BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044L19

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601422.1|  PREDICTED: crocetin glucosyltransferase, chl...    261   8e-81   Nicotiana tomentosiformis
dbj|BAB88935.1|  glucosyltransferase                                    259   8e-80   Nicotiana tabacum [American tobacco]
dbj|BAG80544.1|  UDP-glucose:glucosyltransferase                        257   3e-79   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006358760.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    257   3e-79   Solanum tuberosum [potatoes]
ref|XP_009790237.1|  PREDICTED: crocetin glucosyltransferase, chl...    257   5e-79   Nicotiana sylvestris
ref|XP_006368000.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    253   1e-77   Solanum tuberosum [potatoes]
gb|AAK54465.1|  cold-induced glucosyl transferase                       253   1e-77   Solanum sogarandinum
ref|XP_004247894.1|  PREDICTED: crocetin glucosyltransferase, chl...    253   2e-77   
dbj|BAM28983.1|  UDP-glucose crocetin glucosyltransferase               241   9e-73   Gardenia jasminoides
sp|F8WKW0.1|UGT1_GARJA  RecName: Full=Crocetin glucosyltransferas...    238   7e-72   Gardenia jasminoides
emb|CDP15115.1|  unnamed protein product                                233   4e-70   Coffea canephora [robusta coffee]
ref|XP_002262883.1|  PREDICTED: crocetin glucosyltransferase, chl...    232   1e-69   Vitis vinifera
emb|CAN67608.1|  hypothetical protein VITISV_036779                     232   1e-69   Vitis vinifera
dbj|BAA89009.1|  anthocyanin 5-O-glucosyltransferase                    231   5e-69   Petunia x hybrida [garden petunia]
ref|XP_002263700.1|  PREDICTED: crocetin glucosyltransferase, chl...    230   1e-68   Vitis vinifera
ref|XP_011101605.1|  PREDICTED: crocetin glucosyltransferase, chl...    225   1e-68   
ref|XP_002263301.1|  PREDICTED: crocetin glucosyltransferase, chl...    229   2e-68   Vitis vinifera
ref|XP_009337747.1|  PREDICTED: crocetin glucosyltransferase, chl...    229   3e-68   Pyrus x bretschneideri [bai li]
emb|CDP15111.1|  unnamed protein product                                229   3e-68   Coffea canephora [robusta coffee]
ref|XP_003632054.2|  PREDICTED: crocetin glucosyltransferase, chl...    228   6e-68   
ref|XP_010650395.1|  PREDICTED: crocetin glucosyltransferase, chl...    228   1e-67   Vitis vinifera
ref|XP_006349903.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    227   2e-67   Solanum tuberosum [potatoes]
ref|XP_004252978.1|  PREDICTED: crocetin glucosyltransferase, chl...    226   3e-67   Solanum lycopersicum
gb|ABQ02258.1|  O-glucosyltransferase 3                                 226   4e-67   Vitis labrusca [Concord grape]
emb|CDP15112.1|  unnamed protein product                                226   4e-67   Coffea canephora [robusta coffee]
ref|XP_009373577.1|  PREDICTED: crocetin glucosyltransferase, chl...    226   5e-67   
emb|CAN76093.1|  hypothetical protein VITISV_027116                     225   8e-67   Vitis vinifera
ref|XP_002266628.2|  PREDICTED: crocetin glucosyltransferase, chl...    226   1e-66   
ref|XP_008380456.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    225   1e-66   Malus domestica [apple tree]
ref|XP_007221319.1|  hypothetical protein PRUPE_ppa021645mg             225   1e-66   Prunus persica
emb|CAN75179.1|  hypothetical protein VITISV_018406                     225   1e-66   Vitis vinifera
ref|XP_009373576.1|  PREDICTED: crocetin glucosyltransferase, chl...    227   1e-66   
ref|XP_007221281.1|  hypothetical protein PRUPE_ppa005161mg             224   1e-66   Prunus persica
ref|XP_008348418.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    224   1e-66   Malus domestica [apple tree]
ref|XP_008222736.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    224   2e-66   Prunus mume [ume]
ref|XP_011024782.1|  PREDICTED: crocetin glucosyltransferase, chl...    223   6e-66   Populus euphratica
ref|XP_002267330.2|  PREDICTED: crocetin glucosyltransferase, chl...    223   7e-66   Vitis vinifera
ref|XP_008380454.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    223   8e-66   Malus domestica [apple tree]
ref|XP_011097030.1|  PREDICTED: crocetin glucosyltransferase, chl...    217   8e-66   
ref|XP_007099701.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      223   8e-66   
ref|XP_008222735.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    222   9e-66   Prunus mume [ume]
ref|XP_002263975.1|  PREDICTED: crocetin glucosyltransferase, chl...    222   1e-65   Vitis vinifera
gb|ACW82415.1|  putative glucosyltransferase                            216   1e-65   Olea europaea
ref|XP_008380455.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    222   2e-65   
gb|AAX16493.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase           221   5e-65   Malus domestica [apple tree]
gb|EYU22114.1|  hypothetical protein MIMGU_mgv1a026355mg                216   7e-65   Erythranthe guttata [common monkey flower]
ref|XP_008380634.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    220   7e-65   Malus domestica [apple tree]
gb|AAY27090.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase           220   7e-65   Pyrus communis
ref|XP_002301754.1|  hypothetical protein POPTR_0002s23770g             219   1e-64   
ref|XP_011081386.1|  PREDICTED: crocetin glucosyltransferase, chl...    219   2e-64   Sesamum indicum [beniseed]
gb|KCW45597.1|  hypothetical protein EUGRSUZ_L006312                    211   2e-64   Eucalyptus grandis [rose gum]
