240817.1|  PREDICTED: transcription factor bHLH130-like       152   4e-40   Prunus mume [ume]
ref|XP_011037857.1|  PREDICTED: transcription factor bHLH122-like...    153   4e-40   Populus euphratica
ref|XP_010045000.1|  PREDICTED: transcription factor bHLH130-like       153   5e-40   Eucalyptus grandis [rose gum]
gb|AAB88652.1|  unknown protein                                         152   5e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CBI29901.3|  unnamed protein product                                149   6e-40   Vitis vinifera
ref|XP_003537954.1|  PREDICTED: transcription factor bHLH122-like...    152   7e-40   Glycine max [soybeans]
ref|XP_009379430.1|  PREDICTED: transcription factor bHLH130-like...    153   7e-40   Pyrus x bretschneideri [bai li]
ref|XP_009379429.1|  PREDICTED: transcription factor bHLH122-like...    153   7e-40   Pyrus x bretschneideri [bai li]
ref|XP_006660262.1|  PREDICTED: transcription factor bHLH130-like       148   7e-40   
ref|XP_010031833.1|  PREDICTED: transcription factor bHLH130-like...    152   8e-40   Eucalyptus grandis [rose gum]
ref|XP_011075183.1|  PREDICTED: transcription factor bHLH130-like       152   8e-40   Sesamum indicum [beniseed]
ref|XP_010057736.1|  PREDICTED: transcription factor bHLH130 isof...    152   8e-40   Eucalyptus grandis [rose gum]
ref|XP_010031832.1|  PREDICTED: transcription factor bHLH130-like...    152   8e-40   
ref|XP_010508597.1|  PREDICTED: transcription factor bHLH130-like...    151   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010057742.1|  PREDICTED: transcription factor bHLH130 isof...    152   9e-40   Eucalyptus grandis [rose gum]
gb|KFK37090.1|  hypothetical protein AALP_AA4G211900                    151   9e-40   Arabis alpina [alpine rockcress]
ref|XP_006294481.1|  hypothetical protein CARUB_v10023498mg             151   9e-40   Capsella rubella
ref|XP_010508598.1|  PREDICTED: transcription factor bHLH130-like...    151   9e-40   Camelina sativa [gold-of-pleasure]
emb|CDY53498.1|  BnaC04g02580D                                          150   9e-40   Brassica napus [oilseed rape]
ref|XP_006381041.1|  hypothetical protein POPTR_0006s05640g             151   9e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008384525.1|  PREDICTED: transcription factor bHLH130-like...    152   9e-40   
ref|XP_008384526.1|  PREDICTED: transcription factor bHLH130-like...    152   9e-40   
emb|CDX79884.1|  BnaA05g02720D                                          150   1e-39   
ref|XP_010031830.1|  PREDICTED: transcription factor bHLH130-like...    152   1e-39   
ref|XP_004136581.1|  PREDICTED: transcription factor bHLH130-like       151   1e-39   Cucumis sativus [cucumbers]
ref|XP_010506041.1|  PREDICTED: transcription factor bHLH130-like...    151   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009142816.1|  PREDICTED: transcription factor bHLH130-like       150   1e-39   Brassica rapa
ref|XP_008352417.1|  PREDICTED: transcription factor bHLH130-like...    152   1e-39   
ref|XP_010506040.1|  PREDICTED: transcription factor bHLH130-like...    151   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007203321.1|  hypothetical protein PRUPE_ppa019977mg             150   1e-39   
ref|XP_008352410.1|  PREDICTED: transcription factor bHLH122-like...    152   1e-39   
ref|XP_008443086.1|  PREDICTED: transcription factor bHLH130            151   1e-39   Cucumis melo [Oriental melon]
emb|CDY14822.1|  BnaC04g48190D                                          150   1e-39   Brassica napus [oilseed rape]
ref|XP_010517743.1|  PREDICTED: transcription factor bHLH130 isof...    151   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010111430.1|  hypothetical protein L484_028088                   150   1e-39   Morus notabilis
ref|XP_010517744.1|  PREDICTED: transcription factor bHLH130 isof...    150   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_007028921.1|  Basic helix-loop-helix DNA-binding superfami...    152   1e-39   
gb|KJB36082.1|  hypothetical protein B456_006G140200                    150   2e-39   Gossypium raimondii
ref|XP_010673593.1|  PREDICTED: transcription factor bHLH130            152   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006411489.1|  hypothetical protein EUTSA_v10016847mg             150   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_007014952.1|  Basic helix-loop-helix DNA-binding superfami...    146   2e-39   
ref|XP_009769873.1|  PREDICTED: transcription factor bHLH130-like...    147   2e-39   Nicotiana sylvestris
gb|EYU39897.1|  hypothetical protein MIMGU_mgv1a025138mg                149   3e-39   Erythranthe guttata [common monkey flower]
ref|XP_004304314.1|  PREDICTED: transcription factor bHLH130            149   3e-39   Fragaria vesca subsp. vesca
emb|CBI24857.3|  unnamed protein product                                147   3e-39   Vitis vinifera
ref|XP_010257364.1|  PREDICTED: transcription factor bHLH130-like       151   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_006493662.1|  PREDICTED: transcription factor bHLH122-like...    150   4e-39   Citrus sinensis [apfelsine]
ref|XP_010928471.1|  PREDICTED: transcription factor bHLH130-like       151   4e-39   Elaeis guineensis
ref|XP_006446031.1|  hypothetical protein CICLE_v10015437mg             150   4e-39   
emb|CAN62935.1|  hypothetical protein VITISV_008845                     150   4e-39   Vitis vinifera
tpg|DAA40391.1|  TPA: putative HLH DNA-binding domain superfamily...    146   5e-39   
ref|XP_002277274.1|  PREDICTED: transcription factor bHLH130-like       150   5e-39   Vitis vinifera
ref|XP_003592465.1|  Transcription factor bHLH130                       150   5e-39   
ref|XP_011020282.1|  PREDICTED: transcription factor bHLH130-like       148   5e-39   Populus euphratica
ref|XP_010554850.1|  PREDICTED: transcription factor bHLH130-like...    149   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_011080320.1|  PREDICTED: transcription factor bHLH130-like       150   5e-39   Sesamum indicum [beniseed]
ref|XP_009769857.1|  PREDICTED: transcription factor bHLH130-like...    149   5e-39   Nicotiana sylvestris
ref|XP_011042059.1|  PREDICTED: transcription factor bHLH122-like...    150   6e-39   Populus euphratica
gb|EMT21364.1|  Transcription factor bHLH130                            145   8e-39   
gb|EAZ07555.1|  hypothetical protein OsI_29809                          149   8e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001062190.1|  Os08g0506700                                       149   9e-39   
ref|XP_004229606.1|  PREDICTED: transcription factor bHLH130-like       149   9e-39   Solanum lycopersicum
emb|CDP07732.1|  unnamed protein product                                147   9e-39   Coffea canephora [robusta coffee]
ref|XP_003540708.1|  PREDICTED: transcription factor bHLH122-like...    149   1e-38   Glycine max [soybeans]
gb|KHG25713.1|  Transcription factor protein                            148   1e-38   Gossypium arboreum [tree cotton]
ref|XP_003633592.1|  PREDICTED: transcription factor bHLH130-like       149   1e-38   Vitis vinifera
ref|XP_002304761.1|  basic helix-loop-helix family protein              149   1e-38   Populus trichocarpa [western balsam poplar]
gb|EPS67038.1|  hypothetical protein M569_07739                         140   1e-38   Genlisea aurea
gb|KDO83349.1|  hypothetical protein CISIN_1g0166382mg                  142   1e-38   Citrus sinensis [apfelsine]
ref|XP_007131988.1|  hypothetical protein PHAVU_011G057400g             149   2e-38   Phaseolus vulgaris [French bean]
ref|XP_009591240.1|  PREDICTED: transcription factor bHLH130-like...    144   2e-38   Nicotiana tomentosiformis
ref|XP_011037864.1|  PREDICTED: transcription factor bHLH122-like...    148   2e-38   Populus euphratica
ref|XP_009383216.1|  PREDICTED: transcription factor bHLH130-like...    148   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008450446.1|  PREDICTED: transcription factor bHLH122 isof...    149   2e-38   Cucumis melo [Oriental melon]
ref|XP_008450443.1|  PREDICTED: transcription factor bHLH122 isof...    149   3e-38   Cucumis melo [Oriental melon]
ref|XP_011037863.1|  PREDICTED: transcription factor bHLH122-like...    148   3e-38   Populus euphratica
gb|KDP37364.1|  hypothetical protein JCGZ_06818                         147   3e-38   Jatropha curcas
ref|XP_004139111.1|  PREDICTED: transcription factor bHLH122-like       148   3e-38   Cucumis sativus [cucumbers]
ref|XP_009401509.1|  PREDICTED: transcription factor bHLH130-like       148   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004170093.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    148   3e-38   
gb|KHN30254.1|  Transcription factor bHLH130                            147   3e-38   Glycine soja [wild soybean]
ref|XP_011042060.1|  PREDICTED: transcription factor bHLH122-like...    148   3e-38   Populus euphratica
ref|XP_011042057.1|  PREDICTED: transcription factor bHLH122-like...    148   4e-38   Populus euphratica
ref|XP_003537191.1|  PREDICTED: transcription factor bHLH130-like       147   4e-38   Glycine max [soybeans]
ref|XP_003547061.1|  PREDICTED: transcription factor bHLH122-like...    148   4e-38   Glycine max [soybeans]
gb|KHN30120.1|  Transcription factor bHLH122                            147   4e-38   Glycine soja [wild soybean]
gb|KHN33332.1|  Transcription factor bHLH122                            147   4e-38   Glycine soja [wild soybean]
ref|XP_003543549.1|  PREDICTED: transcription factor bHLH122            147   5e-38   Glycine max [soybeans]
ref|XP_009757642.1|  PREDICTED: transcription factor bHLH130-like       147   5e-38   Nicotiana sylvestris
ref|XP_008670282.1|  PREDICTED: transcription factor bHLH130-like       147   5e-38   Zea mays [maize]
ref|XP_008795725.1|  PREDICTED: transcription factor bHLH130-like       148   5e-38   Phoenix dactylifera
gb|KDP43444.1|  hypothetical protein JCGZ_16731                         147   6e-38   Jatropha curcas
ref|XP_007145653.1|  hypothetical protein PHAVU_007G257100g             146   9e-38   Phaseolus vulgaris [French bean]
ref|XP_004497939.1|  PREDICTED: transcription factor bHLH130-like       146   9e-38   
ref|XP_009591238.1|  PREDICTED: transcription factor bHLH130-like...    145   9e-38   Nicotiana tomentosiformis
ref|XP_010672727.1|  PREDICTED: transcription factor bHLH130            144   1e-37   
ref|XP_006351215.1|  PREDICTED: transcription factor bHLH130-like       145   1e-37   
ref|NP_001151233.1|  helix-loop-helix DNA-binding domain containi...    146   1e-37   Zea mays [maize]
dbj|BAJ85853.1|  predicted protein                                      146   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003574744.1|  PREDICTED: transcription factor bHLH130-like       145   1e-37   Brachypodium distachyon [annual false brome]
gb|KEH41576.1|  transcription factor bHLH122-like protein               145   1e-37   Medicago truncatula
emb|CDY22828.1|  BnaA06g02490D                                          145   2e-37   Brassica napus [oilseed rape]
ref|XP_010461947.1|  PREDICTED: transcription factor bHLH122-like       145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010500685.1|  PREDICTED: transcription factor bHLH122-like       145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009391823.1|  PREDICTED: transcription factor bHLH130-like       145   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002894296.1|  basic helix-loop-helix family protein              145   2e-37   
ref|XP_004249190.1|  PREDICTED: transcription factor bHLH130-like       145   3e-37   Solanum lycopersicum
ref|NP_564583.1|  transcription factor bHLH122                          145   3e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10093.1|  unnamed protein product                                145   3e-37   Coffea canephora [robusta coffee]
ref|XP_004973867.1|  PREDICTED: transcription factor bHLH130-like       144   3e-37   Setaria italica
ref|XP_009768432.1|  PREDICTED: transcription factor bHLH130-like       144   3e-37   Nicotiana sylvestris
ref|XP_008776552.1|  PREDICTED: transcription factor bHLH130-like       145   3e-37   Phoenix dactylifera
ref|XP_010479574.1|  PREDICTED: transcription factor bHLH122-like       144   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004486946.1|  PREDICTED: transcription factor bHLH122-like       145   4e-37   Cicer arietinum [garbanzo]
ref|XP_011087339.1|  PREDICTED: transcription factor bHLH130-like       145   4e-37   Sesamum indicum [beniseed]
ref|XP_003519049.1|  PREDICTED: transcription factor bHLH130-like       144   4e-37   Glycine max [soybeans]
ref|XP_010524295.1|  PREDICTED: transcription factor bHLH130            144   5e-37   Tarenaya hassleriana [spider flower]
emb|CDY25213.1|  BnaC06g04380D                                          144   5e-37   Brassica napus [oilseed rape]
emb|CBI39322.3|  unnamed protein product                                139   5e-37   Vitis vinifera
ref|XP_009147780.1|  PREDICTED: transcription factor bHLH122            144   6e-37   Brassica rapa
ref|XP_010913124.1|  PREDICTED: transcription factor bHLH130-like       145   6e-37   Elaeis guineensis
ref|XP_007052582.1|  Basic helix-loop-helix DNA-binding superfami...    145   6e-37   
ref|XP_004957179.1|  PREDICTED: transcription factor bHLH130-like...    144   7e-37   Setaria italica
ref|XP_006393076.1|  hypothetical protein EUTSA_v10011463mg             145   8e-37   
gb|EAZ45183.1|  hypothetical protein OsJ_29826                          143   9e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009419180.1|  PREDICTED: transcription factor bHLH130-like...    144   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001063529.1|  Os09g0487900                                       144   1e-36   
gb|EPS68391.1|  hypothetical protein M569_06378                         135   1e-36   Genlisea aurea
ref|XP_009419179.1|  PREDICTED: transcription factor bHLH130-like...    144   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ09563.1|  hypothetical protein OsI_31842                          144   1e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_010554849.1|  PREDICTED: transcription factor bHLH130-like...    143   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_002445905.1|  hypothetical protein SORBIDRAFT_07g027810          143   1e-36   
ref|XP_004957993.1|  PREDICTED: transcription factor bHLH130-like...    143   2e-36   Setaria italica
ref|XP_010547953.1|  PREDICTED: transcription factor bHLH130-like       142   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_002314023.1|  basic helix-loop-helix family protein              143   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_006305091.1|  hypothetical protein CARUB_v10009458mg             142   2e-36   Capsella rubella
ref|XP_011007348.1|  PREDICTED: transcription factor bHLH130-like       143   2e-36   Populus euphratica
ref|NP_001147910.1|  DNA binding protein                                142   2e-36   
ref|XP_008672522.1|  PREDICTED: uncharacterized protein LOC100279...    142   2e-36   
ref|XP_006482911.1|  PREDICTED: transcription factor bHLH130-like...    143   2e-36   Citrus sinensis [apfelsine]
tpg|DAA47963.1|  TPA: putative HLH DNA-binding domain superfamily...    140   3e-36   
ref|XP_006438974.1|  hypothetical protein CICLE_v10031622mg             143   3e-36   Citrus clementina [clementine]
ref|XP_007014951.1|  DNA binding protein, putative isoform 3            143   3e-36   
ref|XP_009590362.1|  PREDICTED: transcription factor bHLH130-like       142   3e-36   Nicotiana tomentosiformis
dbj|BAK02702.1|  predicted protein                                      142   3e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002271390.1|  PREDICTED: transcription factor bHLH80-like ...    139   4e-36   Vitis vinifera
ref|XP_009612393.1|  PREDICTED: transcription factor bHLH130-like       142   5e-36   Nicotiana tomentosiformis
ref|XP_004957991.1|  PREDICTED: transcription factor bHLH130-like...    142   5e-36   
emb|CAN80884.1|  hypothetical protein VITISV_018653                     142   5e-36   Vitis vinifera
ref|XP_002513187.1|  DNA binding protein, putative                      142   5e-36   
ref|XP_010536057.1|  PREDICTED: transcription factor bHLH122            140   6e-36   
ref|XP_003597460.1|  Transcription factor bHLH122                       142   7e-36   Medicago truncatula
ref|XP_010238294.1|  PREDICTED: transcription factor bHLH130-like       141   8e-36   Brachypodium distachyon [annual false brome]
ref|XP_004308213.1|  PREDICTED: transcription factor bHLH130-like       142   9e-36   Fragaria vesca subsp. vesca
ref|XP_010242689.1|  PREDICTED: transcription factor bHLH80             138   9e-36   Nelumbo nucifera [Indian lotus]
ref|XP_007020097.1|  Basic helix-loop-helix DNA-binding superfami...    138   9e-36   
ref|NP_001148741.1|  DNA binding protein                                140   1e-35   Zea mays [maize]
ref|XP_008670486.1|  PREDICTED: transcription factor bHLH130-like...    140   1e-35   Zea mays [maize]
ref|XP_008670485.1|  PREDICTED: transcription factor bHLH130-like...    140   1e-35   Zea mays [maize]
gb|AEJ88333.1|  putative MYC protein                                    134   2e-35   Tamarix hispida
ref|XP_008678810.1|  PREDICTED: transcription factor bHLH130-like       133   2e-35   Zea mays [maize]
gb|KDP35099.1|  hypothetical protein JCGZ_10941                         137   3e-35   Jatropha curcas
ref|XP_008651450.1|  PREDICTED: DNA binding protein isoform X3          140   3e-35   Zea mays [maize]
gb|KHM98826.1|  Transcription factor bHLH80                             134   3e-35   Glycine soja [wild soybean]
ref|XP_003521194.1|  PREDICTED: transcription factor bHLH130-like...    139   3e-35   Glycine max [soybeans]
ref|NP_001236464.1|  uncharacterized protein LOC100527723               134   4e-35   Glycine max [soybeans]
ref|XP_008651448.1|  PREDICTED: DNA binding protein isoform X2          140   5e-35   Zea mays [maize]
ref|XP_011031495.1|  PREDICTED: transcription factor bHLH80-like ...    136   6e-35   Populus euphratica
ref|XP_011031494.1|  PREDICTED: transcription factor bHLH81-like ...    136   8e-35   Populus euphratica
ref|XP_006303282.1|  hypothetical protein CARUB_v10010050mg             135   9e-35   Capsella rubella
gb|KJB78402.1|  hypothetical protein B456_013G138300                    135   1e-34   Gossypium raimondii
gb|KHG15625.1|  Transcription factor bHLH80 -like protein               135   1e-34   Gossypium arboreum [tree cotton]
gb|KJB22217.1|  hypothetical protein B456_004G035800                    137   1e-34   Gossypium raimondii
gb|ACM41587.1|  bHLH transcription factor MYC4                          135   1e-34   Catharanthus roseus [chatas]
gb|KHG20926.1|  Transcription factor protein                            137   2e-34   Gossypium arboreum [tree cotton]
ref|XP_007227574.1|  hypothetical protein PRUPE_ppa011017mg             134   2e-34   Prunus persica
gb|KJB22219.1|  hypothetical protein B456_004G035800                    135   2e-34   Gossypium raimondii
ref|XP_008219008.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    134   2e-34   Prunus mume [ume]
ref|XP_009788006.1|  PREDICTED: transcription factor bHLH80-like ...    134   2e-34   Nicotiana sylvestris
ref|XP_006434678.1|  hypothetical protein CICLE_v10002083mg             134   2e-34   Citrus clementina [clementine]
emb|CDY69278.1|  BnaCnng62790D                                          134   2e-34   Brassica napus [oilseed rape]
ref|XP_006473253.1|  PREDICTED: transcription factor bHLH80-like        134   2e-34   Citrus sinensis [apfelsine]
ref|XP_011001080.1|  PREDICTED: transcription factor bHLH80-like ...    134   2e-34   Populus euphratica
ref|XP_006356502.1|  PREDICTED: transcription factor bHLH81-like ...    134   3e-34   Solanum tuberosum [potatoes]
ref|NP_174776.1|  protein FLOWERING BHLH 1                              134   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008231356.1|  PREDICTED: transcription factor bHLH130-like       137   3e-34   Prunus mume [ume]
ref|XP_010543658.1|  PREDICTED: transcription factor bHLH81             134   3e-34   Tarenaya hassleriana [spider flower]
gb|AAF04760.1|AF103808_1  helix-loop-helix protein 1A                   138   4e-34   Pinus taeda
ref|XP_004241842.1|  PREDICTED: transcription factor bHLH81-like        134   4e-34   
ref|XP_010682704.1|  PREDICTED: transcription factor bHLH81-like        134   5e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009379414.1|  PREDICTED: transcription factor bHLH80 isofo...    133   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_008459678.1|  PREDICTED: transcription factor bHLH80 isofo...    133   6e-34   Cucumis melo [Oriental melon]
ref|XP_004141566.1|  PREDICTED: transcription factor bHLH80-like        133   6e-34   Cucumis sativus [cucumbers]
ref|XP_007162279.1|  hypothetical protein PHAVU_001G138600g             136   7e-34   Phaseolus vulgaris [French bean]
ref|XP_009107915.1|  PREDICTED: transcription factor bHLH80-like        132   9e-34   Brassica rapa
emb|CDX91761.1|  BnaC08g06800D                                          132   9e-34   
ref|XP_009605833.1|  PREDICTED: transcription factor bHLH80-like ...    132   1e-33   Nicotiana tomentosiformis
ref|XP_008361617.1|  PREDICTED: transcription factor bHLH80-like        132   1e-33   Malus domestica [apple tree]
emb|CDY41870.1|  BnaA08g06290D                                          132   1e-33   Brassica napus [oilseed rape]
ref|XP_010478939.1|  PREDICTED: transcription factor bHLH80-like        132   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009383213.1|  PREDICTED: transcription factor bHLH130-like...    136   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010500031.1|  PREDICTED: transcription factor bHLH80-like        132   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_009362436.1|  PREDICTED: transcription factor bHLH80-like        131   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_009379422.1|  PREDICTED: transcription factor bHLH80 isofo...    131   2e-33   