ref|XP_011101592.1|  PREDICTED: crocetin glucosyltransferase, chl...    218   4e-64   Sesamum indicum [beniseed]
ref|XP_002321086.2|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...    218   5e-64   
emb|CDP15120.1|  unnamed protein product                                218   6e-64   Coffea canephora [robusta coffee]
ref|XP_009373578.1|  PREDICTED: crocetin glucosyltransferase, chl...    218   7e-64   
ref|XP_007034186.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      217   8e-64   
gb|AHL68667.1|  UDP-glucose: anthocyanin 5-O-glucosyltransferase        217   1e-63   Vitis amurensis
ref|XP_010023602.1|  PREDICTED: crocetin glucosyltransferase, chl...    217   1e-63   
ref|XP_002267526.1|  PREDICTED: crocetin glucosyltransferase, chl...    217   1e-63   Vitis vinifera
ref|XP_002301753.1|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...    216   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_007221288.1|  hypothetical protein PRUPE_ppa016890mg             216   2e-63   Prunus persica
ref|XP_010023609.1|  PREDICTED: crocetin glucosyltransferase, chl...    216   3e-63   Eucalyptus grandis [rose gum]
emb|CDP15119.1|  unnamed protein product                                215   6e-63   Coffea canephora [robusta coffee]
ref|XP_010040347.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   6e-63   Eucalyptus grandis [rose gum]
ref|XP_010039940.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   2e-62   Eucalyptus grandis [rose gum]
gb|ABL85474.1|  glycosyltransferase UGT75L4                             214   2e-62   Maclura pomifera
ref|XP_010023610.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   2e-62   
ref|XP_010650398.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   3e-62   Vitis vinifera
ref|XP_010023603.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   4e-62   Eucalyptus grandis [rose gum]
ref|XP_010069411.1|  PREDICTED: crocetin glucosyltransferase, chl...    211   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010025933.1|  PREDICTED: crocetin glucosyltransferase, chl...    202   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010052789.1|  PREDICTED: crocetin glucosyltransferase, chl...    211   2e-61   Eucalyptus grandis [rose gum]
gb|KHN12357.1|  UDP-glycosyltransferase 75D1                            209   3e-61   Glycine soja [wild soybean]
ref|XP_009622554.1|  PREDICTED: crocetin glucosyltransferase, chl...    210   4e-61   Nicotiana tomentosiformis
ref|XP_004298222.1|  PREDICTED: crocetin glucosyltransferase, chl...    210   5e-61   Fragaria vesca subsp. vesca
emb|CAN62624.1|  hypothetical protein VITISV_001657                     209   5e-61   Vitis vinifera
ref|XP_010039960.1|  PREDICTED: crocetin glucosyltransferase, chl...    201   6e-61   
ref|XP_003531212.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    209   6e-61   Glycine max [soybeans]
ref|XP_010099953.1|  UDP-glycosyltransferase 75D1                       210   7e-61   Morus notabilis
ref|XP_004297014.1|  PREDICTED: crocetin glucosyltransferase, chl...    209   9e-61   Fragaria vesca subsp. vesca
dbj|BAG80545.1|  UDP-glucose:glucosyltransferase                        209   1e-60   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_002266919.1|  PREDICTED: crocetin glucosyltransferase, chl...    208   1e-60   Vitis vinifera
ref|XP_002263422.1|  PREDICTED: crocetin glucosyltransferase, chl...    208   2e-60   Vitis vinifera
gb|AFI98393.1|  UDP-glucosyltransferase                                 205   2e-60   Fragaria x ananassa
ref|XP_010650447.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   2e-60   Vitis vinifera
ref|XP_003601705.1|  O-glucosyltransferase                              209   2e-60   Medicago truncatula
ref|XP_002266967.1|  PREDICTED: crocetin glucosyltransferase, chl...    208   3e-60   Vitis vinifera
ref|XP_004298223.1|  PREDICTED: crocetin glucosyltransferase, chl...    208   3e-60   Fragaria vesca subsp. vesca
ref|XP_010023606.1|  PREDICTED: crocetin glucosyltransferase, chl...    207   5e-60   Eucalyptus grandis [rose gum]
gb|KJB28073.1|  hypothetical protein B456_005G025400                    207   5e-60   Gossypium raimondii
ref|XP_010673328.1|  PREDICTED: crocetin glucosyltransferase, chl...    207   6e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009787090.1|  PREDICTED: crocetin glucosyltransferase, chl...    207   7e-60   Nicotiana sylvestris
gb|KJB28074.1|  hypothetical protein B456_005G025500                    207   8e-60   Gossypium raimondii
ref|XP_010522273.1|  PREDICTED: UDP-glycosyltransferase 75B2-like       208   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_002263498.1|  PREDICTED: crocetin glucosyltransferase, chl...    206   1e-59   Vitis vinifera
ref|XP_010039945.1|  PREDICTED: crocetin glucosyltransferase, chl...    206   1e-59   Eucalyptus grandis [rose gum]
ref|XP_010103920.1|  UDP-glycosyltransferase 75D1                       206   2e-59   Morus notabilis
ref|XP_003629628.1|  UDP-glucose flavonoid 7-O-glucosyltransferase      206   2e-59   Medicago truncatula
gb|KJB18350.1|  hypothetical protein B456_003G047900                    205   2e-59   Gossypium raimondii
gb|KJB28075.1|  hypothetical protein B456_005G025600                    205   2e-59   Gossypium raimondii
ref|XP_010096066.1|  UDP-glycosyltransferase 75D1                       206   2e-59   Morus notabilis
ref|XP_007034187.1|  Indole-3-acetate beta-D-glucosyltransferase,...    205   2e-59   
gb|KDP32582.1|  hypothetical protein JCGZ_13132                         205   3e-59   Jatropha curcas
ref|XP_004297003.2|  PREDICTED: crocetin glucosyltransferase, chl...    206   3e-59   Fragaria vesca subsp. vesca
ref|XP_010023605.1|  PREDICTED: crocetin glucosyltransferase, chl...    205   3e-59   Eucalyptus grandis [rose gum]
sp|Q9ZR25.1|5GT_VERHY  RecName: Full=Anthocyanidin 3-O-glucoside ...    205   4e-59   Glandularia x hybrida [garden verbena]
dbj|BAD90935.1|  monoterpene glucosyltransferase                        204   5e-59   Eucalyptus perriniana
gb|KJB28076.1|  hypothetical protein B456_005G025700                    204   7e-59   Gossypium raimondii
ref|XP_002308970.1|  putative glucosyltransferase family protein        204   9e-59   
ref|XP_009612652.1|  PREDICTED: crocetin glucosyltransferase, chl...    204   9e-59   
dbj|BAD90934.1|  monoterpene glucosyltransferase                        204   9e-59   Eucalyptus perriniana
ref|XP_010068983.1|  PREDICTED: crocetin glucosyltransferase, chl...    204   1e-58   Eucalyptus grandis [rose gum]
ref|XP_010246964.1|  PREDICTED: crocetin glucosyltransferase, chl...    204   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_011020320.1|  PREDICTED: crocetin glucosyltransferase, chl...    204   1e-58   Populus euphratica
emb|CBI39387.3|  unnamed protein product                                193   1e-58   Vitis vinifera
ref|XP_004247895.1|  PREDICTED: crocetin glucosyltransferase, chl...    203   2e-58   Solanum lycopersicum
ref|XP_008458144.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    203   2e-58   Cucumis melo [Oriental melon]
emb|CAN62622.1|  hypothetical protein VITISV_001655                     202   4e-58   Vitis vinifera
dbj|BAF75879.1|  glucosyltransferase                                    202   4e-58   Dianthus caryophyllus [carnation]
ref|XP_006418014.1|  hypothetical protein EUTSA_v10007593mg             201   6e-58   
gb|AFI71902.1|  flavonol 5-O-glucosyltransferase                        201   7e-58   Paeonia lactiflora [common garden peony]
ref|XP_010039944.1|  PREDICTED: crocetin glucosyltransferase, chl...    201   1e-57   Eucalyptus grandis [rose gum]
gb|KJB28077.1|  hypothetical protein B456_005G025900                    200   2e-57   Gossypium raimondii
ref|XP_010039943.1|  PREDICTED: crocetin glucosyltransferase, chl...    200   2e-57   Eucalyptus grandis [rose gum]
dbj|BAF49301.1|  putative glycosyltransferase                           200   2e-57   Clitoria ternatea
ref|XP_011033298.1|  PREDICTED: crocetin glucosyltransferase, chl...    200   2e-57   Populus euphratica
gb|KDP32590.1|  hypothetical protein JCGZ_13140                         200   3e-57   Jatropha curcas
ref|XP_003601706.1|  UDP-glucose glucosyltransferase                    199   4e-57   Medicago truncatula
ref|XP_010040348.1|  PREDICTED: crocetin glucosyltransferase, chl...    199   6e-57   Eucalyptus grandis [rose gum]
ref|XP_003532736.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    200   7e-57   
ref|XP_003629627.1|  Indole-3-acetate beta-glucosyltransferase          199   8e-57   Medicago truncatula
ref|XP_004502258.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       199   1e-56   Cicer arietinum [garbanzo]
ref|XP_002322699.1|  hypothetical protein POPTR_0016s05290g             199   1e-56   
ref|XP_009778639.1|  PREDICTED: crocetin glucosyltransferase, chl...    197   2e-56   Nicotiana sylvestris
ref|NP_563742.1|  UDP-glucosyltransferase 75B1                          197   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163802.1|  hypothetical protein PHAVU_001G265400g             197   8e-56   Phaseolus vulgaris [French bean]
dbj|BAG80537.1|  putative glycosyltransferase                           196   8e-56   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_003552552.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    196   1e-55   Glycine max [soybeans]
ref|XP_004229323.2|  PREDICTED: crocetin glucosyltransferase, chl...    196   1e-55   
ref|XP_003601707.1|  UDP-glucuronosyltransferase 1-6                    196   2e-55   Medicago truncatula
ref|XP_006307449.1|  hypothetical protein CARUB_v10009073mg             195   2e-55   Capsella rubella
ref|XP_010457643.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       195   2e-55   Camelina sativa [gold-of-pleasure]
dbj|BAF49300.1|  putative glycosyltransferase                           194   4e-55   Clitoria ternatea
ref|XP_010475253.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       191   4e-55   
ref|XP_009778637.1|  PREDICTED: crocetin glucosyltransferase, chl...    194   6e-55   Nicotiana sylvestris
ref|XP_009765810.1|  PREDICTED: crocetin glucosyltransferase, chl...    190   6e-55   Nicotiana sylvestris
ref|XP_006373420.1|  hypothetical protein POPTR_0017s13620g             194   7e-55   
ref|XP_006492998.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       194   7e-55   Citrus sinensis [apfelsine]
ref|XP_002516389.1|  UDP-glucosyltransferase, putative                  193   8e-55   Ricinus communis
ref|XP_004252977.1|  PREDICTED: crocetin glucosyltransferase, chl...    193   8e-55   Solanum lycopersicum
ref|XP_009612651.1|  PREDICTED: crocetin glucosyltransferase, chl...    189   1e-54   Nicotiana tomentosiformis
ref|XP_010246531.1|  PREDICTED: crocetin glucosyltransferase, chl...    193   1e-54   Nelumbo nucifera [Indian lotus]
emb|CDY10124.1|  BnaC05g03670D                                          193   1e-54   Brassica napus [oilseed rape]