gb|KFK27804.1|  hypothetical protein AALP_AA8G431300                    132   2e-33   Arabis alpina [alpine rockcress]
ref|XP_009145131.1|  PREDICTED: transcription factor bHLH80-like        132   2e-33   Brassica rapa
gb|KJB36084.1|  hypothetical protein B456_006G140200                    134   2e-33   Gossypium raimondii
ref|XP_004493549.1|  PREDICTED: transcription factor bHLH130-like...    132   3e-33   Cicer arietinum [garbanzo]
ref|XP_002891184.1|  basic helix-loop-helix family protein              131   3e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_007218046.1|  hypothetical protein PRUPE_ppa006134mg             134   3e-33   Prunus persica
ref|XP_010461311.1|  PREDICTED: transcription factor bHLH80-like        131   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004507114.1|  PREDICTED: transcription factor bHLH122-like       134   4e-33   
emb|CDY61281.1|  BnaCnng37600D                                          130   5e-33   Brassica napus [oilseed rape]
ref|XP_009114710.1|  PREDICTED: transcription factor bHLH80             130   5e-33   Brassica rapa
ref|XP_004970931.1|  PREDICTED: transcription factor bHLH128-like       132   6e-33   Setaria italica
ref|XP_010067890.1|  PREDICTED: transcription factor bHLH130-like       133   6e-33   Eucalyptus grandis [rose gum]
emb|CDP10678.1|  unnamed protein product                                130   8e-33   Coffea canephora [robusta coffee]
gb|AGV54554.1|  transcription factor bHLH130-like protein               129   1e-32   Phaseolus vulgaris [French bean]
gb|EEE55825.1|  hypothetical protein OsJ_04431                          127   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008356731.1|  PREDICTED: transcription factor bHLH130-like       133   1e-32   
ref|XP_011075032.1|  PREDICTED: transcription factor bHLH80             129   1e-32   Sesamum indicum [beniseed]
ref|XP_003625199.1|  Transcription factor bHLH130                       131   1e-32   Medicago truncatula
ref|XP_004957992.1|  PREDICTED: transcription factor bHLH130-like...    132   2e-32   
gb|AFK46844.1|  unknown                                                 128   2e-32   Medicago truncatula
ref|XP_009354701.1|  PREDICTED: transcription factor bHLH130-like       132   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_010275943.1|  PREDICTED: transcription factor bHLH128-like       131   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002298446.1|  hypothetical protein POPTR_0001s27680g             132   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010665392.1|  PREDICTED: transcription factor bHLH80-like ...    129   2e-32   Vitis vinifera
ref|XP_010525742.1|  PREDICTED: transcription factor bHLH129-like       126   2e-32   
ref|XP_010665393.1|  PREDICTED: transcription factor bHLH80-like ...    128   3e-32   Vitis vinifera
ref|XP_007131294.1|  hypothetical protein PHAVU_011G001800g             127   3e-32   
tpg|DAA41105.1|  TPA: putative HLH DNA-binding domain superfamily...    131   3e-32   
ref|XP_004957989.1|  PREDICTED: transcription factor bHLH130-like...    132   3e-32   
ref|XP_003531430.1|  PREDICTED: transcription factor bHLH130-like       132   3e-32   
gb|KDO83350.1|  hypothetical protein CISIN_1g0166382mg                  125   4e-32   
ref|XP_008672511.1|  PREDICTED: uncharacterized protein LOC100279...    131   4e-32   
gb|KHN29208.1|  Transcription factor bHLH130                            132   4e-32   
dbj|BAB90521.1|  B1065G12.3                                             128   4e-32   
ref|XP_011093536.1|  PREDICTED: transcription factor bHLH130-like       131   4e-32   
ref|XP_009365015.1|  PREDICTED: transcription factor bHLH130-like       131   5e-32   
ref|XP_010547248.1|  PREDICTED: transcription factor bHLH130-like...    130   5e-32   
ref|XP_009414668.1|  PREDICTED: transcription factor bHLH128-like...    130   5e-32   
ref|XP_002987119.1|  hypothetical protein SELMODRAFT_28264              123   5e-32   
ref|XP_006397195.1|  hypothetical protein EUTSA_v10028883mg             128   5e-32   
ref|XP_011025049.1|  PREDICTED: transcription factor bHLH130-like       131   5e-32   
ref|XP_009414667.1|  PREDICTED: transcription factor bHLH128-like...    130   5e-32   
gb|KHN25262.1|  Transcription factor bHLH122                            131   6e-32   
ref|XP_002456792.1|  hypothetical protein SORBIDRAFT_03g042860          130   6e-32   
ref|XP_006288460.1|  hypothetical protein CARUB_v10001721mg             128   8e-32   
ref|XP_010547247.1|  PREDICTED: transcription factor bHLH130-like...    130   8e-32   
dbj|BAK00285.1|  predicted protein                                      130   9e-32   
ref|XP_003564851.1|  PREDICTED: transcription factor bHLH128-like       130   9e-32   
ref|XP_010102628.1|  hypothetical protein L484_010917                   129   9e-32   
tpg|DAA56312.1|  TPA: putative HLH DNA-binding domain superfamily...    127   1e-31   
ref|XP_009410327.1|  PREDICTED: transcription factor bHLH130-like       130   1e-31   
gb|EYU27082.1|  hypothetical protein MIMGU_mgv1a020283mg                130   1e-31   
ref|NP_192657.1|  protein FLOWERING BHLH 2                              127   1e-31   
ref|XP_002872439.1|  basic helix-loop-helix family protein              127   1e-31   
ref|XP_006646568.1|  PREDICTED: transcription factor bHLH128-like       126   1e-31   
emb|CDM85278.1|  unnamed protein product                                129   1e-31   
gb|KFK32082.1|  hypothetical protein AALP_AA6G197200                    127   2e-31   
ref|NP_001150862.1|  LOC100284495                                       129   2e-31   
gb|KEH39468.1|  transcription factor bHLH122-like protein               129   2e-31   
gb|KEH30251.1|  transcription factor bHLH122-like protein               129   2e-31   
emb|CAE01659.2|  OSJNBa0084K20.3                                        125   3e-31   
gb|AGV54757.1|  transcription factor bHLH130-like protein               129   3e-31   
ref|XP_010524125.1|  PREDICTED: transcription factor bHLH129-like       128   3e-31   
ref|XP_008783787.1|  PREDICTED: transcription factor bHLH129-like...    128   3e-31   
ref|XP_008783788.1|  PREDICTED: transcription factor bHLH129-like...    128   3e-31   
gb|EYU28223.1|  hypothetical protein MIMGU_mgv1a013010mg                125   3e-31   
ref|XP_007149053.1|  hypothetical protein PHAVU_005G036900g             129   4e-31   
gb|ADX60271.1|  bHLH transcription factor                               128   4e-31   
ref|NP_001045106.1|  Os01g0900800                                       128   4e-31   
ref|XP_009420274.1|  PREDICTED: transcription factor bHLH128-like       127   4e-31   
ref|XP_011464756.1|  PREDICTED: transcription factor bHLH80-like        125   5e-31   
ref|XP_010421839.1|  PREDICTED: transcription factor bHLH81             125   5e-31   
ref|XP_010930150.1|  PREDICTED: transcription factor bHLH129-like...    128   5e-31   
ref|XP_010930149.1|  PREDICTED: transcription factor bHLH129-like...    128   5e-31   
ref|XP_007020096.1|  Basic helix-loop-helix DNA-binding superfami...    126   5e-31   
ref|XP_010435842.1|  PREDICTED: transcription factor bHLH81             125   5e-31   
ref|XP_008461268.1|  PREDICTED: transcription factor bHLH130-like...    128   5e-31   
ref|XP_008461266.1|  PREDICTED: transcription factor bHLH130-like...    128   6e-31   
ref|XP_003599090.1|  DNA binding protein                                128   7e-31   
gb|AFK39982.1|  unknown                                                 127   7e-31   
gb|AES69341.2|  transcription factor bHLH122-like protein               127   7e-31   
ref|XP_004135915.1|  PREDICTED: transcription factor bHLH130-like       127   8e-31   
ref|XP_008672964.1|  PREDICTED: LOC100284495 isoform X1                 127   8e-31   
ref|XP_004515594.1|  PREDICTED: transcription factor bHLH130-like       127   9e-31   
ref|XP_002448088.1|  hypothetical protein SORBIDRAFT_06g020810          124   1e-30   
ref|XP_003539646.1|  PREDICTED: transcription factor bHLH130-like       127   1e-30   
gb|EEE57326.1|  hypothetical protein OsJ_07428                          120   1e-30   
ref|XP_010912827.1|  PREDICTED: transcription factor bHLH128            126   1e-30   
ref|XP_006653553.1|  PREDICTED: transcription factor bHLH128-like       126   1e-30   
ref|NP_001053158.1|  Os04g0489600                                       126   1e-30   
ref|XP_009412679.1|  PREDICTED: transcription factor bHLH128-like       125   2e-30   
gb|AFW58662.1|  putative HLH DNA-binding domain superfamily protein     123   2e-30   
gb|KJB22216.1|  hypothetical protein B456_004G035800                    125   2e-30   
ref|XP_006434680.1|  hypothetical protein CICLE_v10002083mg             125   2e-30   
ref|XP_011001081.1|  PREDICTED: transcription factor bHLH81-like ...    124   2e-30   
gb|KDO84015.1|  hypothetical protein CISIN_1g023215mg                   124   2e-30   
ref|XP_006434679.1|  hypothetical protein CICLE_v10002083mg             124   2e-30   
ref|XP_010095898.1|  hypothetical protein L484_008295                   125   2e-30   
gb|KDO84018.1|  hypothetical protein CISIN_1g023215mg                   124   2e-30   
ref|XP_010555784.1|  PREDICTED: transcription factor bHLH129-like       122   3e-30   
ref|XP_006859176.1|  hypothetical protein AMTR_s00070p00149100          124   3e-30   
gb|KDO84016.1|  hypothetical protein CISIN_1g023215mg                   124   3e-30   
ref|XP_006648820.1|  PREDICTED: transcription factor bHLH128-like       122   3e-30   
ref|XP_003542860.1|  PREDICTED: transcription factor bHLH130 isof...    126   3e-30   
gb|KHN37607.1|  Transcription factor bHLH130                            126   3e-30   
ref|XP_006594420.1|  PREDICTED: transcription factor bHLH130 isof...    126   3e-30   
ref|XP_010557784.1|  PREDICTED: transcription factor bHLH130-like       125   3e-30   
gb|EPS70639.1|  hypothetical protein M569_04124                         119   4e-30   
ref|XP_010455333.1|  PREDICTED: transcription factor bHLH81-like        123   4e-30   
ref|XP_010522215.1|  PREDICTED: transcription factor bHLH128            124   5e-30   
gb|EEC73551.1|  hypothetical protein OsI_07971                          122   5e-30   
ref|XP_009142915.1|  PREDICTED: transcription factor bHLH129            124   6e-30   
ref|XP_009605832.1|  PREDICTED: transcription factor bHLH80-like ...    122   6e-30   
ref|XP_006411590.1|  hypothetical protein EUTSA_v10016998mg             123   7e-30   
ref|XP_008663340.1|  PREDICTED: transcription factor bHLH129-like...    124   9e-30   
ref|XP_006411589.1|  hypothetical protein EUTSA_v10016998mg             123   9e-30   
gb|KJB71849.1|  hypothetical protein B456_011G144600                    124   1e-29   
gb|KHG21813.1|  Transcription factor protein                            124   1e-29   
gb|KCW87821.1|  hypothetical protein EUGRSUZ_A00213                     124   1e-29   
ref|XP_010054365.1|  PREDICTED: transcription factor bHLH128 isof...    124   1e-29   
ref|XP_010054309.1|  PREDICTED: transcription factor bHLH128 isof...    124   1e-29   
ref|XP_010666767.1|  PREDICTED: transcription factor bHLH128-like...    120   1e-29   
gb|AFK48367.1|  unknown                                                 121   1e-29   
gb|KEH39469.1|  transcription factor bHLH122-like protein               124   2e-29   
emb|CDY17944.1|  BnaC04g02750D                                          122   2e-29   
ref|XP_009379411.1|  PREDICTED: transcription factor bHLH80 isofo...    121   2e-29   
ref|XP_004978091.1|  PREDICTED: transcription factor bHLH128-like       123   2e-29   
ref|XP_004152076.1|  PREDICTED: transcription factor bHLH128-like       123   2e-29   
ref|XP_008454477.1|  PREDICTED: transcription factor bHLH128            123   2e-29   
ref|XP_010666766.1|  PREDICTED: transcription factor bHLH128-like...    123   2e-29   
ref|XP_003554190.1|  PREDICTED: transcription factor bHLH130-like...    123   3e-29   
emb|CDP10335.1|  unnamed protein product                                123   3e-29   
ref|XP_003556577.1|  PREDICTED: transcription factor bHLH128-like       121   3e-29   
ref|XP_002527387.1|  DNA binding protein, putative                      123   3e-29   
ref|XP_002976209.1|  hypothetical protein SELMODRAFT_443113             124   3e-29   
gb|KHN27140.1|  Transcription factor bHLH128                            121   3e-29   
ref|XP_006294646.1|  hypothetical protein CARUB_v10023683mg             122   4e-29   
gb|KDP42876.1|  hypothetical protein JCGZ_23818                         122   4e-29   
ref|XP_003592849.1|  Transcription factor bHLH128                       122   4e-29   
ref|XP_001766320.1|  predicted protein                                  117   4e-29   
ref|XP_010517868.1|  PREDICTED: transcription factor bHLH129-like       121   5e-29   
ref|XP_010508466.1|  PREDICTED: transcription factor bHLH129-like       121   5e-29   
ref|XP_010506174.1|  PREDICTED: transcription factor bHLH129-like...    121   5e-29   
ref|XP_004497415.1|  PREDICTED: transcription factor bHLH129-like...    121   5e-29   
gb|KEH29302.1|  transcription factor                                    118   6e-29   
ref|XP_002452412.1|  hypothetical protein SORBIDRAFT_04g025260          121   6e-29   
ref|XP_007133842.1|  hypothetical protein PHAVU_011G213500g             122   6e-29   
ref|XP_011084160.1|  PREDICTED: transcription factor bHLH128-like       118   7e-29   
ref|XP_010650469.1|  PREDICTED: transcription factor bHLH128 isof...    121   9e-29   
ref|XP_009339879.1|  PREDICTED: transcription factor bHLH128            121   9e-29   
ref|XP_008645902.1|  PREDICTED: transcription factor bHLH128-like       120   1e-28   
ref|XP_008791728.1|  PREDICTED: transcription factor bHLH128 isof...    121   1e-28   
ref|XP_004296710.1|  PREDICTED: transcription factor bHLH128 isof...    121   1e-28   
gb|EMT27513.1|  Transcription factor bHLH128                            119   1e-28   
ref|XP_008461269.1|  PREDICTED: transcription factor bHLH130-like...    121   1e-28   
emb|CDY42800.1|  BnaC03g24060D                                          117   1e-28   
ref|XP_008380690.1|  PREDICTED: transcription factor bHLH128            121   1e-28   
ref|XP_006366720.1|  PREDICTED: transcription factor bHLH128-like...    120   1e-28   
emb|CBI39159.3|  unnamed protein product                                121   2e-28   
ref|XP_006366721.1|  PREDICTED: transcription factor bHLH128-like...    120   2e-28   
ref|XP_007142611.1|  hypothetical protein PHAVU_007G002200g             120   2e-28   
ref|XP_010326934.1|  PREDICTED: transcription factor bHLH128 isof...    120   2e-28   
ref|NP_001189738.1|  transcription factor bHLH129                       120   2e-28   
ref|XP_010326935.1|  PREDICTED: transcription factor bHLH128 isof...    120   2e-28   
ref|XP_009620076.1|  PREDICTED: transcription factor bHLH128-like...    120   2e-28   
ref|XP_009620077.1|  PREDICTED: transcription factor bHLH128-like...    120   2e-28   
ref|XP_008663339.1|  PREDICTED: transcription factor bHLH129-like...    120   2e-28   
gb|AAM63313.1|  Contains similarity to bHLH transcription factor ...    120   2e-28   
ref|NP_563749.1|  transcription factor bHLH128                          120   2e-28   
ref|XP_010999991.1|  PREDICTED: transcription factor bHLH128-like       120   2e-28   
ref|XP_009133575.1|  PREDICTED: transcription factor bHLH129-like       117   3e-28   
ref|XP_010457680.1|  PREDICTED: transcription factor bHLH128            120   3e-28   
ref|XP_010475300.1|  PREDICTED: transcription factor bHLH128-like       119   4e-28   
ref|XP_006478880.1|  PREDICTED: transcription factor bHLH128-like...    119   4e-28   
gb|KFK42914.1|  hypothetical protein AALP_AA1G054700                    119   4e-28   
ref|XP_006443135.1|  hypothetical protein CICLE_v10020681mg             119   4e-28   
ref|XP_009803686.1|  PREDICTED: transcription factor bHLH128-like...    119   4e-28   
gb|KDO50520.1|  hypothetical protein CISIN_1g038558mg                   119   4e-28   
ref|XP_002321112.1|  hypothetical protein POPTR_0014s14830g             119   5e-28   
ref|XP_002889567.1|  basic helix-loop-helix family protein              119   5e-28   
ref|XP_009803687.1|  PREDICTED: transcription factor bHLH128-like...    119   5e-28   
ref|XP_006305016.1|  hypothetical protein CARUB_v10009382mg             119   5e-28   
ref|XP_006417986.1|  hypothetical protein EUTSA_v10008050mg             119   5e-28   
ref|XP_004953019.1|  PREDICTED: transcription factor bHLH128-like       118   6e-28   
ref|XP_010485336.1|  PREDICTED: transcription factor bHLH128-like       119   6e-28   
ref|XP_004510971.1|  PREDICTED: transcription factor bHLH130-like       119   6e-28   
ref|XP_008222661.1|  PREDICTED: transcription factor bHLH128            119   6e-28   
ref|XP_006598251.1|  PREDICTED: transcription factor bHLH130-like...    119   6e-28   
gb|KEH19058.1|  transcription factor bHLH122-like protein               119   6e-28   
ref|XP_002521827.1|  DNA binding protein, putative                      117   2e-27   
ref|XP_001780134.1|  predicted protein                                  111   2e-27   
gb|KEH33202.1|  transcription factor bHLH122-like protein               118   2e-27   
ref|XP_008350047.1|  PREDICTED: transcription factor bHLH130-like       111   2e-27   
ref|XP_003546874.1|  PREDICTED: transcription factor bHLH130-like...    118   3e-27   
ref|XP_007033996.1|  Basic helix-loop-helix DNA-binding superfami...    117   3e-27   
ref|XP_004167556.1|  PREDICTED: transcription factor bHLH128-like       117   3e-27   
ref|XP_011042788.1|  PREDICTED: transcription factor bHLH128-like       117   4e-27   
emb|CDY51319.1|  BnaA10g03540D                                          117   5e-27   
ref|XP_009119114.1|  PREDICTED: transcription factor bHLH128            117   5e-27   
gb|AGY49114.1|  PA1                                                     116   5e-27   
ref|XP_002967139.1|  hypothetical protein SELMODRAFT_86848              110   5e-27   
ref|XP_010650468.1|  PREDICTED: transcription factor bHLH128 isof...    116   6e-27   
gb|KEH23663.1|  transcription factor bHLH122-like protein               115   7e-27   
ref|XP_006358816.1|  PREDICTED: transcription factor bHLH128-like       113   8e-27   
ref|XP_010650470.1|  PREDICTED: transcription factor bHLH128 isof...    115   8e-27   
ref|XP_009142170.1|  PREDICTED: transcription factor bHLH129-like...    115   1e-26   
ref|XP_010506173.1|  PREDICTED: transcription factor bHLH129-like...    115   1e-26   
ref|XP_007226948.1|  hypothetical protein PRUPE_ppa025178mg             115   1e-26   
emb|CDY30384.1|  BnaA04g24850D                                          114   1e-26   
ref|XP_009405556.1|  PREDICTED: transcription factor bHLH128-like...    115   2e-26   
ref|XP_003572696.1|  PREDICTED: transcription factor bHLH128 isof...    114   2e-26   
ref|XP_001775076.1|  predicted protein                                  108   2e-26   
ref|XP_001758775.1|  predicted protein                                  108   2e-26   
ref|NP_181843.2|  transcription factor bHLH129                          114   2e-26   
ref|XP_001776949.1|  predicted protein                                  115   3e-26   
gb|KHN37261.1|  Transcription factor bHLH128                            109   3e-26   
gb|AAC64303.1|  hypothetical protein                                    114   3e-26   
ref|XP_004497414.1|  PREDICTED: transcription factor bHLH129-like...    113   5e-26   
ref|XP_002881888.1|  hypothetical protein ARALYDRAFT_483415             113   5e-26   
ref|XP_008350818.1|  PREDICTED: transcription factor bHLH130-like       113   8e-26   
ref|XP_002960873.1|  hypothetical protein SELMODRAFT_402301             115   1e-25   
emb|CDY70200.1|  BnaCnng67160D                                          107   1e-25   
emb|CDY10149.1|  BnaC05g03920D                                          110   6e-25   
ref|XP_008791727.1|  PREDICTED: transcription factor bHLH129 isof...    110   7e-25   
ref|XP_010235663.1|  PREDICTED: transcription factor bHLH128 isof...    109   1e-24   
gb|EMT15454.1|  Transcription factor bHLH128                            108   3e-24   
ref|XP_008776591.1|  PREDICTED: transcription factor bHLH128-like       108   4e-24   
ref|XP_009405558.1|  PREDICTED: transcription factor bHLH129-like...    108   6e-24   
gb|KFK37155.1|  transcription factor bhlh                               107   1e-23   
ref|XP_001780186.1|  predicted protein                                  101   4e-23   
ref|XP_006850123.1|  hypothetical protein AMTR_s00022p00228970        99.8    4e-21   
gb|EMT20768.1|  Transcription factor bHLH130                          94.7    6e-21   
ref|XP_001772800.1|  predicted protein                                  100   6e-21   
gb|KJB78403.1|  hypothetical protein B456_013G138300                  97.4    8e-21   
ref|XP_006661373.1|  PREDICTED: transcription factor bHLH66-like      95.5    1e-20   
ref|XP_007020100.1|  Basic helix-loop-helix DNA-binding superfami...  97.4    1e-20   
gb|AEJ88334.1|  putative MYC protein                                  97.1    2e-20   
emb|CAN77105.1|  hypothetical protein VITISV_037095                   96.3    3e-20   
ref|XP_002325537.2|  hypothetical protein POPTR_0019s10900g           95.9    3e-20   
gb|KJB36083.1|  hypothetical protein B456_006G140200                  96.7    4e-20   
ref|XP_007020098.1|  Basic helix-loop-helix DNA-binding superfami...  96.3    4e-20   
ref|XP_007020099.1|  Basic helix-loop-helix DNA-binding superfami...  95.5    4e-20   
gb|KJB78404.1|  hypothetical protein B456_013G138300                  95.5    5e-20   
ref|XP_008339199.1|  PREDICTED: transcription factor bHLH80-like      93.6    1e-19   
ref|XP_006376233.1|  hypothetical protein POPTR_0013s11200g           94.4    1e-19   
gb|KCW51219.1|  hypothetical protein EUGRSUZ_J00796                   95.1    2e-19   
ref|XP_009788007.1|  PREDICTED: transcription factor bHLH80-like ...  93.6    2e-19   