ref|XP_006421040.1|  hypothetical protein CICLE_v10004909mg             193   1e-54   Citrus clementina [clementine]
ref|XP_011021104.1|  PREDICTED: crocetin glucosyltransferase, chl...    193   1e-54   Populus euphratica
gb|EYU31586.1|  hypothetical protein MIMGU_mgv1a005918mg                192   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_009590508.1|  PREDICTED: crocetin glucosyltransferase, chl...    192   2e-54   
ref|XP_010475249.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       191   3e-54   
ref|XP_004504379.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       192   4e-54   Cicer arietinum [garbanzo]
dbj|BAF49285.1|  anthocyanin 5-O-glucosyltransferase                    192   4e-54   Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAF49286.1|  anthocyanin 5-O-glucosyltransferase                    192   4e-54   Eustoma exaltatum subsp. russellianum [bluebells]
gb|EYU31588.1|  hypothetical protein MIMGU_mgv1a005398mg                192   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_002263532.1|  PREDICTED: crocetin glucosyltransferase, chl...    191   5e-54   Vitis vinifera
gb|ABQ02257.1|  O-glucosyltransferase 2                                 191   5e-54   Vitis labrusca [Concord grape]
ref|XP_006858834.1|  hypothetical protein AMTR_s00066p00178410          183   8e-54   
ref|XP_010485047.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...    191   1e-53   
ref|XP_010243149.1|  PREDICTED: crocetin glucosyltransferase, chl...    191   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010485054.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...    191   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010434952.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       191   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009604418.1|  PREDICTED: crocetin glucosyltransferase, chl...    190   1e-53   Nicotiana tomentosiformis
gb|AJM89728.1|  UDP-glucosyltransferase                                 190   2e-53   Leonurus japonicus [Chinese motherwort]
sp|Q9ZR27.1|5GT1_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...    189   2e-53   Perilla frutescens [beefsteak-mint]
dbj|BAA19155.1|  glucosyl transferase                                   190   2e-53   Nicotiana tabacum [American tobacco]
ref|XP_009105515.1|  PREDICTED: UDP-glycosyltransferase 75B2            190   2e-53   Brassica rapa
emb|CAN73416.1|  hypothetical protein VITISV_017052                     189   3e-53   Vitis vinifera
ref|XP_009612650.1|  PREDICTED: crocetin glucosyltransferase, chl...    189   3e-53   Nicotiana tomentosiformis
ref|XP_006342284.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    189   3e-53   Solanum tuberosum [potatoes]
ref|XP_009765809.1|  PREDICTED: crocetin glucosyltransferase, chl...    190   3e-53   Nicotiana sylvestris
gb|EYU31585.1|  hypothetical protein MIMGU_mgv1a007491mg                187   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_006305828.1|  hypothetical protein CARUB_v10010859mg             189   4e-53   Capsella rubella
ref|XP_008219026.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       189   5e-53   Prunus mume [ume]
ref|XP_006442002.1|  hypothetical protein CICLE_v10019912mg             189   5e-53   Citrus clementina [clementine]
gb|AAB58497.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltrans...    189   6e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42892.1|  hypothetical protein AALP_AA1G052200                    189   6e-53   Arabis alpina [alpine rockcress]
ref|XP_010549173.1|  PREDICTED: UDP-glycosyltransferase 75D1            189   6e-53   Tarenaya hassleriana [spider flower]
ref|XP_004242781.1|  PREDICTED: crocetin glucosyltransferase, chl...    188   7e-53   Solanum lycopersicum
gb|AAL24226.1|  AT4g15550/dl3815c                                       187   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781303.1|  PREDICTED: crocetin glucosyltransferase, chl...    188   7e-53   Nicotiana sylvestris
emb|CDP15113.1|  unnamed protein product                                187   9e-53   Coffea canephora [robusta coffee]
ref|XP_010025796.1|  PREDICTED: crocetin glucosyltransferase, chl...    179   9e-53   Eucalyptus grandis [rose gum]
ref|XP_010480357.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       180   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010434517.1|  PREDICTED: UDP-glycosyltransferase 75D1            188   1e-52   Camelina sativa [gold-of-pleasure]
emb|CAB10333.1|  glucosyltransferase like protein                       187   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440288.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       188   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009622557.1|  PREDICTED: crocetin glucosyltransferase, chl...    187   2e-52   Nicotiana tomentosiformis
emb|CBI39412.3|  unnamed protein product                                190   2e-52   Vitis vinifera
ref|XP_003524181.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    188   2e-52   Glycine max [soybeans]
ref|NP_567471.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltra...    187   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858828.1|  hypothetical protein AMTR_s00066p00177320          187   3e-52   Amborella trichopoda
gb|EYU31587.1|  hypothetical protein MIMGU_mgv1a018203mg                187   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_003524180.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    186   3e-52   Glycine max [soybeans]