>ref|XP_009618593.1| PREDICTED: transcription factor bHLH122-like [Nicotiana tomentosiformis]
 ref|XP_009618594.1| PREDICTED: transcription factor bHLH122-like [Nicotiana tomentosiformis]
 ref|XP_009618595.1| PREDICTED: transcription factor bHLH122-like [Nicotiana tomentosiformis]
Length=457

 Score =   172 bits (435),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 125/170 (74%), Gaps = 6/170 (4%)
 Frame = -1

Query  689  GVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDE---KPSLKAKAPDFKNTEGS  519
            G   F +    DESY++ FP+PSWDD  +L+DDFL+V ++   +P     A D +++EG 
Sbjct  282  GDESFGKGHKNDESYMTVFPMPSWDDSQMLTDDFLQVPEDNEAEPFSNVNASDNQSSEG-  340

Query  518  RSRPPGRlshhl--slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDR  345
            R+RPP  LSH            +  +LQDSVPC+VRAKRGCATHPRSIAERVRRTRISDR
Sbjct  341  RARPPTLLSHLSLPQTSAELSAMEKLLQDSVPCKVRAKRGCATHPRSIAERVRRTRISDR  400

Query  344  MRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            MRKLQ+LVPNMDKQTNTADMLD A DYIK+LE +VK L++ R+KC CSNK
Sbjct  401  MRKLQDLVPNMDKQTNTADMLDFAADYIKELETQVKALSERRSKCTCSNK  450



>ref|XP_009785469.1| PREDICTED: transcription factor bHLH122-like [Nicotiana sylvestris]
 ref|XP_009785470.1| PREDICTED: transcription factor bHLH122-like [Nicotiana sylvestris]
Length=443

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = -1

Query  689  GVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKV---TDEKPSLKAKAPDFKNTEGS  519
            G   F +    D+SY++ FPIPSWDD  +L+DDFL+V    + +P     A D +++E  
Sbjct  275  GDESFGKGHKNDDSYMTGFPIPSWDDSQMLTDDFLQVPEDNEAEPFSNVNASDNQSSE-D  333

Query  518  RSRPPGRlshhl--slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDR  345
            R+RPP  LSH            +  +LQDSVPC+VRAKRGCATHPRSIAERVRRTRIS+R
Sbjct  334  RARPPTLLSHLSLPQTSAELSAMEKLLQDSVPCKVRAKRGCATHPRSIAERVRRTRISER  393

Query  344  MRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            MRKLQELVPNMDKQTNTADMLD A DYIK+LE +VK L++ R+KC CSNK
Sbjct  394  MRKLQELVPNMDKQTNTADMLDFAADYIKELETQVKALSERRSKCTCSNK  443



>emb|CBI16416.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 112/172 (65%), Gaps = 9/172 (5%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRPP  504
            G F E  +    +++ FPI SWDD  ++S+ F  +   +            +E  +  P 
Sbjct  123  GSFGEGHSNSGGFITGFPIGSWDDSAIMSESFSSLKSVRDDEAKTFSGLNASEAQKGEPA  182

Query  503  GR---------lshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRIS  351
             R         L    S   ++ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS
Sbjct  183  NRPPVLAHHLSLPTKTSADLTTIEKYLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRIS  242

Query  350  DRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            +RMRKLQELVPNMDKQTNT+DMLDLAVDYIKDL+++VK L+DNRAKC CSNK
Sbjct  243  ERMRKLQELVPNMDKQTNTSDMLDLAVDYIKDLQKQVKTLSDNRAKCTCSNK  294



>ref|XP_006365809.1| PREDICTED: transcription factor bHLH128-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365810.1| PREDICTED: transcription factor bHLH128-like isoform X2 [Solanum 
tuberosum]
Length=454

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 120/163 (74%), Gaps = 6/163 (4%)
 Frame = -1

Query  677  FNEDQTMDESYLSSFPIPSWddldllsddfLKV--TDEKPSLKAKAP-DFKNTEGSRSRP  507
            F +    DESY++ FP+PSWDD  +L+DDFL+V   DE  S     P D +++EG R+RP
Sbjct  290  FGKGHKSDESYMAGFPMPSWDDSQILTDDFLQVPDDDEAGSFSNVNPSDNQSSEG-RARP  348

Query  506  PGRlshhl--slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKL  333
            P  LSH            +  +LQDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKL
Sbjct  349  PTLLSHLSLPQTSAELSAMEKLLQDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKL  408

Query  332  QELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRC  204
            QELVPNMDKQTNTADMLD A DYIK+LE +VK L++ R+KC C
Sbjct  409  QELVPNMDKQTNTADMLDFAADYIKELETQVKALSETRSKCTC  451



>ref|XP_010651262.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Vitis 
vinifera]
Length=425

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 115/179 (64%), Gaps = 23/179 (13%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKA----KAPDFKNTEGSR  516
            G F E  +    +++ FPI SWDD  +       +++   SLK+    +A  F     S 
Sbjct  251  GSFGEGHSNSGGFITGFPIGSWDDSAI-------MSESFSSLKSVRDDEAKTFSGLNASE  303

Query  515  S-------RPPGRls-----hhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAER  372
            +       RPP            S   ++ E     QDSVPC++RAKRGCATHPRSIAER
Sbjct  304  AQKGEPANRPPVLAHHLSLPTKTSADLTTIEKYLQFQDSVPCKIRAKRGCATHPRSIAER  363

Query  371  VRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            VRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDYIKDL+++VK L+DNRAKC CSNK
Sbjct  364  VRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDYIKDLQKQVKTLSDNRAKCTCSNK  422



>ref|XP_009793127.1| PREDICTED: uncharacterized protein LOC104240039 isoform X2 [Nicotiana 
sylvestris]
Length=454

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 5/161 (3%)
 Frame = -1

Query  671  EDQTMDESYLSSFPIPSWddldllsddfLKVTDEK--PSLKAKAPDFKNTEGSRSRPPGR  498
            ++Q  DES ++ FPIPSW+D  +LSDDFLK  D +  P     A + +N+EG  SRPP  
Sbjct  297  DEQKNDESCITDFPIPSWEDSHILSDDFLKAEDIEIEPFSNVNASNIQNSEG-LSRPP--  353

Query  497  lshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVP  318
            +     L   +  L  +LQDS P  VRAKRGCATHPRSIAERVRRT+ISDRMR+LQ+LVP
Sbjct  354  IPLSHHLSLPTSTLEKLLQDSTPLNVRAKRGCATHPRSIAERVRRTKISDRMRRLQDLVP  413

Query  317  NMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            NMDKQTNTADMLD AVDYIK+LE++VK LA+ RAKC C+NK
Sbjct  414  NMDKQTNTADMLDFAVDYIKELEKQVKILAEKRAKCTCTNK  454



>ref|XP_009793126.1| PREDICTED: uncharacterized protein LOC104240039 isoform X1 [Nicotiana 
sylvestris]
Length=462

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 5/161 (3%)
 Frame = -1

Query  671  EDQTMDESYLSSFPIPSWddldllsddfLKVTDEK--PSLKAKAPDFKNTEGSRSRPPGR  498
            ++Q  DES ++ FPIPSW+D  +LSDDFLK  D +  P     A + +N+EG  SRPP  
Sbjct  305  DEQKNDESCITDFPIPSWEDSHILSDDFLKAEDIEIEPFSNVNASNIQNSEG-LSRPP--  361

Query  497  lshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVP  318
            +     L   +  L  +LQDS P  VRAKRGCATHPRSIAERVRRT+ISDRMR+LQ+LVP
Sbjct  362  IPLSHHLSLPTSTLEKLLQDSTPLNVRAKRGCATHPRSIAERVRRTKISDRMRRLQDLVP  421

Query  317  NMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            NMDKQTNTADMLD AVDYIK+LE++VK LA+ RAKC C+NK
Sbjct  422  NMDKQTNTADMLDFAVDYIKELEKQVKILAEKRAKCTCTNK  462



>ref|XP_009620427.1| PREDICTED: uncharacterized protein LOC104112259 isoform X2 [Nicotiana 
tomentosiformis]
Length=448

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  656  DESYLSSFPIPSWddldllsddfLKVTDEK--PSLKAKAPDFKNTEGSRSRPPGRlshhl  483
            DES ++ FPIPSW+D  +LSDDFLK  D +  P     A D +N EG  SRPP  +    
Sbjct  296  DESSITDFPIPSWEDSHILSDDFLKAEDIEIEPFSNVNASDNQNCEG-LSRPP--IPLSH  352

Query  482  slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ  303
             L   +  L  +LQDS P  VRAKRGCATHPRSIAERVRRT+ISDRMR+LQELVPNMDKQ
Sbjct  353  HLSLPTSTLEKLLQDSTPLNVRAKRGCATHPRSIAERVRRTKISDRMRRLQELVPNMDKQ  412

Query  302  TNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            TNTADMLD AVDYIK+LE++VK LA+ RAKC C+NK
Sbjct  413  TNTADMLDFAVDYIKELEKQVKILAEKRAKCTCTNK  448



>ref|XP_010314674.1| PREDICTED: transcription factor bHLH130-like [Solanum lycopersicum]
Length=445

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 120/167 (72%), Gaps = 6/167 (4%)
 Frame = -1

Query  689  GVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKV--TDEKPSL-KAKAPDFKNTEGS  519
            G   F +    DESY++ F +PSWDD  +L+DDFL+V   DE  S     A D +++EG 
Sbjct  277  GHESFGKGHKSDESYMAGFALPSWDDSQILTDDFLQVPEDDESGSFSNVNASDNQSSEG-  335

Query  518  RSRPPGRlshhl--slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDR  345
            R+RPP  LSH            +  +LQDSVPC+VRAKRGCATHPRSIAERVRRTRIS+R
Sbjct  336  RARPPTLLSHLSLPQTSAELSAMEKLLQDSVPCKVRAKRGCATHPRSIAERVRRTRISER  395

Query  344  MRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRC  204
            MRKLQELVPNMDKQTNTADMLD A DYIK+LE +VK L++ R+KC C
Sbjct  396  MRKLQELVPNMDKQTNTADMLDFAADYIKELETQVKALSETRSKCTC  442



>ref|XP_010651260.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Vitis 
vinifera]
Length=438

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 115/179 (64%), Gaps = 23/179 (13%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKA----KAPDFKNTEGSR  516
            G F E  +    +++ FPI SWDD  +       +++   SLK+    +A  F     S 
Sbjct  264  GSFGEGHSNSGGFITGFPIGSWDDSAI-------MSESFSSLKSVRDDEAKTFSGLNASE  316

Query  515  S-------RPPGRls-----hhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAER  372
            +       RPP            S   ++ E     QDSVPC++RAKRGCATHPRSIAER
Sbjct  317  AQKGEPANRPPVLAHHLSLPTKTSADLTTIEKYLQFQDSVPCKIRAKRGCATHPRSIAER  376

Query  371  VRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            VRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDYIKDL+++VK L+DNRAKC CSNK
Sbjct  377  VRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDYIKDLQKQVKTLSDNRAKCTCSNK  435



>ref|XP_009620426.1| PREDICTED: uncharacterized protein LOC104112259 isoform X1 [Nicotiana 
tomentosiformis]
Length=456

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 116/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  656  DESYLSSFPIPSWddldllsddfLKVTDEK--PSLKAKAPDFKNTEGSRSRPPGRlshhl  483
            DES ++ FPIPSW+D  +LSDDFLK  D +  P     A D +N EG  SRPP  +    
Sbjct  304  DESSITDFPIPSWEDSHILSDDFLKAEDIEIEPFSNVNASDNQNCEG-LSRPP--IPLSH  360

Query  482  slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ  303
             L   +  L  +LQDS P  VRAKRGCATHPRSIAERVRRT+ISDRMR+LQELVPNMDKQ
Sbjct  361  HLSLPTSTLEKLLQDSTPLNVRAKRGCATHPRSIAERVRRTKISDRMRRLQELVPNMDKQ  420

Query  302  TNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            TNTADMLD AVDYIK+LE++VK LA+ RAKC C+NK
Sbjct  421  TNTADMLDFAVDYIKELEKQVKILAEKRAKCTCTNK  456



>emb|CDP17403.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 118/169 (70%), Gaps = 9/169 (5%)
 Frame = -1

Query  677  FNEDQTMDESYLSSFPIPSWddldllsddfLK-----VTDEKPSLKAKAPDFKNTEGSRS  513
            F E Q  D  Y++ FP+ SWDD  LLSD FLK       D K    A A + ++ EG R+
Sbjct  261  FGEGQRNDSGYITGFPVTSWDDSALLSDSFLKGLGDDDDDSKTLSNAVASENQSNEG-RN  319

Query  512  RPP---GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            RP           +       + +++QDSV C++RAKRGCATHPRSIAERVRRT+IS+RM
Sbjct  320  RPSTLLAHHLSLPNTSDELSAIETLMQDSVLCKLRAKRGCATHPRSIAERVRRTKISERM  379

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQELVPNMDKQTNTADMLDLAVDYIKDL+++VK L+DNRAKC C N+
Sbjct  380  RKLQELVPNMDKQTNTADMLDLAVDYIKDLQKQVKTLSDNRAKCTCFNQ  428



>gb|KDO57266.1| hypothetical protein CISIN_1g0180071mg, partial [Citrus sinensis]
Length=210

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  119  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  178

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+ + K L+DNRAKC+CS
Sbjct  179  IKDLQNQFKTLSDNRAKCKCS  199



>gb|KDO57265.1| hypothetical protein CISIN_1g0180071mg, partial [Citrus sinensis]
Length=222

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  131  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  190

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+ + K L+DNRAKC+CS
Sbjct  191  IKDLQNQFKTLSDNRAKCKCS  211



>ref|XP_006490036.1| PREDICTED: transcription factor bHLH130-like [Citrus sinensis]
Length=362

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  271  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  330

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+ + K L+DNRAKC+CS
Sbjct  331  IKDLQNQFKTLSDNRAKCKCS  351



>ref|XP_006421491.1| hypothetical protein CICLE_v10005233mg [Citrus clementina]
 gb|ESR34731.1| hypothetical protein CICLE_v10005233mg [Citrus clementina]
Length=362

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/81 (88%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  271  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  330

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+ + K L+DNRAKC+CS
Sbjct  331  IKDLQNQFKTLSDNRAKCKCS  351



>ref|XP_007014949.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY32568.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
Length=434

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 114/180 (63%), Gaps = 26/180 (14%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-------------AKAP  543
             GF E++    +Y S FP+ SW+D  +       ++D  P +K                 
Sbjct  261  AGFGENR--HNNYSSGFPVTSWEDSMM-------ISDNMPGVKRLREDDRSLSGLDLDGA  311

Query  542  DFKNTEGSRSRPPGRlshhlslpksseels----siLQDSVPCRVRAKRGCATHPRSIAE  375
            + +NT+     PP    H      S+E  +       QDSVPC++RAKRGCATHPRSIAE
Sbjct  312  ETQNTDAGNRPPPILAHHLSLPKSSAEMSAIDKFLQYQDSVPCKIRAKRGCATHPRSIAE  371

Query  374  RVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+ +VK L+DNRAKC CSNK
Sbjct  372  RVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQNQVKTLSDNRAKCSCSNK  431



>ref|XP_007014950.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY32569.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
Length=432

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 114/180 (63%), Gaps = 26/180 (14%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-------------AKAP  543
             GF E++    +Y S FP+ SW+D  +       ++D  P +K                 
Sbjct  259  AGFGENR--HNNYSSGFPVTSWEDSMM-------ISDNMPGVKRLREDDRSLSGLDLDGA  309

Query  542  DFKNTEGSRSRPPGRlshhlslpksseels----siLQDSVPCRVRAKRGCATHPRSIAE  375
            + +NT+     PP    H      S+E  +       QDSVPC++RAKRGCATHPRSIAE
Sbjct  310  ETQNTDAGNRPPPILAHHLSLPKSSAEMSAIDKFLQYQDSVPCKIRAKRGCATHPRSIAE  369

Query  374  RVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+ +VK L+DNRAKC CSNK
Sbjct  370  RVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQNQVKTLSDNRAKCSCSNK  429



>ref|XP_002513457.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF48860.1| DNA binding protein, putative [Ricinus communis]
Length=418

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = -1

Query  680  GFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRPPG  501
            GF E  T   +Y++ FPI SWDD  ++S    ++TD+  +L         +    + PP 
Sbjct  251  GFGE--TRSNNYVTGFPIGSWDDTAVMSAGLKRLTDDDRTLSGLNASENESGEVGNHPPM  308

Query  500  Rlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKL  333
               H      S   S+ E    LQDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKL
Sbjct  309  LAHHLSLPKTSAELSAIEKYLQLQDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKL  368

Query  332  QELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            Q+LVPNMDKQTNT+DMLDLAVDYIKDL+++V+ L++NR+KC C++K
Sbjct  369  QDLVPNMDKQTNTSDMLDLAVDYIKDLQRQVETLSENRSKCTCASK  414