ref|XP_004247896.2|  PREDICTED: crocetin glucosyltransferase, chl...    187   3e-52   Solanum lycopersicum
gb|KJB28080.1|  hypothetical protein B456_005G026200                    188   4e-52   Gossypium raimondii
ref|XP_004173025.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       179   4e-52   
ref|XP_010246537.1|  PREDICTED: crocetin glucosyltransferase, chl...    187   4e-52   Nelumbo nucifera [Indian lotus]
emb|CDY47274.1|  BnaA10g03720D                                          186   5e-52   Brassica napus [oilseed rape]
ref|XP_010246963.1|  PREDICTED: crocetin glucosyltransferase, chl...    185   8e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004307485.1|  PREDICTED: crocetin glucosyltransferase, chl...    185   8e-52   Fragaria vesca subsp. vesca
gb|KFK39474.1|  hypothetical protein AALP_AA3G248900                    186   1e-51   Arabis alpina [alpine rockcress]
ref|XP_002892298.1|  UDP-glucosyl transferase 75B1                      185   1e-51   
ref|XP_004253165.1|  PREDICTED: crocetin glucosyltransferase, chl...    185   1e-51   Solanum lycopersicum
ref|XP_007041389.1|  UDP-Glycosyltransferase superfamily protein        185   1e-51   
ref|NP_172044.1|  UDP-glucosyl transferase 75B2                         184   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27003.1|  hypothetical protein MIMGU_mgv1a024986mg                184   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_007041390.1|  UDP-Glycosyltransferase superfamily protein        184   3e-51   
ref|XP_006349902.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    184   3e-51   Solanum tuberosum [potatoes]
ref|XP_011043909.1|  PREDICTED: crocetin glucosyltransferase, chl...    185   3e-51   Populus euphratica
ref|XP_009119145.1|  PREDICTED: UDP-glycosyltransferase 75B1            184   3e-51   Brassica rapa
ref|XP_006414807.1|  hypothetical protein EUTSA_v10025167mg             184   3e-51   Eutrema salsugineum [saltwater cress]
ref|XP_006442000.1|  hypothetical protein CICLE_v10023445mg             184   4e-51   
ref|XP_007226459.1|  hypothetical protein PRUPE_ppa024612mg             184   4e-51   Prunus persica
ref|XP_006858829.1|  hypothetical protein AMTR_s00066p00177490          183   5e-51   Amborella trichopoda
ref|XP_006415092.1|  hypothetical protein EUTSA_v10007589mg             183   6e-51   Eutrema salsugineum [saltwater cress]
emb|CDP21497.1|  unnamed protein product                                183   6e-51   Coffea canephora [robusta coffee]
emb|CAN70791.1|  hypothetical protein VITISV_029654                     182   7e-51   Vitis vinifera
ref|XP_002305226.2|  hypothetical protein POPTR_0004s08200g             184   7e-51   
ref|XP_002263497.1|  PREDICTED: crocetin glucosyltransferase, chl...    182   8e-51   Vitis vinifera
ref|XP_002892295.1|  UDP-glucosyl transferase 75B2                      183   8e-51   Arabidopsis lyrata subsp. lyrata
gb|ABQ02259.1|  truncated O-glucosyltransferase 4                       182   1e-50   Vitis labrusca [Concord grape]
emb|CDY71964.1|  BnaAnng39390D                                          182   1e-50   Brassica napus [oilseed rape]
ref|XP_008458151.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    182   1e-50   Cucumis melo [Oriental melon]
dbj|BAE98677.1|  glucosyltransferase like protein                       182   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193146.1|  anthocyanin 5-O-glucosyltransferase                   182   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAL69494.1|  putative glucosyltransferase                            182   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ02256.1|  O-glucosyltransferase 1                                 181   2e-50   Vitis labrusca [Concord grape]
gb|KCW57191.1|  hypothetical protein EUGRSUZ_H00007                     181   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010101353.1|  UDP-glycosyltransferase 74F2                       181   2e-50   Morus notabilis
ref|XP_006858830.1|  hypothetical protein AMTR_s00066p00177790          181   3e-50   Amborella trichopoda
ref|XP_009108098.1|  PREDICTED: UDP-glycosyltransferase 75C1            181   3e-50   Brassica rapa
gb|ADG45874.1|  UDP-glucosyltransferase                                 181   3e-50   Isatis tinctoria [woad]
emb|CDY27124.1|  BnaA08g07620D                                          181   3e-50   Brassica napus [oilseed rape]
dbj|BAP90370.1|  UDP-glycose: glycosyltransferase UGT75R1               181   3e-50   Fagopyrum esculentum
sp|B2NID7.1|5GT_GENTR  RecName: Full=Anthocyanidin 3-O-glucoside ...    182   3e-50   Gentiana triflora
ref|XP_002868314.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    181   4e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010434494.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       181   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010434953.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       181   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004140483.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       180   9e-50   Cucumis sativus [cucumbers]
gb|KGN45711.1|  hypothetical protein Csa_6G007450                       180   9e-50   Cucumis sativus [cucumbers]
ref|XP_004239848.1|  PREDICTED: crocetin glucosyltransferase, chl...    179   1e-49   Solanum lycopersicum
ref|XP_006858837.1|  hypothetical protein AMTR_s00066p00179570          179   1e-49   Amborella trichopoda