>ref|XP_007205257.1| hypothetical protein PRUPE_ppa006295mg [Prunus persica]
 gb|EMJ06456.1| hypothetical protein PRUPE_ppa006295mg [Prunus persica]
Length=419

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 119/176 (68%), Gaps = 18/176 (10%)
 Frame = -1

Query  695  GDGVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVT----DEKPSLKAKAPDFKNT  528
            GDG G          +Y++ FPI SWDD  ++S D  + T    D+  +    +P     
Sbjct  251  GDGSG---------NNYVTGFPIDSWDDSAMMSGDITRSTSFREDDIKAFTGLSPSETQD  301

Query  527  EGSRSRPPGRlshh-----lslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRR  363
              + +RPP  L+HH      S   ++ E     QDSVPC++RAKRGCATHPRSIAERVRR
Sbjct  302  VEAGNRPPTLLAHHLSLPKTSAEMAAIEKFMQFQDSVPCKIRAKRGCATHPRSIAERVRR  361

Query  362  TRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            TRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YIKDL+ +V+ L+DNRAKC CS+K
Sbjct  362  TRISERMRKLQELVPNMDKQTNTADMLDLAVEYIKDLQTQVQTLSDNRAKCTCSSK  417



>ref|XP_011090494.1| PREDICTED: transcription factor bHLH130-like [Sesamum indicum]
Length=363

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 109/165 (66%), Gaps = 3/165 (2%)
 Frame = -1

Query  689  GVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSR--  516
            G G F++D+  D  Y+  FP+  WD  D      +   D K   KA   D +N EG    
Sbjct  195  GDGQFDQDRGNDGDYIPGFPMNPWDLSDDFLKGLVD-NDSKTFPKANDSDDQNNEGGNRS  253

Query  515  SRPPGRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
            + P  R     +       +  +LQDSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRK
Sbjct  254  TTPLSRHLSLPTSSAELSAMEKLLQDSVPCKIRAKRGCATHPRSIAERVRRTKISERMRK  313

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCS  201
            LQELVPNM+KQTNTADMLDLAVDYIKDL+++V+ L+D   +C CS
Sbjct  314  LQELVPNMEKQTNTADMLDLAVDYIKDLQRQVQTLSDRHVRCSCS  358



>ref|XP_004295210.1| PREDICTED: transcription factor bHLH122-like [Fragaria vesca 
subsp. vesca]
Length=431

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 118/172 (69%), Gaps = 12/172 (7%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVT-------DEKPSLKAKAPDFKNTE  525
            GGF+E +    +Y+S FP+ SW+D  LL+DD +  T       D K      A + +N E
Sbjct  261  GGFSEGR--GNNYVSGFPMGSWEDSSLLADDIIGSTNFRDDDDDVKTITGLSASETQNME  318

Query  524  GSRSRPPGRlsh--hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRIS  351
             +R RP          S   ++ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS
Sbjct  319  -ARGRPLAHHLSLPKTSAEMAAIENFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRIS  377

Query  350  DRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            +RMRKLQELVPNMDKQTNTADMLDLAVDYIK+L+ +V+ L++ RAKC CSN+
Sbjct  378  ERMRKLQELVPNMDKQTNTADMLDLAVDYIKNLQTEVQTLSEARAKCTCSNQ  429



>ref|XP_008219331.1| PREDICTED: transcription factor bHLH130-like [Prunus mume]
Length=419

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 121/177 (68%), Gaps = 20/177 (11%)
 Frame = -1

Query  695  GDGVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVT-----DEKPSLKAKAPDFKN  531
            GDG G          +Y++ FPI SWDD  ++SDD  + T     D K      + + ++
Sbjct  251  GDGSG---------NNYVTGFPIDSWDDSAMMSDDITRSTSFREDDIKAFTGLSSSETQD  301

Query  530  TEGSRSRPPGRlshh-----lslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVR  366
             E   +RPP  L+HH      S   ++ E     QDSVPC++RAKRGCATHPRSIAERVR
Sbjct  302  VEAG-NRPPTLLAHHLSLPKTSAEMAAIEKFMQFQDSVPCKIRAKRGCATHPRSIAERVR  360

Query  365  RTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YIKDL+ +V+ L+DNRAKC CS+K
Sbjct  361  RTRISERMRKLQELVPNMDKQTNTADMLDLAVEYIKDLQTQVQTLSDNRAKCTCSSK  417



>ref|XP_011033269.1| PREDICTED: transcription factor bHLH130-like [Populus euphratica]
Length=353

 Score =   155 bits (392),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  262  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  321

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L+DNRA C+C +K
Sbjct  322  IKDLQKQYKTLSDNRANCKCLSK  344



>ref|XP_010265785.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265786.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265787.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265788.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010265789.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nelumbo 
nucifera]
Length=451

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 112/169 (66%), Gaps = 13/169 (8%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-AKAPDFKNTEG-SRSR  510
            G F      +  Y+  FP+ SW+D  L       V++    LK  +  +  N  G + SR
Sbjct  281  GSFGSGNAGNRGYIQGFPVGSWEDSAL-------VSENVTGLKRIRDTNGGNQNGEAGSR  333

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S+  ++ E     QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  334  PPMLAHHFSLPKTSVEMAAMEKFLQFQDAVPCKIRAKRGCATHPRSIAERVRRTRISERM  393

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQELVPNMDKQTNTADMLDLAV+YIKDL+++VK L DNRA C CS+K
Sbjct  394  RKLQELVPNMDKQTNTADMLDLAVEYIKDLQKQVKTLNDNRANCTCSSK  442



>ref|XP_010265791.1| PREDICTED: transcription factor bHLH130-like isoform X3 [Nelumbo 
nucifera]
Length=447

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 112/169 (66%), Gaps = 13/169 (8%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-AKAPDFKNTEG-SRSR  510
            G F      +  Y+  FP+ SW+D  L       V++    LK  +  +  N  G + SR
Sbjct  277  GSFGSGNAGNRGYIQGFPVGSWEDSAL-------VSENVTGLKRIRDTNGGNQNGEAGSR  329

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S+  ++ E     QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  330  PPMLAHHFSLPKTSVEMAAMEKFLQFQDAVPCKIRAKRGCATHPRSIAERVRRTRISERM  389

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQELVPNMDKQTNTADMLDLAV+YIKDL+++VK L DNRA C CS+K
Sbjct  390  RKLQELVPNMDKQTNTADMLDLAVEYIKDLQKQVKTLNDNRANCTCSSK  438



>ref|XP_010265790.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 112/169 (66%), Gaps = 13/169 (8%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-AKAPDFKNTEG-SRSR  510
            G F      +  Y+  FP+ SW+D  L       V++    LK  +  +  N  G + SR
Sbjct  278  GSFGSGNAGNRGYIQGFPVGSWEDSAL-------VSENVTGLKRIRDTNGGNQNGEAGSR  330

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S+  ++ E     QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  331  PPMLAHHFSLPKTSVEMAAMEKFLQFQDAVPCKIRAKRGCATHPRSIAERVRRTRISERM  390

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQELVPNMDKQTNTADMLDLAV+YIKDL+++VK L DNRA C CS+K
Sbjct  391  RKLQELVPNMDKQTNTADMLDLAVEYIKDLQKQVKTLNDNRANCTCSSK  439



>ref|XP_002323299.2| hypothetical protein POPTR_0016s05100g [Populus trichocarpa]
 gb|EEF05060.2| hypothetical protein POPTR_0016s05100g [Populus trichocarpa]
Length=353

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  262  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  321

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L+DNRA C+C +K
Sbjct  322  IKDLQKQYKTLSDNRANCKCLSK  344



>ref|XP_002532405.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF29990.1| DNA binding protein, putative [Ricinus communis]
Length=355

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  264  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  323

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L+DNRA C+C +K
Sbjct  324  IKDLQKQYKTLSDNRANCKCLSK  346



>ref|XP_006364245.1| PREDICTED: transcription factor bHLH122-like [Solanum tuberosum]
Length=441

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 115/156 (74%), Gaps = 5/156 (3%)
 Frame = -1

Query  656  DESYLSSFPIPSWddldllsddfLKVTDEK--PSLKAKAPDFKNTEGSRSRPPGRlshhl  483
            DE+ ++ FP+PSW+D  +LSDDFLK  D +  P     A   +N+EG  +RPP  +    
Sbjct  289  DENCITDFPMPSWEDSHILSDDFLKAEDIEIEPYSNEDASHNQNSEG-LARPP--IPLSH  345

Query  482  slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ  303
             L   +  +  +LQDSV   VRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ
Sbjct  346  HLSLPTSIMEKLLQDSVHLNVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ  405

Query  302  TNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            TNTADMLD AVDYIK+LE++VK LA+ R+KC C NK
Sbjct  406  TNTADMLDFAVDYIKELEKQVKILAEMRSKCTCINK  441



>gb|KJB55342.1| hypothetical protein B456_009G071900 [Gossypium raimondii]
 gb|KJB55343.1| hypothetical protein B456_009G071900 [Gossypium raimondii]
Length=426

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 116/168 (69%), Gaps = 10/168 (6%)
 Frame = -1

Query  680  GFNEDQTMDESYLSSFPIPSWddldllsddfLKV----TDEKPSLKAKAPDFKNTEGSRS  513
            GF E++    +Y S  P+ SWDD  ++SD+   +     D++        + KN +G   
Sbjct  253  GFGENRP--NNYSSGLPVTSWDDSMMISDNMSGIKRLREDDRSLSGLDGAETKNADGGNH  310

Query  512  RPP----GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDR  345
            RPP      LS   S   S+ E     QDSVPC++RAKRGCATHPRSIAERVRRT+IS+R
Sbjct  311  RPPPLLAHHLSLPKSSDMSAIEKFLQYQDSVPCKIRAKRGCATHPRSIAERVRRTKISER  370

Query  344  MRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCS  201
            MRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+++VK L+D+RAKC C+
Sbjct  371  MRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQKQVKSLSDSRAKCSCA  418



>gb|AAL87667.1| transcription factor RAU1 [Oryza sativa]
Length=150

 Score =   148 bits (373),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  62   QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  121

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D+RA C CS K
Sbjct  122  IKDLQKQVKGLNDSRANCTCSAK  144



>gb|KHG02416.1| Transcription factor protein [Gossypium arboreum]
Length=346

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  255  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  314

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+DNRA C+C N
Sbjct  315  IKDLQKQFKSLSDNRANCKCLN  336



>gb|KHG06292.1| Transcription factor protein [Gossypium arboreum]
Length=422

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 116/169 (69%), Gaps = 10/169 (6%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKV----TDEKPSLKAKAPDFKNTEGSR  516
             GF E++    +Y S  P+ SWDD  ++SD+   +     D++        + KN +G  
Sbjct  249  AGFGENRP--SNYSSGLPVTSWDDSMMISDNMSGIKRLREDDRSLSGLDGAETKNADGGN  306

Query  515  SRPP----GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISD  348
             RPP      LS   S   S+ E     QDSVPC++RAKRGCATHPRSIAERVRRT+IS+
Sbjct  307  HRPPPLLAHHLSLPKSSDMSAIEKFLQYQDSVPCKIRAKRGCATHPRSIAERVRRTKISE  366

Query  347  RMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCS  201
            RMRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+++VK L+D+RAKC C+
Sbjct  367  RMRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQKQVKSLSDSRAKCSCA  415



>ref|XP_011037862.1| PREDICTED: transcription factor bHLH122-like isoform X2 [Populus 
euphratica]
Length=418

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 119/170 (70%), Gaps = 10/170 (6%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLK-VTDEKPSLKA--KAPDFKNTEGSRS  513
            GG++E  T   +Y+S +PI SWDD  +LS    + +TD+  ++ +   A + +N EG  +
Sbjct  249  GGYSE--TRSSNYVSGYPIGSWDDSAMLSAGSKRHLTDDDTTVLSGLNASETQNEEGG-N  305

Query  512  RPP----GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDR  345
            RPP           +   S+ E     QDSVPCR RAKRGCATHPRSIAERVRRTRIS+R
Sbjct  306  RPPVLVHHMSLPKTAAEISAIEKFLQFQDSVPCRTRAKRGCATHPRSIAERVRRTRISER  365

Query  344  MRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            MRKLQ+LVPNMDKQTNT+DMLDLA DYIKDL+++V+ L++ RA+C C NK
Sbjct  366  MRKLQDLVPNMDKQTNTSDMLDLAADYIKDLQRQVQTLSEIRARCACINK  415



>ref|XP_010091980.1| hypothetical protein L484_007964 [Morus notabilis]
 gb|EXB48386.1| hypothetical protein L484_007964 [Morus notabilis]
Length=417

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 116/167 (69%), Gaps = 5/167 (3%)
 Frame = -1

Query  686  VGGFNEDQTMDESYLSSFPIPSWddl--dllsddfLKVTDEKPSLKAKAPDFKNTE-GSR  516
             G F + ++   S++SSFP+ SWDD      +   LK   +   +K  + + +N E G+R
Sbjct  247  TGAFGDSRS--NSFVSSFPMGSWDDSPIMSENITGLKRLRDDHDVKQYSSETQNVESGTR  304

Query  515  SRPPGRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
                       S   ++ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRK
Sbjct  305  PLAHHLSLPKTSSEMAAIEKFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRK  364

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            LQELVPNM+KQTNTADMLDLAV+YIKDL+++V+ L+D+RAKC CS+K
Sbjct  365  LQELVPNMEKQTNTADMLDLAVEYIKDLKKQVQTLSDSRAKCTCSSK  411



>gb|KDP20187.1| hypothetical protein JCGZ_07907 [Jatropha curcas]
Length=399

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 14/169 (8%)
 Frame = -1

Query  674  NEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSR-----SR  510
            N++ + D    +SF I SWDD  ++S    ++TD+      + P   NT  ++     +R
Sbjct  233  NKENSSDNYAAASFSIASWDDASVMSSGAKRLTDDD-----RTPSGLNTSETQNAEAVTR  287

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S   S+ E    LQDSVPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  288  PPLLAHHLSLPKTSAEFSAIEKYLQLQDSVPCKIRAKRGCATHPRSIAERVRRTRISERM  347

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+++VK L++NR KC C++K
Sbjct  348  RKLQDLVPNMDKQTNTADMLDLAVDYIKDLQRQVKTLSENRDKCTCTSK  396



>emb|CDY47961.1| BnaA04g24390D [Brassica napus]
Length=348

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPCR+RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  261  QDSVPCRIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTADMLDLAVDY  320

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  321  IKDLQRQYKILNENRANCKCMNK  343



>ref|XP_008392106.1| PREDICTED: transcription factor bHLH130-like [Malus domestica]
Length=316

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  225  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  284

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+D RA C+C N
Sbjct  285  IKDLQKQFKTLSDVRANCKCLN  306



>ref|XP_004250857.1| PREDICTED: transcription factor bHLH81 [Solanum lycopersicum]
Length=441

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = -1

Query  656  DESYLSSFPIPSWddldllsddfLKVTDEK--PSLKAKAPDFKNTEGSRSRPPGRlshhl  483
            DE  ++ FP+PSW+D  +LSDDFLK  D +  P     A   +++EG  +RPP  +    
Sbjct  289  DEHCITDFPMPSWEDSHILSDDFLKTEDIEIEPFSNEDASHNQSSEG-LARPP--IPLSH  345

Query  482  slpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ  303
             L   +  +  +LQDSV   VRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ
Sbjct  346  HLSLPTSTMEKLLQDSVHLNVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQ  405

Query  302  TNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            TNTADMLD AVDYIK+LE++VK LA+ RAKC C NK
Sbjct  406  TNTADMLDFAVDYIKELEKQVKILAERRAKCTCINK  441



>ref|XP_009142051.1| PREDICTED: transcription factor bHLH130-like [Brassica rapa]
Length=348

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPCR+RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  261  QDSVPCRIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTADMLDLAVDY  320

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  321  IKDLQRQYKILNENRANCKCMNK  343



>gb|EYU46294.1| hypothetical protein MIMGU_mgv1a008008mg [Erythranthe guttata]
Length=388

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 123/165 (75%), Gaps = 10/165 (6%)
 Frame = -1

Query  680  GFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRPPG  501
            G  E+ + D  Y++ FP+ +WDD  L      ++ D      +   + ++ EG  +RP  
Sbjct  227  GIGENNSSD--YITGFPMNAWDDDFLN-----ELADNDNKRFSNNANDQSNEGGNNRPTN  279

Query  500  RlshhlslpksseelssiL---QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQ  330
            RLSHHLS+P SS ELS++    QDSVPC++RAKRG ATHPRSIAERVRRT+IS+RMRKLQ
Sbjct  280  RLSHHLSMPTSSAELSAMEKLLQDSVPCKIRAKRGHATHPRSIAERVRRTKISERMRKLQ  339

Query  329  ELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            ELVPNM+KQTNT+DMLDLAVDYIKDL+++VK L+DNRAKC CS K
Sbjct  340  ELVPNMEKQTNTSDMLDLAVDYIKDLQRQVKTLSDNRAKCSCSAK  384



>ref|XP_009345105.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH130-like 
[Pyrus x bretschneideri]
Length=343

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  252  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  311

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+D RA C+C N
Sbjct  312  IKDLQKQFKTLSDVRANCKCLN  333



>ref|XP_002881830.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58089.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  272  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  331

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L DNRA C+C NK
Sbjct  332  IKDLQRQYKILNDNRANCKCMNK  354



>ref|XP_008373739.1| PREDICTED: transcription factor bHLH130-like [Malus domestica]
Length=356

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  253  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  312

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+D RA C+C N
Sbjct  313  IKDLQKQFKTLSDVRANCKCLN  334



>ref|NP_181757.2| transcription factor bHLH130 [Arabidopsis thaliana]
 sp|Q66GR3.1|BH130_ARATH RecName: Full=Transcription factor bHLH130; AltName: Full=Basic 
helix-loop-helix protein 130; Short=AtbHLH130; Short=bHLH 
130; AltName: Full=Transcription factor EN 69; AltName: Full=bHLH 
transcription factor bHLH130 [Arabidopsis thaliana]
 gb|AAU05462.1| At2g42280 [Arabidopsis thaliana]
 gb|AAU45210.1| At2g42280 [Arabidopsis thaliana]
 dbj|BAF00869.1| putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AEC10099.1| transcription factor bHLH130 [Arabidopsis thaliana]
Length=359

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  272  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  331

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L DNRA C+C NK
Sbjct  332  IKDLQRQYKILNDNRANCKCMNK  354



>gb|KJB16402.1| hypothetical protein B456_002G228900 [Gossypium raimondii]
Length=346

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  255  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  314

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+D+RA C+C N
Sbjct  315  IKDLQKQFKTLSDSRANCKCLN  336



>ref|XP_009374647.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009374656.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009374663.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Pyrus 
x bretschneideri]
Length=416

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 7/169 (4%)
 Frame = -1

Query  686  VGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRP  507
             GGF + +    +Y++ FP+ SWDD  +L DD     DE  +    +P       + + P
Sbjct  248  AGGFGDGR--GNNYVTGFPMDSWDDSAILGDDTGFRDDEVKAYTGLSPSETQDVEAGNHP  305

Query  506  PGRlshh-----lslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            P  L+HH      S   ++ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  306  PTLLAHHLSLPKTSAEMAAIEKFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERM  365

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQELVPNMDKQ +T+DMLDLAV+YIKDL+ +V+ L++NRAKC CSNK
Sbjct  366  RKLQELVPNMDKQAHTSDMLDLAVEYIKDLQTQVQTLSENRAKCTCSNK  414



>ref|XP_009374670.1| PREDICTED: transcription factor bHLH122-like isoform X2 [Pyrus 
x bretschneideri]
Length=414

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 7/169 (4%)
 Frame = -1

Query  686  VGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRP  507
             GGF + +    +Y++ FP+ SWDD  +L DD     DE  +    +P       + + P
Sbjct  246  AGGFGDGR--GNNYVTGFPMDSWDDSAILGDDTGFRDDEVKAYTGLSPSETQDVEAGNHP  303

Query  506  PGRlshh-----lslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            P  L+HH      S   ++ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  304  PTLLAHHLSLPKTSAEMAAIEKFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERM  363

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RKLQELVPNMDKQ +T+DMLDLAV+YIKDL+ +V+ L++NRAKC CSNK
Sbjct  364  RKLQELVPNMDKQAHTSDMLDLAVEYIKDLQTQVQTLSENRAKCTCSNK  412



>ref|XP_008240817.1| PREDICTED: transcription factor bHLH130-like [Prunus mume]
Length=346

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  254  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  313

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+D RA CRC N
Sbjct  314  IKDLQKQFKTLSDVRANCRCLN  335



>ref|XP_011037857.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Populus 
euphratica]
 ref|XP_011037858.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Populus 
euphratica]
 ref|XP_011037859.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Populus 
euphratica]
 ref|XP_011037860.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Populus 
euphratica]
 ref|XP_011037861.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Populus 
euphratica]
Length=419

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 117/170 (69%), Gaps = 9/170 (5%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLK-VTDEKPSLKA--KAPDFKNTEGSRS  513
            GG++E  T   +Y+S +PI SWDD  +LS    + +TD+  ++ +   A + +  E   +
Sbjct  249  GGYSE--TRSSNYVSGYPIGSWDDSAMLSAGSKRHLTDDDTTVLSGLNASETQQNEEGGN  306

Query  512  RPP----GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDR  345
            RPP           +   S+ E     QDSVPCR RAKRGCATHPRSIAERVRRTRIS+R
Sbjct  307  RPPVLVHHMSLPKTAAEISAIEKFLQFQDSVPCRTRAKRGCATHPRSIAERVRRTRISER  366

Query  344  MRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            MRKLQ+LVPNMDKQTNT+DMLDLA DYIKDL+++V+ L++ RA+C C NK
Sbjct  367  MRKLQDLVPNMDKQTNTSDMLDLAADYIKDLQRQVQTLSEIRARCACINK  416



>ref|XP_010045000.1| PREDICTED: transcription factor bHLH130-like [Eucalyptus grandis]
 gb|KCW87142.1| hypothetical protein EUGRSUZ_B03669 [Eucalyptus grandis]
Length=431

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 120/178 (67%), Gaps = 12/178 (7%)
 Frame = -1

Query  701  CSGDGVGGFNEDQTMDESYLSSFPIPSWddldllsddfLKVT----DEKPSLKAKAPDFK  534
             S D    F E    D  Y++ +P+ SW+D   +S++F  +     D+K      A D  
Sbjct  254  ASIDEGAAFGEGNAND--YVAGYPMSSWEDSASMSENFNALKRSRDDDKKFSGLNASDLV  311

Query  533  NTEGSRSRPPGRlshh-----lslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERV  369
            N E  RSRPP  L+HH      S   SS E    LQDSVPC++RAKRGCATHPRSIAERV
Sbjct  312  NEE-VRSRPPMGLTHHLSLPKTSAEISSIEKFLQLQDSVPCKIRAKRGCATHPRSIAERV  370

Query  368  RRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            RRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+ +VK L+ NRA+C C N+
Sbjct  371  RRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQTQVKGLSANRARCTCLNR  428



>gb|AAB88652.1| unknown protein [Arabidopsis thaliana]
Length=380

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  293  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  352

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L DNRA C+C NK
Sbjct  353  IKDLQRQYKILNDNRANCKCMNK  375



>emb|CBI29901.3| unnamed protein product [Vitis vinifera]
Length=280

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  189  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  248

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++   L DNRA C+C  K
Sbjct  249  IKDLQKQYNTLTDNRAHCKCLGK  271



>ref|XP_003537954.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Glycine 
max]
 ref|XP_006590956.1| PREDICTED: transcription factor bHLH122-like isoform X2 [Glycine 
max]
 ref|XP_006590957.1| PREDICTED: transcription factor bHLH122-like isoform X3 [Glycine 
max]
 ref|XP_006590958.1| PREDICTED: transcription factor bHLH122-like isoform X4 [Glycine 
max]
 ref|XP_006590959.1| PREDICTED: transcription factor bHLH122-like isoform X5 [Glycine 
max]
 gb|KHN21885.1| Transcription factor bHLH122 [Glycine soja]
Length=418

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAV+YI
Sbjct  334  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVEYI  393

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+ +V+ L+DNRAKC CS+K
Sbjct  394  KDLQNQVQTLSDNRAKCTCSHK  415



>ref|XP_009379430.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Pyrus 
x bretschneideri]
Length=433

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAV+Y
Sbjct  349  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVEY  408

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L+++RAKC CSNK
Sbjct  409  IKDLQTQVQTLSEHRAKCTCSNK  431



>ref|XP_009379429.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Pyrus 
x bretschneideri]
Length=435

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAV+Y
Sbjct  351  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVEY  410

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L+++RAKC CSNK
Sbjct  411  IKDLQTQVQTLSEHRAKCTCSNK  433



>ref|XP_006660262.1| PREDICTED: transcription factor bHLH130-like [Oryza brachyantha]
Length=226

 Score =   148 bits (373),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  137  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  196

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L+D+RA C CS
Sbjct  197  IKDLQKQVKVLSDSRASCTCS  217



>ref|XP_010031833.1| PREDICTED: transcription factor bHLH130-like isoform X3 [Eucalyptus 
grandis]
 gb|KCW51217.1| hypothetical protein EUGRSUZ_J00796 [Eucalyptus grandis]
Length=396

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKV-TDEKPSLKAKAPDFKNTEGSRSRP  507
            G F+E    D  Y++ FPI SWDD   LSD+F +   DEK  L   A +   TE  + R 
Sbjct  232  GDFSEGHGND--YITGFPIGSWDDPVGLSDNFNRGDEDEKGFLGLNASE---TEEGKGRV  286

Query  506  PG---RlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
            PG         S   +  +    LQDSVPC+VRAKRG ATHPRSIAERVRRT+IS+R+RK
Sbjct  287  PGLLAHHLSLPSKSSADVDKFLQLQDSVPCKVRAKRGFATHPRSIAERVRRTKISERIRK  346

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            LQ+LVPNMDKQTNTADMLDLAVDYIK+L+ +VK L+D+RAKC C +K
Sbjct  347  LQDLVPNMDKQTNTADMLDLAVDYIKELQGQVKTLSDDRAKCTCPSK  393



>ref|XP_011075183.1| PREDICTED: transcription factor bHLH130-like [Sesamum indicum]
Length=377

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  286  QDTVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  345

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK L+++ K L+DNRA C+CS
Sbjct  346  IKSLQKQYKTLSDNRANCKCS  366



>ref|XP_010057736.1| PREDICTED: transcription factor bHLH130 isoform X1 [Eucalyptus 
grandis]
Length=392

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  302  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  361

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++ K L++NRA C+C
Sbjct  362  IKDLQKQFKILSENRANCKC  381



>ref|XP_010031832.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Eucalyptus 
grandis]
Length=397

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKV-TDEKPSLKAKAPDFKNTEGSRSRP  507
            G F+E    D  Y++ FPI SWDD   LSD+F +   DEK  L   A +   TE  + R 
Sbjct  233  GDFSEGHGND--YITGFPIGSWDDPVGLSDNFNRGDEDEKGFLGLNASE---TEEGKGRV  287

Query  506  PG---RlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
            PG         S   +  +    LQDSVPC+VRAKRG ATHPRSIAERVRRT+IS+R+RK
Sbjct  288  PGLLAHHLSLPSKSSADVDKFLQLQDSVPCKVRAKRGFATHPRSIAERVRRTKISERIRK  347

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            LQ+LVPNMDKQTNTADMLDLAVDYIK+L+ +VK L+D+RAKC C +K
Sbjct  348  LQDLVPNMDKQTNTADMLDLAVDYIKELQGQVKTLSDDRAKCTCPSK  394



>ref|XP_010508597.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Camelina 
sativa]
Length=370

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  283  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  342

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  343  IKDLQRQYKILNENRANCKCMNK  365



>ref|XP_010057742.1| PREDICTED: transcription factor bHLH130 isoform X2 [Eucalyptus 
grandis]
 gb|KCW90272.1| hypothetical protein EUGRSUZ_A02417 [Eucalyptus grandis]
Length=390

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  300  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  359

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++ K L++NRA C+C
Sbjct  360  IKDLQKQFKILSENRANCKC  379



>gb|KFK37090.1| hypothetical protein AALP_AA4G211900 [Arabis alpina]
Length=367

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  280  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  339

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  340  IKDLQRQYKILNENRANCKCMNK  362



>ref|XP_006294481.1| hypothetical protein CARUB_v10023498mg [Capsella rubella]
 gb|EOA27379.1| hypothetical protein CARUB_v10023498mg [Capsella rubella]
Length=362

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  275  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  334

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  335  IKDLQRQYKILNENRANCKCMNK  357



>ref|XP_010508598.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Camelina 
sativa]
Length=369

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  282  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  341

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  342  IKDLQRQYKILNENRANCKCMNK  364



>emb|CDY53498.1| BnaC04g02580D [Brassica napus]
Length=325

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  238  QDSVPCKVRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVDY  297

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  298  IKDLQRQYKILNENRANCKCVNK  320



>ref|XP_006381041.1| hypothetical protein POPTR_0006s05640g [Populus trichocarpa]
 gb|ERP58838.1| hypothetical protein POPTR_0006s05640g [Populus trichocarpa]
Length=355

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV Y
Sbjct  264  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVVY  323

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L+DNRA C+C +K
Sbjct  324  IKDLQKQYKTLSDNRANCKCLSK  346



>ref|XP_008384525.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Malus 
domestica]
Length=435

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAV+Y
Sbjct  351  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVEY  410

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L++NRAKC CS K
Sbjct  411  IKDLQTQVQTLSENRAKCTCSXK  433



>ref|XP_008384526.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Malus 
domestica]
Length=433

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAV+Y
Sbjct  349  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVEY  408

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L++NRAKC CS K
Sbjct  409  IKDLQTQVQTLSENRAKCTCSXK  431



>emb|CDX79884.1| BnaA05g02720D [Brassica napus]
Length=327

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  240  QDSVPCKVRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVDY  299

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  300  IKDLQRQYKILNENRANCKCVNK  322



>ref|XP_010031830.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Eucalyptus 
grandis]
Length=404

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKV-TDEKPSLKAKAPDFKNTEGSRSRP  507
            G F+E    D  Y++ FPI SWDD   LSD+F +   DEK  L   A +   TE  + R 
Sbjct  240  GDFSEGHGND--YITGFPIGSWDDPVGLSDNFNRGDEDEKGFLGLNASE---TEEGKGRV  294

Query  506  PG---RlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
            PG         S   +  +    LQDSVPC+VRAKRG ATHPRSIAERVRRT+IS+R+RK
Sbjct  295  PGLLAHHLSLPSKSSADVDKFLQLQDSVPCKVRAKRGFATHPRSIAERVRRTKISERIRK  354

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            LQ+LVPNMDKQTNTADMLDLAVDYIK+L+ +VK L+D+RAKC C +K
Sbjct  355  LQDLVPNMDKQTNTADMLDLAVDYIKELQGQVKTLSDDRAKCTCPSK  401



>ref|XP_004136581.1| PREDICTED: transcription factor bHLH130-like [Cucumis sativus]
 ref|XP_004168456.1| PREDICTED: transcription factor bHLH130-like [Cucumis sativus]
 gb|KGN59326.1| hypothetical protein Csa_3G810510 [Cucumis sativus]
Length=366

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR+RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+LVPNMDKQTNTADMLDLAVDY
Sbjct  275  QDAVPCRIRAKRGCATHPRSIAERVRRTRISERMRKLQDLVPNMDKQTNTADMLDLAVDY  334

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IK+L+++ K L+DNRA C C N
Sbjct  335  IKELQKQFKTLSDNRANCVCVN  356



>ref|XP_010506041.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Camelina 
sativa]
Length=372

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  285  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  344

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  345  IKDLQRQYKILYENRANCKCMNK  367



>ref|XP_009142816.1| PREDICTED: transcription factor bHLH130-like [Brassica rapa]
Length=326

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  239  QDSVPCKVRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVDY  298

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  299  IKDLQRQYKILNENRANCKCVNK  321



>ref|XP_008352417.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Malus 
domestica]
Length=411

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQ +T+DMLDLAV+Y
Sbjct  327  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQAHTSDMLDLAVEY  386

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L++NRAKC CSNK
Sbjct  387  IKDLQTQVQTLSENRAKCTCSNK  409



>ref|XP_010506040.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Camelina 
sativa]
Length=373

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  286  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  345

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  346  IKDLQRQYKILYENRANCKCMNK  368



>ref|XP_007203321.1| hypothetical protein PRUPE_ppa019977mg [Prunus persica]
 gb|EMJ04520.1| hypothetical protein PRUPE_ppa019977mg [Prunus persica]
Length=335

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  243  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  302

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L+D RA C+C N
Sbjct  303  IKDLQKQFKTLSDVRANCKCLN  324



>ref|XP_008352410.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Malus 
domestica]
Length=413

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQ +T+DMLDLAV+Y
Sbjct  329  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQAHTSDMLDLAVEY  388

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L++NRAKC CSNK
Sbjct  389  IKDLQTQVQTLSENRAKCTCSNK  411



>ref|XP_008443086.1| PREDICTED: transcription factor bHLH130 [Cucumis melo]
Length=369

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR+RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+LVPNMDKQTNTADMLDLAVDY
Sbjct  278  QDAVPCRIRAKRGCATHPRSIAERVRRTRISERMRKLQDLVPNMDKQTNTADMLDLAVDY  337

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IK+L+++ K L+DNRA C C N
Sbjct  338  IKELQKQFKTLSDNRANCVCVN  359



>emb|CDY14822.1| BnaC04g48190D [Brassica napus]
Length=345

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPCR+RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTA MLDLAVDY
Sbjct  258  QDSVPCRIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTAGMLDLAVDY  317

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  318  IKDLQRQYKILNENRANCKCMNK  340



>ref|XP_010517743.1| PREDICTED: transcription factor bHLH130 isoform X1 [Camelina 
sativa]
Length=370

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  283  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  342

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  343  IKDLQRQYKILNENRAHCKCMNK  365



>ref|XP_010111430.1| hypothetical protein L484_028088 [Morus notabilis]
 gb|EXC30908.1| hypothetical protein L484_028088 [Morus notabilis]
Length=360

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  269  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  328

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++ K L++NRA C+C
Sbjct  329  IKDLQKQFKTLSNNRANCKC  348



>ref|XP_010517744.1| PREDICTED: transcription factor bHLH130 isoform X2 [Camelina 
sativa]
Length=369

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  282  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  341

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L +NRA C+C NK
Sbjct  342  IKDLQRQYKILNENRAHCKCMNK  364



>ref|XP_007028921.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY09423.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=428

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  337  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  396

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++ K L+DNRA C+C
Sbjct  397  IKDLQKQFKTLSDNRANCKC  416



>gb|KJB36082.1| hypothetical protein B456_006G140200 [Gossypium raimondii]
Length=333

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  251  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  310

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            I DL+++ K L+D RA C+C N
Sbjct  311  INDLQKQFKTLSDRRANCKCLN  332



>ref|XP_010673593.1| PREDICTED: transcription factor bHLH130 [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVP R+RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+LVPNMDKQTNTADMLDLAV+Y
Sbjct  372  QDSVPLRIRAKRGCATHPRSIAERVRRTRISERMRKLQDLVPNMDKQTNTADMLDLAVEY  431

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL++KV+ L DNRAKC CS
Sbjct  432  IKDLQKKVENLNDNRAKCTCS  452



>ref|XP_006411489.1| hypothetical protein EUTSA_v10016847mg [Eutrema salsugineum]
 dbj|BAJ34249.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52942.1| hypothetical protein EUTSA_v10016847mg [Eutrema salsugineum]
Length=363

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  278  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDY  337

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L DNRA C+C  K
Sbjct  338  IKDLQRQYKILNDNRANCKCKEK  360



>ref|XP_007014952.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 4, partial [Theobroma cacao]
 gb|EOY32571.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 4, partial [Theobroma cacao]
Length=211

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 109/174 (63%), Gaps = 26/174 (15%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-------------AKAP  543
             GF E++    +Y S FP+ SW+D  +       ++D  P +K                 
Sbjct  47   AGFGENR--HNNYSSGFPVTSWEDSMM-------ISDNMPGVKRLREDDRSLSGLDLDGA  97

Query  542  DFKNTEGSRSRPPGRlshhlslpksseels----siLQDSVPCRVRAKRGCATHPRSIAE  375
            + +NT+     PP    H      S+E  +       QDSVPC++RAKRGCATHPRSIAE
Sbjct  98   ETQNTDAGNRPPPILAHHLSLPKSSAEMSAIDKFLQYQDSVPCKIRAKRGCATHPRSIAE  157

Query  374  RVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAK  213
            RVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+ +VK L+DNRAK
Sbjct  158  RVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQNQVKTLSDNRAK  211



>ref|XP_009769873.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Nicotiana 
sylvestris]
Length=231

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD++PC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  144  QDTIPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  203

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++ K L D+RA C+CS
Sbjct  204  IKDLQKQYKTLTDHRANCKCS  224



>gb|EYU39897.1| hypothetical protein MIMGU_mgv1a025138mg [Erythranthe guttata]
Length=330

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  239  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  298

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK L+++ K L D+RA C+CS
Sbjct  299  IKSLQKQYKILGDSRANCKCS  319



>ref|XP_004304314.1| PREDICTED: transcription factor bHLH130 [Fragaria vesca subsp. 
vesca]
Length=319

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  228  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  287

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IK+L+++ K L+D RA C+C
Sbjct  288  IKELQKQFKSLSDVRANCKC  307



>emb|CBI24857.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQEL PNMDKQTNTADMLDLAV+Y
Sbjct  164  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELFPNMDKQTNTADMLDLAVEY  223

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L D + KC CS
Sbjct  224  IKDLQKQVKTLNDTKVKCTCS  244



>ref|XP_010257364.1| PREDICTED: transcription factor bHLH130-like [Nelumbo nucifera]
Length=467

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDL+V+Y
Sbjct  376  QDSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLSVEY  435

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D RA C CS+K
Sbjct  436  IKDLQKQVKTLTDKRANCTCSSK  458



>ref|XP_006493662.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Citrus 
sinensis]
 ref|XP_006493663.1| PREDICTED: transcription factor bHLH122-like isoform X2 [Citrus 
sinensis]
 gb|KDO64853.1| hypothetical protein CISIN_1g015337mg [Citrus sinensis]
 gb|KDO64854.1| hypothetical protein CISIN_1g015337mg [Citrus sinensis]
Length=408

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  323  QDSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTADMLDLAVDY  382

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            +K+L+ +VK L+DNRAKC C+
Sbjct  383  VKELQCQVKALSDNRAKCTCA  403



>ref|XP_010928471.1| PREDICTED: transcription factor bHLH130-like [Elaeis guineensis]
Length=453

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  361  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  420

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L+++RA C CS
Sbjct  421  IKDLQKQVKALSESRASCTCS  441



>ref|XP_006446031.1| hypothetical protein CICLE_v10015437mg [Citrus clementina]
 ref|XP_006446032.1| hypothetical protein CICLE_v10015437mg [Citrus clementina]
 gb|ESR59271.1| hypothetical protein CICLE_v10015437mg [Citrus clementina]
 gb|ESR59272.1| hypothetical protein CICLE_v10015437mg [Citrus clementina]
Length=408

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  323  QDSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTADMLDLAVDY  382

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            +K+L+ +VK L+DNRAKC C+
Sbjct  383  VKELQCQVKALSDNRAKCTCA  403



>emb|CAN62935.1| hypothetical protein VITISV_008845 [Vitis vinifera]
Length=394

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  303  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  362

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++   L DNRA C+C  K
Sbjct  363  IKDLQKQYNTLTDNRAHCKCLGK  385



>tpg|DAA40391.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=244

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  153  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTADMLDLAVDY  212

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++VK L D RA C CS 
Sbjct  213  IKDLQKQVKVLNDGRANCTCSG  234



>ref|XP_002277274.1| PREDICTED: transcription factor bHLH130-like [Vitis vinifera]
Length=405

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  314  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  373

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++   L DNRA C+C  K
Sbjct  374  IKDLQKQYNTLTDNRAHCKCLGK  396



>ref|XP_003592465.1| Transcription factor bHLH130 [Medicago truncatula]
 gb|KEH30252.1| transcription factor bHLH122-like protein [Medicago truncatula]
Length=433

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNT+DMLDLAV+YI
Sbjct  349  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTSDMLDLAVEYI  408

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+ +V+ L+DNRAKC CS+K
Sbjct  409  KDLQNQVETLSDNRAKCTCSHK  430



>ref|XP_011020282.1| PREDICTED: transcription factor bHLH130-like [Populus euphratica]
Length=322

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQT+TADMLDLAV Y
Sbjct  231  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTSTADMLDLAVVY  290

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L+DNRA C+C +K
Sbjct  291  IKDLQKQYKTLSDNRANCKCLSK  313



>ref|XP_010554850.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Tarenaya 
hassleriana]
Length=365

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAV+Y
Sbjct  278  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVEY  337

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L++ RA C+C NK
Sbjct  338  IKDLQRQFKILSETRAHCKCFNK  360



>ref|XP_011080320.1| PREDICTED: transcription factor bHLH130-like [Sesamum indicum]
Length=420

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRG ATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNT+DMLDLAVDY
Sbjct  332  QDSVPCKIRAKRGFATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTSDMLDLAVDY  391

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L+DNRAKC CS K
Sbjct  392  IKDLQRQVKTLSDNRAKCSCSAK  414



>ref|XP_009769857.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769864.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nicotiana 
sylvestris]
Length=348