ref|XP_010917296.1|  PREDICTED: crocetin glucosyltransferase, chl...    179   2e-49   Elaeis guineensis
gb|AFJ52952.1|  UDP-glycosyltransferase 1                               178   3e-49   Linum usitatissimum
ref|XP_008458143.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    179   4e-49   Cucumis melo [Oriental melon]
ref|XP_006478477.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       171   4e-49   Citrus sinensis [apfelsine]
emb|CDY12370.1|  BnaC08g08350D                                          178   4e-49   Brassica napus [oilseed rape]
ref|XP_006854002.1|  hypothetical protein AMTR_s00036p00237680          172   4e-49   Amborella trichopoda
emb|CDY46180.1|  BnaA01g23020D                                          178   6e-49   Brassica napus [oilseed rape]
emb|CDP21504.1|  unnamed protein product                                177   7e-49   Coffea canephora [robusta coffee]
ref|XP_006365463.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    177   7e-49   
ref|XP_007041388.1|  UDP-Glycosyltransferase superfamily protein        177   8e-49   
ref|XP_004957368.1|  PREDICTED: crocetin glucosyltransferase 2-like     177   8e-49   Setaria italica
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    177   2e-48   
gb|EPS69486.1|  glycosyltransferase                                     176   2e-48   Genlisea aurea
ref|XP_006285715.1|  hypothetical protein CARUB_v10007186mg             176   3e-48   Capsella rubella
gb|KGN46578.1|  hypothetical protein Csa_6G109730                       176   3e-48   Cucumis sativus [cucumbers]
emb|CAN67249.1|  hypothetical protein VITISV_008684                     175   3e-48   Vitis vinifera
ref|XP_003531287.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       176   3e-48   Glycine max [soybeans]
ref|XP_006854001.1|  hypothetical protein AMTR_s00036p00237560          175   3e-48   
gb|KJB28079.1|  hypothetical protein B456_005G026100                    177   4e-48   Gossypium raimondii
gb|EYU17621.1|  hypothetical protein MIMGU_mgv1a006158mg                176   4e-48   Erythranthe guttata [common monkey flower]
emb|CDP08078.1|  unnamed protein product                                175   4e-48   Coffea canephora [robusta coffee]
ref|XP_010101355.1|  UDP-glycosyltransferase 74F2                       176   4e-48   
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       175   4e-48   Vitis vinifera
ref|XP_010915038.1|  PREDICTED: crocetin glucosyltransferase, chl...    176   5e-48   Elaeis guineensis
gb|EYU32718.1|  hypothetical protein MIMGU_mgv1a005538mg                176   5e-48   Erythranthe guttata [common monkey flower]
ref|XP_002868197.1|  indole-3-acetate beta-D-glucosyltransferase        176   6e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_006858838.1|  hypothetical protein AMTR_s00066p00179760          175   6e-48   Amborella trichopoda
gb|AFJ52963.1|  UDP-glycosyltransferase 1                               176   6e-48   Linum usitatissimum
ref|XP_006282890.1|  hypothetical protein CARUB_v10007134mg             175   7e-48   Capsella rubella
gb|AFJ52962.1|  UDP-glycosyltransferase 1                               176   7e-48   
ref|XP_008233915.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       174   8e-48   
emb|CDP08077.1|  unnamed protein product                                174   8e-48   
gb|EYU36923.1|  hypothetical protein MIMGU_mgv1a026563mg                175   9e-48   
ref|NP_001145859.1|  uncharacterized protein LOC100279371               175   9e-48   
ref|XP_006858826.1|  hypothetical protein AMTR_s00066p00176700          175   1e-47   
ref|XP_004140604.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       174   1e-47   
emb|CDP20001.1|  unnamed protein product                                174   1e-47   
emb|CDY22902.1|  BnaA01g18400D                                          174   1e-47   
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       174   1e-47   
ref|XP_007222137.1|  hypothetical protein PRUPE_ppa005722mg             174   1e-47   
gb|KGN46579.1|  hypothetical protein Csa_6G109740                       174   1e-47   
dbj|BAO51836.1|  UDP-glycosyltransferase 74Y1                           174   1e-47   
ref|XP_004162386.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    174   2e-47   
gb|KHN24034.1|  UDP-glycosyltransferase 74E2                            167   2e-47   
ref|XP_004140605.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       174   3e-47   
ref|XP_004957369.1|  PREDICTED: crocetin glucosyltransferase 2-like     173   3e-47   
emb|CDY65144.1|  BnaC01g41850D                                          173   4e-47   
ref|XP_008338819.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       173   4e-47   
ref|XP_010023608.1|  PREDICTED: crocetin glucosyltransferase, chl...    169   4e-47   
gb|KFK36297.1|  hypothetical protein AALP_AA4G104100                    173   4e-47   
ref|XP_008787452.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    173   4e-47   
ref|XP_004172403.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       167   5e-47   
emb|CDP13106.1|  unnamed protein product                                175   5e-47   
ref|XP_008233916.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       172   6e-47   
ref|XP_006380269.1|  putative glucosyltransferase family protein        165   6e-47   
ref|XP_004162387.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       172   6e-47   
ref|XP_010069226.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       172   8e-47   
sp|Q9ZR26.1|5GT2_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...    172   8e-47   
ref|XP_002462674.1|  hypothetical protein SORBIDRAFT_02g030030          172   8e-47   
ref|XP_002460531.1|  hypothetical protein SORBIDRAFT_02g030050          172   8e-47   
ref|XP_010673325.1|  PREDICTED: crocetin glucosyltransferase, chl...    173   8e-47   
emb|CDY09754.1|  BnaC07g33070D                                          174   9e-47   
ref|XP_004957371.1|  PREDICTED: crocetin glucosyltransferase 2-like     172   9e-47   
gb|EYU31602.1|  hypothetical protein MIMGU_mgv1a021119mg                172   1e-46   
gb|AFJ52964.1|  UDP-glycosyltransferase 1                               171   1e-46   
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                  171   2e-46   
ref|XP_007151246.1|  hypothetical protein PHAVU_004G030400g             171   2e-46   
ref|XP_010925318.1|  PREDICTED: crocetin glucosyltransferase, chl...    172   2e-46   
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    171   2e-46   
ref|XP_007151254.1|  hypothetical protein PHAVU_004G031100g             171   3e-46   
ref|XP_011082053.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       171   3e-46   
ref|XP_006858827.1|  hypothetical protein AMTR_s00066p00177000          171   4e-46   
gb|AEM42999.1|  UDP-glucosyltransferase                                 170   4e-46   
ref|XP_009146925.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       171   4e-46   
ref|XP_009776895.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       170   4e-46   
ref|XP_010557055.1|  PREDICTED: UDP-glycosyltransferase 74C1            171   4e-46   
gb|KCW57501.1|  hypothetical protein EUGRSUZ_H00270                     170   4e-46   
gb|AEZ01222.1|  UDP-glucosyltransferase                                 171   4e-46   
ref|XP_010324536.1|  PREDICTED: UDP-glycosyltransferase 74F1-like...    167   4e-46   
ref|XP_008455265.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    170   4e-46   
ref|XP_008791887.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    170   4e-46   
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       170   4e-46   
ref|XP_007143051.1|  hypothetical protein PHAVU_007G039500g             171   5e-46   
gb|KCW76863.1|  hypothetical protein EUGRSUZ_D01218                     169   5e-46   
ref|XP_008793436.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    170   5e-46   
ref|XP_010069224.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       170   5e-46   
ref|XP_010069225.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       170   6e-46   
gb|EPS72597.1|  hypothetical protein M569_02161                         163   6e-46   
ref|XP_007143050.1|  hypothetical protein PHAVU_007G039400g             170   6e-46   
ref|XP_006372900.1|  hypothetical protein POPTR_0017s061201g            166   6e-46   
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...    170   6e-46   
gb|EYU27002.1|  hypothetical protein MIMGU_mgv1a023035mg                170   6e-46   
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...    170   6e-46   
ref|XP_007159561.1|  hypothetical protein PHAVU_002G247700g             170   6e-46   
ref|XP_008361094.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       165   7e-46   
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       169   7e-46   
ref|XP_007143052.1|  hypothetical protein PHAVU_007G039600g             170   7e-46   
dbj|BAG80543.1|  UDP-glucose:glucosyltransferase                        169   7e-46   
gb|KCW57503.1|  hypothetical protein EUGRSUZ_H00275                     170   8e-46   
gb|KCW57502.1|  hypothetical protein EUGRSUZ_H00273                     170   8e-46   
ref|XP_008793440.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    170   8e-46   
ref|XP_009366994.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       169   9e-46   
ref|XP_010023607.1|  PREDICTED: crocetin glucosyltransferase, chl...    169   9e-46   
ref|XP_006653195.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       165   9e-46   
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       169   9e-46   
ref|XP_008235865.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       169   1e-45   
gb|AIT15666.1|  UDP-glycosyltransferase                                 168   1e-45   
emb|CAN67246.1|  hypothetical protein VITISV_008681                     169   1e-45   
emb|CBI24722.3|  unnamed protein product                                168   1e-45   
gb|EMT17556.1|  Putative UDP-glucosyltransferase                        165   1e-45   
gb|KJB27754.1|  hypothetical protein B456_005G007900                    169   1e-45   
ref|XP_007137294.1|  hypothetical protein PHAVU_009G115200g             169   1e-45   
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       169   1e-45   
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       169   1e-45   
ref|NP_172059.1|  Uridine diphosphate glycosyltransferase 74E2          169   1e-45   
ref|XP_010908630.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   1e-45   
emb|CAN67248.1|  hypothetical protein VITISV_008683                     168   2e-45   
ref|XP_008458142.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    168   2e-45   
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       168   2e-45   
ref|XP_010324535.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    167   2e-45   
gb|EAZ09772.1|  hypothetical protein OsI_32059                          169   2e-45   