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD++PC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  261  QDTIPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  320

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++ K L D+RA C+CS
Sbjct  321  IKDLQKQYKTLTDHRANCKCS  341



>ref|XP_011042059.1| PREDICTED: transcription factor bHLH122-like isoform X3 [Populus 
euphratica]
Length=429

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 112/165 (68%), Gaps = 9/165 (5%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLK-VTDEKPSLKAKAPDFKNTEGSRSRP  507
            GGF E  T   +Y   +PI SWDD  ++S    + +TD+  +L          E + +RP
Sbjct  257  GGFGE--TPGNNY--DYPIGSWDDSAVMSTGSKRHLTDDDRTLSGLNSSGTQNEEAGNRP  312

Query  506  PGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMR  339
            P    H      S   S+ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMR
Sbjct  313  PMLAHHLSLPKTSAEMSTIENFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERMR  372

Query  338  KLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRC  204
            KLQ+LVPNMDKQTNT+DMLDLAVDYIKDL+++ K L++NRA+C C
Sbjct  373  KLQDLVPNMDKQTNTSDMLDLAVDYIKDLQRQFKALSENRARCTC  417



>gb|EMT21364.1| Transcription factor bHLH130 [Aegilops tauschii]
Length=221

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  132  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  191

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+++VK + ++RA C CS
Sbjct  192  IKELQEQVKVINESRANCTCS  212



>gb|EAZ07555.1| hypothetical protein OsI_29809 [Oryza sativa Indica Group]
Length=403

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  315  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  374

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D+RA C CS K
Sbjct  375  IKDLQKQVKGLNDSRANCTCSAK  397



>ref|NP_001062190.1| Os08g0506700 [Oryza sativa Japonica Group]
 dbj|BAD10188.1| putative transcription factor RAU1 [Oryza sativa Japonica Group]
 dbj|BAF24104.1| Os08g0506700 [Oryza sativa Japonica Group]
 gb|EAZ43276.1| hypothetical protein OsJ_27873 [Oryza sativa Japonica Group]
 dbj|BAG94449.1| unnamed protein product [Oryza sativa Japonica Group]
Length=399

 Score =   149 bits (376),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  311  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  370

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D+RA C CS K
Sbjct  371  IKDLQKQVKGLNDSRANCTCSAK  393



>ref|XP_004229606.1| PREDICTED: transcription factor bHLH130-like [Solanum lycopersicum]
Length=407

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAER+RRTRIS+RM+KLQ+L PNMDKQTNTADMLDLAVDY
Sbjct  316  QDSVPCKIRAKRGCATHPRSIAERMRRTRISERMKKLQDLFPNMDKQTNTADMLDLAVDY  375

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++V+ L D +AKC C++K
Sbjct  376  IKDLQKQVQTLTDKKAKCSCTSK  398



>emb|CDP07732.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAER+RRTRIS+RM+KLQEL PNMDKQTNTADMLDLAV+Y
Sbjct  237  QDSVPCKIRAKRGCATHPRSIAERMRRTRISERMKKLQELFPNMDKQTNTADMLDLAVEY  296

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+ +V+ L + RAKC CS+K
Sbjct  297  IKDLQNQVQTLTETRAKCICSSK  319



>ref|XP_003540708.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Glycine 
max]
 ref|XP_006592167.1| PREDICTED: transcription factor bHLH122-like isoform X2 [Glycine 
max]
Length=415

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAV+YI
Sbjct  331  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVEYI  390

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+ +V+ L+DNRAKC C +K
Sbjct  391  KDLQNQVEALSDNRAKCTCLHK  412



>gb|KHG25713.1| Transcription factor protein [Gossypium arboreum]
Length=347

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  256  QDPVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  315

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L D RA C+C N
Sbjct  316  IKDLQKQFKTLNDRRANCKCLN  337



>ref|XP_003633592.1| PREDICTED: transcription factor bHLH130-like [Vitis vinifera]
Length=408

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQEL PNMDKQTNTADMLDLAV+Y
Sbjct  326  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELFPNMDKQTNTADMLDLAVEY  385

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L D + KC CS
Sbjct  386  IKDLQKQVKTLNDTKVKCTCS  406



>ref|XP_002304761.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE79740.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=422

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 115/166 (69%), Gaps = 10/166 (6%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLK-VTDEKPSLKA-KAPDFKNTEGSRSR  510
            GGF E  T   +Y   +PI SWDD  ++S    + +TD+  +L    + + +  E + +R
Sbjct  255  GGFGE--TPGNNY--DYPIGSWDDSAVMSTGSKRYLTDDDRTLSGLNSSETQQNEEAGNR  310

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S   S+ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  311  PPMLAHHLSLPKTSAEMSTIENFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERM  370

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRC  204
            RKLQ+LVPNMDKQTNT+DMLDLAVDYIKDL+++ K L++NRA+C C
Sbjct  371  RKLQDLVPNMDKQTNTSDMLDLAVDYIKDLQRQFKALSENRARCTC  416



>gb|EPS67038.1| hypothetical protein M569_07739, partial [Genlisea aurea]
Length=78

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = -1

Query  434  VPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKD  255
            VPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLD AVDYIKD
Sbjct  1    VPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDFAVDYIKD  60

Query  254  LEQKVKRLADNRAKCRCS  201
            L+++VK L+D+RAKC CS
Sbjct  61   LQRQVKTLSDDRAKCSCS  78



>gb|KDO83349.1| hypothetical protein CISIN_1g0166382mg, partial [Citrus sinensis]
Length=151

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+L PNMDKQTNTA+MLDLAV++
Sbjct  65   QGSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQDLFPNMDKQTNTAEMLDLAVEH  124

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L DN+AKC C NK
Sbjct  125  IKDLQKQVKLLTDNKAKCMCPNK  147



>ref|XP_007131988.1| hypothetical protein PHAVU_011G057400g [Phaseolus vulgaris]
 gb|ESW03982.1| hypothetical protein PHAVU_011G057400g [Phaseolus vulgaris]
Length=416

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLA++YI
Sbjct  330  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAIEYI  389

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++V+ L+DNR KC CS+K
Sbjct  390  KDLQKQVETLSDNRDKCTCSHK  411



>ref|XP_009591240.1| PREDICTED: transcription factor bHLH130-like isoform X3 [Nicotiana 
tomentosiformis]
Length=231

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  437  SVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIK  258
            ++PC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YIK
Sbjct  147  TIPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEYIK  206

Query  257  DLEQKVKRLADNRAKCRCS  201
            DL+++ K L D+RA C+CS
Sbjct  207  DLQKQYKTLTDHRANCKCS  225



>ref|XP_011037864.1| PREDICTED: transcription factor bHLH122-like isoform X4 [Populus 
euphratica]
Length=393

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 107/167 (64%), Gaps = 29/167 (17%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRPP  504
            GG++E  T   +Y+S +PI SWDD                       + +N EG  +RPP
Sbjct  249  GGYSE--TRSSNYVSGYPIGSWDDS----------------------ETQNEEGG-NRPP  283

Query  503  ----GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
                       +   S+ E     QDSVPCR RAKRGCATHPRSIAERVRRTRIS+RMRK
Sbjct  284  VLVHHMSLPKTAAEISAIEKFLQFQDSVPCRTRAKRGCATHPRSIAERVRRTRISERMRK  343

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            LQ+LVPNMDKQTNT+DMLDLA DYIKDL+++V+ L++ RA+C C NK
Sbjct  344  LQDLVPNMDKQTNTSDMLDLAADYIKDLQRQVQTLSEIRARCACINK  390



>ref|XP_009383216.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=377

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLA+ Y
Sbjct  289  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAIGY  348

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++VK LAD+R  C CS+
Sbjct  349  IKDLQKQVKTLADSRESCACSS  370



>ref|XP_008450446.1| PREDICTED: transcription factor bHLH122 isoform X2 [Cucumis melo]
Length=430

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAV+YI
Sbjct  346  DSVPCKLRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVEYI  405

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            K L+++V+ L+DNRAKC+CS+
Sbjct  406  KGLQKQVQTLSDNRAKCKCSH  426



>ref|XP_008450443.1| PREDICTED: transcription factor bHLH122 isoform X1 [Cucumis melo]
 ref|XP_008450444.1| PREDICTED: transcription factor bHLH122 isoform X1 [Cucumis melo]
Length=431

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAV+YI
Sbjct  347  DSVPCKLRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVEYI  406

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            K L+++V+ L+DNRAKC+CS+
Sbjct  407  KGLQKQVQTLSDNRAKCKCSH  427



>ref|XP_011037863.1| PREDICTED: transcription factor bHLH122-like isoform X3 [Populus 
euphratica]
Length=394

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 107/167 (64%), Gaps = 28/167 (17%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKAKAPDFKNTEGSRSRPP  504
            GG++E  T   +Y+S +PI SWDD +                       +N EG  +RPP
Sbjct  249  GGYSE--TRSSNYVSGYPIGSWDDSETQ---------------------QNEEGG-NRPP  284

Query  503  ----GRlshhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRK  336
                       +   S+ E     QDSVPCR RAKRGCATHPRSIAERVRRTRIS+RMRK
Sbjct  285  VLVHHMSLPKTAAEISAIEKFLQFQDSVPCRTRAKRGCATHPRSIAERVRRTRISERMRK  344

Query  335  LQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            LQ+LVPNMDKQTNT+DMLDLA DYIKDL+++V+ L++ RA+C C NK
Sbjct  345  LQDLVPNMDKQTNTSDMLDLAADYIKDLQRQVQTLSEIRARCACINK  391



>gb|KDP37364.1| hypothetical protein JCGZ_06818 [Jatropha curcas]
Length=370

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNM+KQTNTADMLDLAV+Y
Sbjct  279  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMEKQTNTADMLDLAVEY  338

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L+D RA C+C +K
Sbjct  339  IKDLQKQYKTLSDIRANCKCLSK  361



>ref|XP_004139111.1| PREDICTED: transcription factor bHLH122-like [Cucumis sativus]
 gb|KGN66472.1| hypothetical protein Csa_1G612950 [Cucumis sativus]
Length=437

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAV+YI
Sbjct  353  DSVPCKLRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVEYI  412

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            K L+++V+ L+DNRAKC+CS+
Sbjct  413  KGLQKQVQTLSDNRAKCKCSH  433



>ref|XP_009401509.1| PREDICTED: transcription factor bHLH130-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
             D+VPC++RAKRGCATHPRSIAERVRRTRIS+RM+KLQELVPNMDKQTNTADMLDLAVDY
Sbjct  339  HDAVPCKIRAKRGCATHPRSIAERVRRTRISERMKKLQELVPNMDKQTNTADMLDLAVDY  398

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L+++RA C CS
Sbjct  399  IKDLQKQVKALSESRASCSCS  419



>ref|XP_004170093.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH122-like 
[Cucumis sativus]
Length=437

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAV+YI
Sbjct  353  DSVPCKLRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVEYI  412

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            K L+++V+ L+DNRAKC+CS+
Sbjct  413  KGLQKQVQTLSDNRAKCKCSH  433



>gb|KHN30254.1| Transcription factor bHLH130 [Glycine soja]
Length=384

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YI
Sbjct  294  DSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEYI  353

Query  260  KDLEQKVKRLADNRAKCRCS  201
            KDL+++ K L++ RAKC C+
Sbjct  354  KDLQKQFKTLSEKRAKCECT  373



>ref|XP_011042060.1| PREDICTED: transcription factor bHLH122-like isoform X4 [Populus 
euphratica]
Length=428

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 10/166 (6%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLK-VTDEKPSLKA-KAPDFKNTEGSRSR  510
            GGF E  T   +Y   +PI SWDD  ++S    + +TD+  +L    +   +  E + +R
Sbjct  255  GGFGE--TPGNNY--DYPIGSWDDSAVMSTGSKRHLTDDDRTLSGLNSSGTQQNEEAGNR  310

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S   S+ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  311  PPMLAHHLSLPKTSAEMSTIENFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERM  370

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRC  204
            RKLQ+LVPNMDKQTNT+DMLDLAVDYIKDL+++ K L++NRA+C C
Sbjct  371  RKLQDLVPNMDKQTNTSDMLDLAVDYIKDLQRQFKALSENRARCTC  416



>ref|XP_011042057.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Populus 
euphratica]
 ref|XP_011042058.1| PREDICTED: transcription factor bHLH122-like isoform X2 [Populus 
euphratica]
Length=430

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 10/166 (6%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLK-VTDEKPSLKA-KAPDFKNTEGSRSR  510
            GGF E  T   +Y   +PI SWDD  ++S    + +TD+  +L    +   +  E + +R
Sbjct  257  GGFGE--TPGNNY--DYPIGSWDDSAVMSTGSKRHLTDDDRTLSGLNSSGTQQNEEAGNR  312

Query  509  PPGRlsh----hlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAERVRRTRISDRM  342
            PP    H      S   S+ E     QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RM
Sbjct  313  PPMLAHHLSLPKTSAEMSTIENFLQFQDSVPCKIRAKRGCATHPRSIAERVRRTRISERM  372

Query  341  RKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRC  204
            RKLQ+LVPNMDKQTNT+DMLDLAVDYIKDL+++ K L++NRA+C C
Sbjct  373  RKLQDLVPNMDKQTNTSDMLDLAVDYIKDLQRQFKALSENRARCTC  418



>ref|XP_003537191.1| PREDICTED: transcription factor bHLH130-like [Glycine max]
Length=384

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YI
Sbjct  294  DSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEYI  353

Query  260  KDLEQKVKRLADNRAKCRCS  201
            KDL+++ K L++ RAKC C+
Sbjct  354  KDLQKQFKTLSEKRAKCECT  373



>ref|XP_003547061.1| PREDICTED: transcription factor bHLH122-like isoform X1 [Glycine 
max]
Length=411

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYI
Sbjct  327  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYI  386

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++V+ L+D  AKC CS++
Sbjct  387  KDLQKQVQTLSDCHAKCTCSHE  408



>gb|KHN30120.1| Transcription factor bHLH122 [Glycine soja]
Length=408

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 105/158 (66%), Gaps = 7/158 (4%)
 Frame = -1

Query  647  YLSSFPIPSWddldllsddfLKV-----TDEKPSLKAKAPDFKNTEGSRSRPPGRlshhl  483
            +++ F +  WDD  ++SD+   +      D KP     A + +N  G    P        
Sbjct  248  FITGFQVGHWDDAAIMSDNVGGLKRFRENDSKPFSGLNAAETQNETGQTHAPLAHQLSLP  307

Query  482  slpksseelssiLQ--DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMD  309
            +       +   LQ  DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD
Sbjct  308  NTSAEMAAIEKFLQFSDSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMD  367

Query  308  KQTNTADMLDLAVDYIKDLEQKVKRLADNRAKCRCSNK  195
            KQTNTADMLDLAVDYIKDL+++V+ L+D  AKC CS++
Sbjct  368  KQTNTADMLDLAVDYIKDLQKQVQTLSDCHAKCTCSHE  405



>gb|KHN33332.1| Transcription factor bHLH122 [Glycine soja]
Length=411

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYI
Sbjct  327  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYI  386

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++V+ L+D  AKC CS++
Sbjct  387  KDLQKQVQTLSDCHAKCTCSHE  408



>ref|XP_003543549.1| PREDICTED: transcription factor bHLH122 [Glycine max]
Length=408

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYI
Sbjct  324  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYI  383

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++V+ L+D  AKC CS++
Sbjct  384  KDLQKQVQTLSDCHAKCTCSHE  405



>ref|XP_009757642.1| PREDICTED: transcription factor bHLH130-like [Nicotiana sylvestris]
Length=413

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAER+RRTRIS+RM+KLQ+L PNMDKQTNTADMLDLAVDY
Sbjct  322  QDSVPCKIRAKRGCATHPRSIAERMRRTRISERMKKLQDLFPNMDKQTNTADMLDLAVDY  381

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++V+ L D +AKC C +K
Sbjct  382  IKDLQKQVQTLTDKKAKCSCPSK  404



>ref|XP_008670282.1| PREDICTED: transcription factor bHLH130-like [Zea mays]
Length=406

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  315  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTADMLDLAVDY  374

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++VK L D RA C CS 
Sbjct  375  IKDLQKQVKVLNDGRANCTCSG  396



>ref|XP_008795725.1| PREDICTED: transcription factor bHLH130-like [Phoenix dactylifera]
Length=453

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  361  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  420

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+ +VK L++ RA C CS
Sbjct  421  IKELQTQVKTLSETRASCTCS  441



>gb|KDP43444.1| hypothetical protein JCGZ_16731 [Jatropha curcas]
Length=421

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQ+L PNMDKQTNTADMLDLAV+Y
Sbjct  330  QGSVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQDLFPNMDKQTNTADMLDLAVEY  389

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D RAKC C +K
Sbjct  390  IKDLQKQVKTLTDTRAKCTCPSK  412



>ref|XP_007145653.1| hypothetical protein PHAVU_007G257100g [Phaseolus vulgaris]
 gb|ESW17647.1| hypothetical protein PHAVU_007G257100g [Phaseolus vulgaris]
Length=383

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC+ RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YI
Sbjct  297  DSVPCKTRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEYI  356

Query  260  KDLEQKVKRLADNRAKCRCS  201
            KDL+++ K L D RA C+CS
Sbjct  357  KDLQKQFKTLCDKRANCKCS  376



>ref|XP_004497939.1| PREDICTED: transcription factor bHLH130-like [Cicer arietinum]
Length=381

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTADMLDLAVDYI
Sbjct  292  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTADMLDLAVDYI  351

Query  260  KDLEQKVKRLADNRAKCRC  204
            K+L+++ K L++ RA C+C
Sbjct  352  KNLQKQFKSLSEKRASCKC  370



>ref|XP_009591238.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Nicotiana 
tomentosiformis]
Length=349

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  437  SVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIK  258
            ++PC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+YIK
Sbjct  265  TIPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEYIK  324

Query  257  DLEQKVKRLADNRAKCRCS  201
            DL+++ K L D+RA C+CS
Sbjct  325  DLQKQYKTLTDHRANCKCS  343



>ref|XP_010672727.1| PREDICTED: transcription factor bHLH130 [Beta vulgaris subsp. 
vulgaris]
Length=300

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD VPC+VRAKRGCATHPRSIAER+RR RIS+RMRKLQELVPNMDKQTNTADMLD AVDY
Sbjct  219  QDVVPCKVRAKRGCATHPRSIAERMRRNRISERMRKLQELVPNMDKQTNTADMLDFAVDY  278

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IK+L+ + K L+DNRA+C+C N
Sbjct  279  IKNLQNQHKILSDNRARCKCLN  300



>ref|XP_006351215.1| PREDICTED: transcription factor bHLH130-like [Solanum tuberosum]
Length=342

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD++PC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  256  QDTIPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  315

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK L+++ K L D RA C+CS
Sbjct  316  IKGLQKQYKVLTDCRANCKCS  336



>ref|NP_001151233.1| helix-loop-helix DNA-binding domain containing protein [Zea mays]
 gb|ACG42080.1| helix-loop-helix DNA-binding domain containing protein [Zea mays]
 tpg|DAA62031.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=408

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  318  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTADMLDLAVDY  377

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L D RA C CS
Sbjct  378  IKDLQKQVKVLNDGRASCTCS  398



>dbj|BAJ85853.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  300  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  359

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+++VK + ++RA C CS
Sbjct  360  IKELQEQVKVINESRASCTCS  380



>ref|XP_003574744.1| PREDICTED: transcription factor bHLH130-like [Brachypodium distachyon]
Length=377

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  293  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMDKQTNTADMLDLAVDY  352

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+++VK + ++RA C CS
Sbjct  353  IKELQEQVKVINESRANCTCS  373



>gb|KEH41576.1| transcription factor bHLH122-like protein [Medicago truncatula]
Length=382

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAER+RRT+IS+RMRKLQELVPNMDKQTNT+DMLDLAVDYI
Sbjct  292  DSVPCKIRAKRGCATHPRSIAERLRRTKISERMRKLQELVPNMDKQTNTSDMLDLAVDYI  351

Query  260  KDLEQKVKRLADNRAKCRC  204
            K+L+++ K L+D RA C+C
Sbjct  352  KNLQKQFKSLSDKRANCKC  370



>emb|CDY22828.1| BnaA06g02490D [Brassica napus]
Length=361

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  280  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  339

Query  260  KDLEQKVKRLADNRAKCRCS  201
            KDL+++VK L D+RA+CRCS
Sbjct  340  KDLQEQVKGLEDSRARCRCS  359



>ref|XP_010461947.1| PREDICTED: transcription factor bHLH122-like [Camelina sativa]
Length=382

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  301  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  360

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+ +VK L +NRA+CRCS+
Sbjct  361  KDLQDQVKALEENRARCRCSS  381



>ref|XP_010500685.1| PREDICTED: transcription factor bHLH122-like [Camelina sativa]
Length=381

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  300  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  359

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+ +VK L +NRA+CRCS+
Sbjct  360  KDLQDQVKALEENRARCRCSS  380



>ref|XP_009391823.1| PREDICTED: transcription factor bHLH130-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  276  QDAVPCRTRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTADMLDLAVDY  335

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            I DL+++VK L + RA C CS
Sbjct  336  IHDLQKQVKALTEGRASCTCS  356



>ref|XP_002894296.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70555.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  297  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  356

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+++VK L + RA+CRCS+
Sbjct  357  KDLQEQVKTLEETRARCRCSS  377



>ref|XP_004249190.1| PREDICTED: transcription factor bHLH130-like [Solanum lycopersicum]
Length=380

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD++PC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAV+Y
Sbjct  294  QDTIPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVEY  353

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK L+++ K L D RA C+CS
Sbjct  354  IKGLQKQYKVLTDCRANCKCS  374



>ref|NP_564583.1| transcription factor bHLH122 [Arabidopsis thaliana]
 sp|Q9C690.1|BH122_ARATH RecName: Full=Transcription factor bHLH122; AltName: Full=Basic 
helix-loop-helix protein 122; Short=AtbHLH122; Short=bHLH 
122; AltName: Full=Transcription factor EN 70; AltName: Full=bHLH 
transcription factor bHLH122 [Arabidopsis thaliana]
 gb|AAG50543.1|AC079828_14 unknown protein [Arabidopsis thaliana]
 gb|AAK59447.1| unknown protein [Arabidopsis thaliana]
 gb|AAL34294.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32626.1| transcription factor bHLH122 [Arabidopsis thaliana]
Length=379

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  298  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  357

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+++VK L ++RA+CRCS+
Sbjct  358  KDLQEQVKALEESRARCRCSS  378



>emb|CDP10093.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+LVPNMDKQT+TADMLDLAV+Y
Sbjct  330  QDTVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQDLVPNMDKQTSTADMLDLAVEY  389

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++ K L+D RA C+CS
Sbjct  390  IKDLQKQYKTLSDIRANCKCS  410



>ref|XP_004973867.1| PREDICTED: transcription factor bHLH130-like [Setaria italica]
Length=371

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  282  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  341

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L ++RA C CS
Sbjct  342  IKDLQKQVKVLNESRANCTCS  362



>ref|XP_009768432.1| PREDICTED: transcription factor bHLH130-like [Nicotiana sylvestris]
Length=357

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q++VPC+VRAKRG ATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLAVDY
Sbjct  266  QETVPCKVRAKRGFATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAVDY  325

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++ K L D RA C+C+
Sbjct  326  IKDLQKQYKTLTDCRANCKCA  346



>ref|XP_008776552.1| PREDICTED: transcription factor bHLH130-like [Phoenix dactylifera]
Length=453

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR+RAKRGCATHPRSIAERVRRT+IS+RMRKLQELVPNMDKQTNTADMLD AV Y
Sbjct  361  QDAVPCRIRAKRGCATHPRSIAERVRRTKISERMRKLQELVPNMDKQTNTADMLDFAVVY  420

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L+++RA C CS
Sbjct  421  IKDLQKQVKTLSESRAGCTCS  441



>ref|XP_010479574.1| PREDICTED: transcription factor bHLH122-like [Camelina sativa]
Length=376

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  295  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  354

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+ +VK L DNRA+C CS+
Sbjct  355  KDLQDQVKALEDNRARCTCSS  375



>ref|XP_004486946.1| PREDICTED: transcription factor bHLH122-like [Cicer arietinum]
Length=416

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVP ++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNM+KQTNTADMLDLAVDYI
Sbjct  332  DSVPMKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMEKQTNTADMLDLAVDYI  391

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+ +V+ L+D RAKC CS+K
Sbjct  392  KDLQNQVQTLSDCRAKCTCSHK  413



>ref|XP_011087339.1| PREDICTED: transcription factor bHLH130-like [Sesamum indicum]
Length=429

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAER+RRTRIS++M+KLQ+L PNMDKQTNTADMLDLAV+Y
Sbjct  339  QDTVPCQIRAKRGCATHPRSIAERMRRTRISEKMKKLQDLFPNMDKQTNTADMLDLAVEY  398

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++V+ L++ RAKC CS K
Sbjct  399  IKDLQKQVQTLSETRAKCSCSTK  421



>ref|XP_003519049.1| PREDICTED: transcription factor bHLH130-like [Glycine max]
 gb|KHN26292.1| Transcription factor bHLH130 [Glycine soja]
Length=378

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVP+MDKQTNTADMLDLAV+YI
Sbjct  288  DSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPHMDKQTNTADMLDLAVEYI  347

Query  260  KDLEQKVKRLADNRAKCRC  204
            KDL+++ K L++ RA C+C
Sbjct  348  KDLQKQFKTLSEKRANCKC  366



>ref|XP_010524295.1| PREDICTED: transcription factor bHLH130 [Tarenaya hassleriana]
Length=351

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNM+KQTNT+DMLDLAV+Y
Sbjct  264  QGSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMNKQTNTSDMLDLAVEY  323

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++ K L++ RA CRC N+
Sbjct  324  IKDLQRQFKVLSEIRANCRCVNE  346



>emb|CDY25213.1| BnaC06g04380D [Brassica napus]
Length=364

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  283  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  342

Query  260  KDLEQKVKRLADNRAKCRCS  201
            KDL+++VK L ++RA+CRCS
Sbjct  343  KDLQEQVKGLEESRARCRCS  362



>emb|CBI39322.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   139 bits (350),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  98   EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  157

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+QK++ L++++ KC C
Sbjct  158  VKFLQQKIQELSEHQKKCTC  177



>ref|XP_009147780.1| PREDICTED: transcription factor bHLH122 [Brassica rapa]
Length=361

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  280  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  339

Query  260  KDLEQKVKRLADNRAKCRCS  201
            KDL+++VK L ++RA+CRCS
Sbjct  340  KDLQEQVKGLEESRARCRCS  359



>ref|XP_010913124.1| PREDICTED: transcription factor bHLH130-like [Elaeis guineensis]
Length=454

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR+RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLD AV Y
Sbjct  362  QDAVPCRIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDFAVVY  421

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L+++RA C C
Sbjct  422  IKDLQKQVKTLSESRASCTC  441



>ref|XP_007052582.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX96739.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=431

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQ L PNM+KQTNTADMLD+AV+Y
Sbjct  340  QGSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQGLFPNMEKQTNTADMLDMAVEY  399

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D +AKC CS+K
Sbjct  400  IKDLQKQVKTLTDTKAKCSCSSK  422



>ref|XP_004957179.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Setaria 
italica]
Length=397

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  306  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTADMLDLAVDY  365

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L D R  C CS
Sbjct  366  IKDLQKQVKVLNDGRISCTCS  386



>ref|XP_006393076.1| hypothetical protein EUTSA_v10011463mg [Eutrema salsugineum]
 gb|ESQ30362.1| hypothetical protein EUTSA_v10011463mg [Eutrema salsugineum]
Length=459

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  378  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  437

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+++VK L ++RA+CRCS+
Sbjct  438  KDLQEQVKELEESRARCRCSS  458



>gb|EAZ45183.1| hypothetical protein OsJ_29826 [Oryza sativa Japonica Group]
Length=379

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  290  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMEKQTNTADMLDLAVDY  349

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+++VK L D+R+ C CS
Sbjct  350  IKELQKQVKVLNDSRSSCTCS  370



>ref|XP_009419180.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=390

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR+RAKRGCATHPRSIAERVRRT+IS+RM+KLQE+VPNMDKQTNTADML+LAVDY
Sbjct  293  QDAVPCRIRAKRGCATHPRSIAERVRRTKISERMKKLQEVVPNMDKQTNTADMLNLAVDY  352

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L + RA C C
Sbjct  353  IKDLQKQVKTLTEGRASCSC  372



>ref|NP_001063529.1| Os09g0487900 [Oryza sativa Japonica Group]
 dbj|BAF25443.1| Os09g0487900 [Oryza sativa Japonica Group]
Length=401

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  312  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMEKQTNTADMLDLAVDY  371

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+++VK L D+R+ C CS
Sbjct  372  IKELQKQVKVLNDSRSSCTCS  392



>gb|EPS68391.1| hypothetical protein M569_06378, partial [Genlisea aurea]
Length=83

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  437  SVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIK  258
            +V C++RAKRGCATHPRSIAER+RRTRIS+RMRKLQELVPNMDKQTNTADMLDL V+Y+K
Sbjct  4    TVTCKIRAKRGCATHPRSIAERMRRTRISERMRKLQELVPNMDKQTNTADMLDLTVEYVK  63

Query  257  DLEQKVKRLADNRAKCRCSN  198
            DL+++ K L DN+A C+CS+
Sbjct  64   DLQKQYKTLCDNQASCKCSS  83



>ref|XP_009419179.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=415

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPCR+RAKRGCATHPRSIAERVRRT+IS+RM+KLQE+VPNMDKQTNTADML+LAVDY
Sbjct  318  QDAVPCRIRAKRGCATHPRSIAERVRRTKISERMKKLQEVVPNMDKQTNTADMLNLAVDY  377

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L + RA C C
Sbjct  378  IKDLQKQVKTLTEGRASCSC  397



>gb|EAZ09563.1| hypothetical protein OsI_31842 [Oryza sativa Indica Group]
Length=400

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+R+RKLQELVPNM+KQTNTADMLDLAVDY
Sbjct  311  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERIRKLQELVPNMEKQTNTADMLDLAVDY  370

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+++VK L D+R+ C CS
Sbjct  371  IKELQKQVKVLNDSRSSCTCS  391



>ref|XP_010554849.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Tarenaya 
hassleriana]
Length=374

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 79/92 (86%), Gaps = 9/92 (10%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAV+Y
Sbjct  278  QDSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVEY  337

Query  263  IKDLE---------QKVKRLADNRAKCRCSNK  195
            IKDL+         Q+++ L++ RA C+C NK
Sbjct  338  IKDLQRQFKVKTLLQQMQILSETRAHCKCFNK  369



>ref|XP_002445905.1| hypothetical protein SORBIDRAFT_07g027810 [Sorghum bicolor]
 gb|EES15400.1| hypothetical protein SORBIDRAFT_07g027810 [Sorghum bicolor]
Length=399

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  310  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  369

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L ++RA C C
Sbjct  370  IKDLQKQVKALNESRASCTC  389



>ref|XP_004957993.1| PREDICTED: transcription factor bHLH130-like isoform X5 [Setaria 
italica]
Length=381

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  292  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  351

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L ++ A C CS
Sbjct  352  IKDLQKQVKVLKESHANCTCS  372



>ref|XP_010547953.1| PREDICTED: transcription factor bHLH130-like [Tarenaya hassleriana]
Length=351

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVP  +RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+LVPNMDKQTNTADMLDLAV+Y
Sbjct  264  QDSVPWNIRAKRGCATHPRSIAERVRRTRISERMRKLQDLVPNMDKQTNTADMLDLAVEY  323

Query  263  IKDLEQKVKRLADNRAKCRCSN  198
            IKDL+++ K L++NR  C+C N
Sbjct  324  IKDLQRQFKILSENRVNCKCFN  345



>ref|XP_002314023.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE87978.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=421

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            +SVPC++RAKRG ATHPRSIAERVRRTRIS+RMRKLQEL PNMDKQTNTADMLDLAV++I
Sbjct  331  NSVPCKIRAKRGFATHPRSIAERVRRTRISERMRKLQELFPNMDKQTNTADMLDLAVEHI  390

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++VK L D +AKC CS+K
Sbjct  391  KDLQKQVKTLTDTKAKCTCSSK  412



>ref|XP_006305091.1| hypothetical protein CARUB_v10009458mg [Capsella rubella]
 gb|EOA37989.1| hypothetical protein CARUB_v10009458mg [Capsella rubella]
Length=377

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DS+PC++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMD QTNTADMLDLAV YI
Sbjct  296  DSIPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDTQTNTADMLDLAVQYI  355

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+ +VK L + RA+CRCS+
Sbjct  356  KDLQDQVKALEEARARCRCSS  376



>ref|XP_011007348.1| PREDICTED: transcription factor bHLH130-like [Populus euphratica]
 ref|XP_011007349.1| PREDICTED: transcription factor bHLH130-like [Populus euphratica]
Length=421

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            +SVPC++RAKRG ATHPRSIAERVRRTRIS+RMRKLQEL PNMDKQTNTADMLDLAV++I
Sbjct  331  NSVPCKIRAKRGFATHPRSIAERVRRTRISERMRKLQELFPNMDKQTNTADMLDLAVEHI  390

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++VK L D +AKC CS+K
Sbjct  391  KDLQKQVKTLTDTKAKCTCSSK  412



>ref|NP_001147910.1| DNA binding protein [Zea mays]
 gb|ACG29090.1| DNA binding protein [Zea mays]
Length=380

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC+VRAKRGCATHPRSIAERVRRT+IS+R+RKLQELVP+MDKQTNT+DMLDLAVDY
Sbjct  290  QDAVPCKVRAKRGCATHPRSIAERVRRTKISERIRKLQELVPDMDKQTNTSDMLDLAVDY  349

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L ++RA C C
Sbjct  350  IKDLQKQVKALNESRASCTC  369



>ref|XP_008672522.1| PREDICTED: uncharacterized protein LOC100279237 isoform X2 [Zea 
mays]
 tpg|DAA47960.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=380

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC+VRAKRGCATHPRSIAERVRRT+IS+R+RKLQELVP+MDKQTNT+DMLDLAVDY
Sbjct  290  QDAVPCKVRAKRGCATHPRSIAERVRRTKISERIRKLQELVPDMDKQTNTSDMLDLAVDY  349

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L ++RA C C
Sbjct  350  IKDLQKQVKALNESRASCTC  369



>ref|XP_006482911.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Citrus 
sinensis]
 ref|XP_006482912.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Citrus 
sinensis]
Length=427

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+L PNMDKQTNTA+MLDLAV++
Sbjct  341  QGSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQDLFPNMDKQTNTAEMLDLAVEH  400

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D +AKC C NK
Sbjct  401  IKDLQKQVKLLTDKKAKCMCPNK  423



>tpg|DAA47963.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=277

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC+VRAKRGCATHPRSIAERVRRT+IS+R+RKLQELVP+MDKQTNT+DMLDLAVDY
Sbjct  187  QDAVPCKVRAKRGCATHPRSIAERVRRTKISERIRKLQELVPDMDKQTNTSDMLDLAVDY  246

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L ++RA C C
Sbjct  247  IKDLQKQVKALNESRASCTC  266



>ref|XP_006438974.1| hypothetical protein CICLE_v10031622mg [Citrus clementina]
 ref|XP_006438975.1| hypothetical protein CICLE_v10031622mg [Citrus clementina]
 gb|ESR52214.1| hypothetical protein CICLE_v10031622mg [Citrus clementina]
 gb|ESR52215.1| hypothetical protein CICLE_v10031622mg [Citrus clementina]
Length=427

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQ+L PNMDKQTNTA+MLDLAV++
Sbjct  341  QGSVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQDLFPNMDKQTNTAEMLDLAVEH  400

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D +AKC C NK
Sbjct  401  IKDLQKQVKLLTDKKAKCMCPNK  423



>ref|XP_007014951.1| DNA binding protein, putative isoform 3, partial [Theobroma cacao]
 gb|EOY32570.1| DNA binding protein, putative isoform 3, partial [Theobroma cacao]
Length=424

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 108/175 (62%), Gaps = 28/175 (16%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLK-------------AKAP  543
             GF E++    +Y S FP+ SW+D  +       ++D  P +K                 
Sbjct  261  AGFGENR--HNNYSSGFPVTSWEDSMM-------ISDNMPGVKRLREDDRSLSGLDLDGA  311

Query  542  DFKNTEGSRSRPPGRlshhlslpksseelss----iLQDSVPCRVRAKRGCATHPRSIAE  375
            + +NT+     PP    H      S+E  +       QDSVPC++RAKRGCATHPRSIAE
Sbjct  312  ETQNTDAGNRPPPILAHHLSLPKSSAEMSAIDKFLQYQDSVPCKIRAKRGCATHPRSIAE  371

Query  374  RVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKC  210
            RVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYIKDL+ +   L+DNRAKC
Sbjct  372  RVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYIKDLQNQT--LSDNRAKC  424



>ref|XP_009590362.1| PREDICTED: transcription factor bHLH130-like [Nicotiana tomentosiformis]
Length=358

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q+ VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNM+KQT TADMLDLAVDY
Sbjct  267  QEIVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMEKQTKTADMLDLAVDY  326

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++ K L D RA C+C+
Sbjct  327  IKDLQKQYKTLTDCRANCKCA  347



>dbj|BAK02702.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNT+DMLDLAVDY
Sbjct  317  QDSVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTSDMLDLAVDY  376

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+ +VK + D RA C CS
Sbjct  377  IKELQMQVKVMNDGRAGCTCS  397



>ref|XP_002271390.1| PREDICTED: transcription factor bHLH80-like isoform X2 [Vitis 
vinifera]
Length=251

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  168  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  227

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+QK++ L++++ KC C
Sbjct  228  VKFLQQKIQELSEHQKKCTC  247



>ref|XP_009612393.1| PREDICTED: transcription factor bHLH130-like [Nicotiana tomentosiformis]
Length=411

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRGCATHPRSIAER+RRTRIS RM+KL +L PNMDKQTNTADMLDLAVDY
Sbjct  320  QDSVPCKIRAKRGCATHPRSIAERMRRTRISQRMKKLHDLFPNMDKQTNTADMLDLAVDY  379

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++V+ L D +A C C +K
Sbjct  380  IKDLQKQVQTLTDKKATCSCPSK  402



>ref|XP_004957991.1| PREDICTED: transcription factor bHLH130-like isoform X3 [Setaria 
italica]
Length=438

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  349  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  408

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L ++ A C CS
Sbjct  409  IKDLQKQVKVLKESHANCTCS  429



>emb|CAN80884.1| hypothetical protein VITISV_018653 [Vitis vinifera]
Length=446

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 107/174 (61%), Gaps = 26/174 (15%)
 Frame = -1

Query  683  GGFNEDQTMDESYLSSFPIPSWddldllsddfLKVTDEKPSLKA----KAPDFKNTEGSR  516
            G F E  +    +++ FPI SWDD  +       +++   SLK+    +A  F     S 
Sbjct  266  GSFGEGHSNSGGFITGFPIGSWDDSAI-------MSESFSSLKSVRDDEAKTFSGLNASE  318

Query  515  S-------RPPGRls-----hhlslpksseelssiLQDSVPCRVRAKRGCATHPRSIAER  372
            +       RPP            S   ++ E     QDSVPC++RAKRGCATHPRSIAER
Sbjct  319  AQKGEPANRPPVLAHHLSLPTKTSADLTTIEKYLQFQDSVPCKIRAKRGCATHPRSIAER  378

Query  371  VRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIKDLEQKVKRLADNRAKC  210
            VRRTRIS+RMRKLQELVPNMDKQTNT+DMLDLAVDYIKDL+++VKR   NR K 
Sbjct  379  VRRTRISERMRKLQELVPNMDKQTNTSDMLDLAVDYIKDLQKQVKR---NRKKA  429



>ref|XP_002513187.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF49178.1| DNA binding protein, putative [Ricinus communis]
Length=432

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRG ATHPRSIAERVRRTRIS+RMRKLQ+L PNMDKQTNTADMLDLAV+Y
Sbjct  343  QGSVPCKIRAKRGFATHPRSIAERVRRTRISERMRKLQDLFPNMDKQTNTADMLDLAVEY  402

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D +AKC C +K
Sbjct  403  IKDLQKQVKTLKDTKAKCTCPSK  425



>ref|XP_010536057.1| PREDICTED: transcription factor bHLH122 [Tarenaya hassleriana]
 ref|XP_010536058.1| PREDICTED: transcription factor bHLH122 [Tarenaya hassleriana]
 ref|XP_010536059.1| PREDICTED: transcription factor bHLH122 [Tarenaya hassleriana]
Length=350

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRGCATHPRSIAERVRRT+IS+RM+KLQ+LVPNMDKQTNTADMLDLAVD+I
Sbjct  267  DSVPCKIRAKRGCATHPRSIAERVRRTKISERMKKLQDLVPNMDKQTNTADMLDLAVDHI  326

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+++++ L ++RA+C CS+
Sbjct  327  KDLQERLRILQEDRARCTCSS  347



>ref|XP_003597460.1| Transcription factor bHLH122 [Medicago truncatula]
 gb|AES67711.1| transcription factor bHLH122-like protein [Medicago truncatula]
Length=412

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVP ++RAKRGCATHPRSIAERVRRT+IS+RMRKLQ+LVPNMDKQTNTADMLDLAVDYI
Sbjct  326  DSVPMKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDKQTNTADMLDLAVDYI  385

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            KDL+++ ++L D +AKC C +K
Sbjct  386  KDLQKQAQKLQDCQAKCTCPHK  407



>ref|XP_010238294.1| PREDICTED: transcription factor bHLH130-like [Brachypodium distachyon]
Length=410

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNM+KQTNT+DMLDLAVDY
Sbjct  321  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMEKQTNTSDMLDLAVDY  380

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IK+L+ +VK + D RA C CS
Sbjct  381  IKELQMQVKVMNDGRASCTCS  401



>ref|XP_004308213.1| PREDICTED: transcription factor bHLH130-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011468810.1| PREDICTED: transcription factor bHLH130-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011468811.1| PREDICTED: transcription factor bHLH130-like [Fragaria vesca 
subsp. vesca]
Length=429

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QDSVPC++RAKRG ATHPRSIAER+RRTRIS+RMRKLQ+L PNMDKQTNTA+ML+LAV+Y
Sbjct  343  QDSVPCKIRAKRGFATHPRSIAERMRRTRISERMRKLQDLFPNMDKQTNTAEMLELAVEY  402

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D +AKC CS+K
Sbjct  403  IKDLQKEVKTLKDTKAKCSCSSK  425



>ref|XP_010242689.1| PREDICTED: transcription factor bHLH80 [Nelumbo nucifera]
Length=262

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y+
Sbjct  180  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEYV  239

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            K L+++++ L++ +  C+C+NK
Sbjct  240  KYLQKQIQELSEYQRNCKCTNK  261



>ref|XP_007020097.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY17322.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
Length=261

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD AV+Y
Sbjct  178  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEAVEY  237

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ KC+C  K
Sbjct  238  VKYLQKQIEELTEHQRKCKCKTK  260



>ref|NP_001148741.1| DNA binding protein [Zea mays]
 ref|XP_008651451.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
 gb|ACG32709.1| DNA binding protein [Zea mays]
 tpg|DAA63087.1| TPA: putative HLH DNA-binding domain superfamily protein isoform 
1 [Zea mays]
 tpg|DAA63088.1| TPA: putative HLH DNA-binding domain superfamily protein isoform 
2 [Zea mays]
 gb|AIB05240.1| bHLH transcription factor, partial [Zea mays]
Length=374

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  285  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  344

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L +++  C CS
Sbjct  345  IKDLQKQVKVLKESQDNCTCS  365



>ref|XP_008670486.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Zea 
mays]
Length=343

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  254  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  313

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IK+L+++VK L + +A C C
Sbjct  314  IKELQKQVKVLKETQANCTC  333



>ref|XP_008670485.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Zea 
mays]
 tpg|DAA41104.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=367

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  278  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  337

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IK+L+++VK L + +A C C
Sbjct  338  IKELQKQVKVLKETQANCTC  357



>gb|AEJ88333.1| putative MYC protein [Tamarix hispida]
Length=160

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  77   EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  136

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+++++ L +++ KC C
Sbjct  137  VKGLQKQIEELMEHQRKCTC  156



>ref|XP_008678810.1| PREDICTED: transcription factor bHLH130-like [Zea mays]
Length=120

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD VPC++RAKRGCATH R+IAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  31   QDDVPCKIRAKRGCATHLRNIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  90

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L + +A C C
Sbjct  91   IKDLQRQVKVLKETQANCTC  110



>gb|KDP35099.1| hypothetical protein JCGZ_10941 [Jatropha curcas]
Length=267

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD AV+Y
Sbjct  184  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEAVEY  243

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+ +++ L +++ KC C
Sbjct  244  VKFLQMQIQELTEHQRKCTC  263



>ref|XP_008651450.1| PREDICTED: DNA binding protein isoform X3 [Zea mays]
Length=401

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  312  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  371

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L +++  C CS
Sbjct  372  IKDLQKQVKVLKESQDNCTCS  392



>gb|KHM98826.1| Transcription factor bHLH80 [Glycine soja]
Length=157

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD AV Y
Sbjct  74   EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEAVAY  133

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+++++ L++++ +C+C
Sbjct  134  VKFLQKQIEELSEHQRRCKC  153



>ref|XP_003521194.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Glycine 
max]
 ref|XP_006576845.1| PREDICTED: transcription factor bHLH130-like isoform X2 [Glycine 
max]
 ref|XP_006576846.1| PREDICTED: transcription factor bHLH130-like isoform X3 [Glycine 
max]
 ref|XP_006576847.1| PREDICTED: transcription factor bHLH130-like isoform X4 [Glycine 
max]
 gb|KHN07403.1| Transcription factor bHLH130 [Glycine soja]
Length=387

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRG ATHPRSIAERVRRTRIS+R+RKLQELVP MDKQT+TA+MLDLA+DYI
Sbjct  297  DSVPCKIRAKRGFATHPRSIAERVRRTRISERIRKLQELVPTMDKQTSTAEMLDLALDYI  356

Query  260  KDLEQKVKRLADNRAKCRCSN  198
            KDL+++ K L+D RAKC+C N
Sbjct  357  KDLQKQFKTLSDKRAKCKCIN  377



>ref|NP_001236464.1| uncharacterized protein LOC100527723 [Glycine max]
 gb|ACU16880.1| unknown [Glycine max]
Length=157

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD AV Y
Sbjct  74   EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEAVAY  133

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+++++ L++++ +C+C
Sbjct  134  VKFLQKQIEELSEHQRRCKC  153



>ref|XP_008651448.1| PREDICTED: DNA binding protein isoform X2 [Zea mays]
Length=437

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRT+IS+R+RKLQELVPNMDKQTNT+DMLDLAVDY
Sbjct  348  QDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRKLQELVPNMDKQTNTSDMLDLAVDY  407

Query  263  IKDLEQKVKRLADNRAKCRCS  201
            IKDL+++VK L +++  C CS
Sbjct  408  IKDLQKQVKVLKESQDNCTCS  428



>ref|XP_011031495.1| PREDICTED: transcription factor bHLH80-like isoform X2 [Populus 
euphratica]
Length=258

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD A++Y
Sbjct  175  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEALEY  234

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L + + KC+C  K
Sbjct  235  VKFLQRQIQELTEQQRKCKCIAK  257



>ref|XP_011031494.1| PREDICTED: transcription factor bHLH81-like isoform X1 [Populus 
euphratica]
Length=269

 Score =   136 bits (342),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD A++Y
Sbjct  186  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEALEY  245

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L + + KC+C  K
Sbjct  246  VKFLQRQIQELTEQQRKCKCIAK  268



>ref|XP_006303282.1| hypothetical protein CARUB_v10010050mg [Capsella rubella]
 gb|EOA36180.1| hypothetical protein CARUB_v10010050mg [Capsella rubella]
Length=260

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADML+ AV+Y
Sbjct  175  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEY  234

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+ +++ L + + +CRC
Sbjct  235  VKTLQSQIQELTEQQKRCRC  254



>gb|KJB78402.1| hypothetical protein B456_013G138300 [Gossypium raimondii]
Length=259

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  176  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  235

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ +C+C  K
Sbjct  236  VKYLQRQIQELTEHQKRCKCKAK  258



>gb|KHG15625.1| Transcription factor bHLH80 -like protein [Gossypium arboreum]
Length=259

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  176  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  235

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ +C+C  K
Sbjct  236  VKYLQRQIQELTEHQKRCKCKAK  258



>gb|KJB22217.1| hypothetical protein B456_004G035800 [Gossypium raimondii]
 gb|KJB22220.1| hypothetical protein B456_004G035800 [Gossypium raimondii]
Length=339

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAER+RRTRIS+RMRKLQ L PN+DKQTNTADMLD+AV+Y
Sbjct  260  QSSVPCKIRAKRGCATHPRSIAERMRRTRISERMRKLQGLFPNIDKQTNTADMLDMAVEY  319

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L D +AKC C
Sbjct  320  IKDLQKQVKILRDTKAKCSC  339



>gb|ACM41587.1| bHLH transcription factor MYC4 [Catharanthus roseus]
Length=259

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSV CRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  176  EDSVLCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  235

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L + + KC+CS K
Sbjct  236  VKFLQKQIQELTEQQKKCKCSAK  258



>gb|KHG20926.1| Transcription factor protein [Gossypium arboreum]
Length=339

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAER+RRTRIS+RMRKLQ L PN+DKQTNTADMLD+AV+Y
Sbjct  260  QSSVPCKIRAKRGCATHPRSIAERMRRTRISERMRKLQGLFPNIDKQTNTADMLDMAVEY  319

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L D +AKC C
Sbjct  320  IKDLQKQVKILRDTKAKCSC  339



>ref|XP_007227574.1| hypothetical protein PRUPE_ppa011017mg [Prunus persica]
 gb|EMJ28773.1| hypothetical protein PRUPE_ppa011017mg [Prunus persica]
Length=227

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +D+VPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQ+LVPNMDKQTNTADMLD AV+Y
Sbjct  144  EDAVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQDLVPNMDKQTNTADMLDEAVEY  203

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L++++ +C+C  K
Sbjct  204  VKFLQKQIQELSEHQRRCKCIAK  226



>gb|KJB22219.1| hypothetical protein B456_004G035800 [Gossypium raimondii]
Length=262

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            Q SVPC++RAKRGCATHPRSIAER+RRTRIS+RMRKLQ L PN+DKQTNTADMLD+AV+Y
Sbjct  183  QSSVPCKIRAKRGCATHPRSIAERMRRTRISERMRKLQGLFPNIDKQTNTADMLDMAVEY  242

Query  263  IKDLEQKVKRLADNRAKCRC  204
            IKDL+++VK L D +AKC C
Sbjct  243  IKDLQKQVKILRDTKAKCSC  262



>ref|XP_008219008.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH80 [Prunus 
mume]
Length=227

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +D+VPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQ+LVPNMDKQTNTADMLD AV+Y
Sbjct  144  EDAVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQDLVPNMDKQTNTADMLDEAVEY  203

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L++++ +C+C  K
Sbjct  204  VKFLQKQIQELSEHQRRCKCIAK  226



>ref|XP_009788006.1| PREDICTED: transcription factor bHLH80-like isoform X1 [Nicotiana 
sylvestris]
Length=252

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            D VPC+VRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y+
Sbjct  169  DLVPCKVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEYV  228

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            K L+++++ L +++ KC CS K
Sbjct  229  KFLQKQIQELMEHQKKCTCSEK  250



>ref|XP_006434678.1| hypothetical protein CICLE_v10002083mg [Citrus clementina]
 gb|ESR47918.1| hypothetical protein CICLE_v10002083mg [Citrus clementina]
Length=253

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQ+LVPNMDKQTNTADML+ AV+Y
Sbjct  170  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQDLVPNMDKQTNTADMLEEAVEY  229

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ +C+CS K
Sbjct  230  VKFLQKQIEELTEHQRRCKCSAK  252



>emb|CDY69278.1| BnaCnng62790D [Brassica napus]
Length=242

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVP RVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADMLD A+ Y
Sbjct  158  EDSVPFRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLDEALQY  217

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K LE +++ L + + +CRC N+
Sbjct  218  VKALESQIQELTEQQKRCRCKNE  240



>ref|XP_006473253.1| PREDICTED: transcription factor bHLH80-like [Citrus sinensis]
 gb|KDO84017.1| hypothetical protein CISIN_1g023215mg [Citrus sinensis]
Length=253

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQ+LVPNMDKQTNTADML+ AV+Y
Sbjct  170  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQDLVPNMDKQTNTADMLEEAVEY  229

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ +C+CS K
Sbjct  230  VKFLQKQIEELTEHQRRCKCSAK  252



>ref|XP_011001080.1| PREDICTED: transcription factor bHLH80-like isoform X1 [Populus 
euphratica]
Length=258

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            ++SVPC++RAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AVDY
Sbjct  175  EESVPCKIRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVDY  234

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L + + KC+C  K
Sbjct  235  VKFLQRQIQELTEQQRKCKCMAK  257



>ref|XP_006356502.1| PREDICTED: transcription factor bHLH81-like isoform X1 [Solanum 
tuberosum]
Length=257

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            D VPC+VRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y+
Sbjct  174  DLVPCKVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEYV  233

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            K L+++++ L +++ KC CS K
Sbjct  234  KFLQKQIQELTEHQKKCTCSMK  255



>ref|NP_174776.1| protein FLOWERING BHLH 1 [Arabidopsis thaliana]
 sp|Q9C8P8.1|BH080_ARATH RecName: Full=Transcription factor bHLH80; AltName: Full=Basic 
helix-loop-helix protein 80; Short=AtbHLH80; Short=bHLH 80; 
AltName: Full=Transcription factor EN 71; AltName: Full=bHLH 
transcription factor bHLH080 [Arabidopsis thaliana]
 gb|AAG52112.1|AC023064_5 helix-loop-helix protein 1A, putative; 28707-26892 [Arabidopsis 
thaliana]
 gb|AAL06481.1|AF411791_1 At1g35460/F12A4_2 [Arabidopsis thaliana]
 gb|AAM10958.1|AF488612_1 putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AAM10410.1| At1g35460/F12A4_2 [Arabidopsis thaliana]
 gb|AEE31795.1| transcription factor bHLH80 [Arabidopsis thaliana]
Length=259

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADML+ AV+Y
Sbjct  174  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEY  233

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+ +++ L + + +C+C
Sbjct  234  VKALQSQIQELTEQQKRCKC  253



>ref|XP_008231356.1| PREDICTED: transcription factor bHLH130-like [Prunus mume]
Length=429

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DS+PC++RAKRG ATHPRSIAER+RRTRIS+RM+KLQ+L PNMDKQ NTA+MLDLAV++
Sbjct  345  EDSIPCKIRAKRGFATHPRSIAERMRRTRISERMKKLQDLFPNMDKQINTAEMLDLAVEF  404

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            IKDL+++VK L D +AKC CS+K
Sbjct  405  IKDLQKQVKTLGDTKAKCSCSSK  427



>ref|XP_010543658.1| PREDICTED: transcription factor bHLH81 [Tarenaya hassleriana]
Length=272

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            ++SVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y
Sbjct  187  EESVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEY  246

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+++++ L +++ +C C
Sbjct  247  VKSLQRQIQELTEHQKRCTC  266



>gb|AAF04760.1|AF103808_1 helix-loop-helix protein 1A [Pinus taeda]
Length=551

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQT-NTADMLDLAVD  267
            QD+VPC+VRAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPN DKQT N ADMLD AV+
Sbjct  461  QDAVPCKVRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNSDKQTVNIADMLDEAVE  520

Query  266  YIKDLEQKVKRLADNRAKCRCSN  198
            Y+K L+++V+ LA+NRAKC C++
Sbjct  521  YVKSLQKQVQELAENRAKCTCTH  543



>ref|XP_004241842.1| PREDICTED: transcription factor bHLH81-like [Solanum lycopersicum]
Length=254

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            D VPC+VRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y+
Sbjct  171  DLVPCKVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEYV  230

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            K L+++++ L +++ KC CS K
Sbjct  231  KFLQRQIQELTEHQKKCTCSMK  252



>ref|XP_010682704.1| PREDICTED: transcription factor bHLH81-like [Beta vulgaris subsp. 
vulgaris]
Length=276

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  437  SVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYIK  258
            SVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADML+ AV+Y+K
Sbjct  195  SVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEYVK  254

Query  257  DLEQKVKRLADNRAKCRCSNK  195
             L++++  L + + KC+C  K
Sbjct  255  TLQRQIHDLTEQQKKCKCIAK  275



>ref|XP_009379414.1| PREDICTED: transcription factor bHLH80 isoform X2 [Pyrus x bretschneideri]
Length=232

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSV CRVRAKRGCATHPRSIAERVRRT+ISDR+RKLQELVPNMDKQTNTADMLD AV+Y
Sbjct  149  EDSVGCRVRAKRGCATHPRSIAERVRRTKISDRIRKLQELVPNMDKQTNTADMLDEAVEY  208

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L++++ +C+C+ K
Sbjct  209  VKFLQKQIQELSEHQRRCKCTAK  231



>ref|XP_008459678.1| PREDICTED: transcription factor bHLH80 isoform X1 [Cucumis melo]
Length=242

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQE+VPNMDKQTNTADML+ AV+Y
Sbjct  159  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQEVVPNMDKQTNTADMLEEAVEY  218

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ +C+C  K
Sbjct  219  VKFLQKQIQELTEHQRRCKCMVK  241



>ref|XP_004141566.1| PREDICTED: transcription factor bHLH80-like [Cucumis sativus]
 ref|XP_004168264.1| PREDICTED: transcription factor bHLH80-like [Cucumis sativus]
 gb|KGN52716.1| hypothetical protein Csa_5G652220 [Cucumis sativus]
Length=244

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+RKLQE+VPNMDKQTNTADML+ AV+Y
Sbjct  161  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQEVVPNMDKQTNTADMLEEAVEY  220

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L +++ +C+C  K
Sbjct  221  VKFLQKQIQELTEHQRRCKCMVK  243



>ref|XP_007162279.1| hypothetical protein PHAVU_001G138600g [Phaseolus vulgaris]
 gb|ESW34273.1| hypothetical protein PHAVU_001G138600g [Phaseolus vulgaris]
Length=396

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            DSVPC++RAKRG ATHPRSIAERVRRTRIS+R+RKLQELVPNM+KQT+TA+MLDLAVDYI
Sbjct  306  DSVPCKIRAKRGFATHPRSIAERVRRTRISERIRKLQELVPNMEKQTSTAEMLDLAVDYI  365

Query  260  KDLEQKVKRLADNRAKCRC  204
            K+L+ + K L++ RAKC+C
Sbjct  366  KNLQNQFKTLSERRAKCKC  384



>ref|XP_009107915.1| PREDICTED: transcription factor bHLH80-like [Brassica rapa]
Length=246

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADML+ AV+Y
Sbjct  161  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEY  220

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+ K++ L + + +C C  K
Sbjct  221  VKALQSKIQELTEQQRRCICKPK  243



>emb|CDX91761.1| BnaC08g06800D [Brassica napus]
Length=246

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADML+ AV+Y
Sbjct  161  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEY  220

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+ K++ L + + +C C  K
Sbjct  221  VKALQSKIQELTEQQRRCICKPK  243



>ref|XP_009605833.1| PREDICTED: transcription factor bHLH80-like isoform X2 [Nicotiana 
tomentosiformis]
Length=248

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  440  DSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDYI  261
            D VPC+VRAKRGCATHPRSIAERVRRTRISDR+RKLQELVP+MDKQTNTADML+ AV+Y+
Sbjct  165  DLVPCKVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPSMDKQTNTADMLEEAVEYV  224

Query  260  KDLEQKVKRLADNRAKCRCSNK  195
            K L+++++ L +++ KC CS K
Sbjct  225  KFLQKQIQELTEHQKKCTCSEK  246



>ref|XP_008361617.1| PREDICTED: transcription factor bHLH80-like [Malus domestica]
Length=227

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSV CRVRAKRGCATHPRSIAERVRRTRISDR+RKLQELVPNMDKQTNTADMLD AV+Y
Sbjct  144  EDSVSCRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLDEAVEY  203

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+++++ L++++ +C+C  K
Sbjct  204  VKFLQKQIQELSEDQRRCKCIAK  226



>emb|CDY41870.1| BnaA08g06290D [Brassica napus]
Length=244

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADML+ AV+Y
Sbjct  159  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEY  218

Query  263  IKDLEQKVKRLADNRAKCRCSNK  195
            +K L+ K++ L + + +C C  K
Sbjct  219  VKALQSKIQELTEQQRRCICKPK  241



>ref|XP_010478939.1| PREDICTED: transcription factor bHLH80-like [Camelina sativa]
Length=262

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            +DSVPCRVRAKRGCATHPRSIAERVRRTRISDR+R+LQELVPNMDKQTNTADML+ AV+Y
Sbjct  177  EDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEY  236

Query  263  IKDLEQKVKRLADNRAKCRC  204
            +K L+ +++ L + + +C C
Sbjct  237  VKTLQSQIQELTEQQKRCIC  256



>ref|XP_009383213.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009383215.1| PREDICTED: transcription factor bHLH130-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=473

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 77/97 (79%), Gaps = 8/97 (8%)
 Frame = -1

Query  443  QDSVPCRVRAKRGCATHPRSIAERVRRTRISDRMRKLQELVPNMDKQTNTADMLDLAVDY  264
            QD+VPC++RAKRGCATHPRSIAERVRRTRIS+RMRKLQELVPNMDKQTNTADMLDLA+ Y
Sbjct  289  QDAVPCKIRAKRGCATHPRSIAERVRRTRISERMRKLQELVPNMDKQTNTADMLDLAIGY  348

Query  263  IKDLEQKVKRLADNRAKCRCSNK**GRDVPMNVTWKV  153
            IKDL+++VK L   R          G  V +NV W V
Sbjct  349  IKDLQKQVKVLRLQRFA--------GIVVLVNVNWIV  377



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320