emb|CDY31602.1|  BnaA03g54500D                                          168   2e-45   
gb|EAZ45384.1|  hypothetical protein OsJ_30030                          168   2e-45   
ref|XP_008787439.1|  PREDICTED: LOW QUALITY PROTEIN: cyanidin 3-O...    167   2e-45   
gb|KFK42906.1|  hypothetical protein AALP_AA1G053600                    168   2e-45   
ref|XP_006826758.1|  hypothetical protein AMTR_s00136p00072610          168   3e-45   
gb|KJB27755.1|  hypothetical protein B456_005G008000                    168   3e-45   
ref|XP_007033641.1|  Uridine diphosphate glycosyltransferase 74E2...    168   3e-45   
ref|XP_004504205.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       168   3e-45   
emb|CDP13110.1|  unnamed protein product                                168   3e-45   
ref|NP_001063685.1|  Os09g0518200                                       168   3e-45   
gb|ACR38641.1|  unknown                                                 168   3e-45   
gb|EMS46301.1|  UDP-glycosyltransferase 74E1                            162   3e-45   
ref|NP_001234680.1|  UDP-xylose phenolic glycosyltransferase            168   3e-45   
gb|KDP35129.1|  hypothetical protein JCGZ_10663                         167   4e-45   
ref|XP_002306205.2|  putative glucosyltransferase family protein        168   4e-45   
ref|XP_004167066.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       164   4e-45   
gb|KGN43661.1|  hypothetical protein Csa_7G051410                       167   4e-45   
ref|XP_002275387.2|  PREDICTED: UDP-glycosyltransferase 74E1-like       167   4e-45   
ref|XP_004244487.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    167   4e-45   
ref|XP_008394269.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       162   5e-45   
emb|CDP20003.1|  unnamed protein product                                167   6e-45   
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       167   6e-45   
ref|NP_001150551.1|  indole-3-acetate beta-glucosyltransferase          167   7e-45   
gb|AFK48618.1|  unknown                                                 159   7e-45   
gb|KCW57495.1|  hypothetical protein EUGRSUZ_H00261                     167   7e-45   
ref|XP_006372897.1|  putative glucosyltransferase family protein        167   7e-45   
ref|XP_008793438.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    167   8e-45   
ref|XP_010069220.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       167   8e-45   
ref|XP_004244486.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       167   8e-45   
ref|XP_010915126.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    171   8e-45   
ref|XP_011082054.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       167   9e-45   
emb|CDP20005.1|  unnamed protein product                                167   9e-45   
gb|AFJ52965.1|  UDP-glycosyltransferase 1                               167   9e-45   
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       167   1e-44   
gb|ABR17196.1|  unknown                                                 167   1e-44   
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   1e-44   
ref|XP_006388126.1|  hypothetical protein POPTR_0322s00200g             166   1e-44   
ref|XP_010522243.1|  PREDICTED: UDP-glycosyltransferase 74E2            166   1e-44   
ref|XP_009119126.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   1e-44   
ref|XP_004140239.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       162   1e-44   
ref|XP_010908641.1|  PREDICTED: crocetin glucosyltransferase 2-like     166   1e-44   
emb|CDP20085.1|  unnamed protein product                                166   1e-44   
ref|XP_010647893.1|  PREDICTED: UDP-glycosyltransferase 84B1            167   1e-44   
ref|XP_004145722.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   1e-44   
gb|AFJ52950.1|  UDP-glycosyltransferase 1                               166   1e-44   
gb|KDP35132.1|  hypothetical protein JCGZ_10666                         166   1e-44   
gb|KCW57500.1|  hypothetical protein EUGRSUZ_H00268                     165   1e-44   
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       166   1e-44   
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    166   2e-44   
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    166   2e-44   
ref|XP_006372895.1|  hypothetical protein POPTR_0017s06080g             164   2e-44   
gb|EAY93062.1|  hypothetical protein OsI_14865                          166   2e-44   
ref|XP_010025876.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       161   2e-44   
dbj|BAD34403.1|  putative UDP-glucose:salicylic acid glucosyltran...    166   2e-44   
ref|XP_006858835.1|  hypothetical protein AMTR_s00066p00178850          166   2e-44   
ref|XP_006357047.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   2e-44   
ref|XP_010242509.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       166   2e-44   
ref|XP_007033375.1|  Uridine diphosphate glycosyltransferase 74E2...    165   2e-44   
ref|XP_010908653.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       160   2e-44   
ref|XP_007201011.1|  hypothetical protein PRUPE_ppa005386mg             166   2e-44   
ref|XP_007201692.1|  hypothetical protein PRUPE_ppa016444mg             166   2e-44   
dbj|BAG80534.1|  putative glycosyltransferase                           166   2e-44   
emb|CAH66226.1|  H0825G02.3                                             166   2e-44   
ref|XP_006357048.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       166   2e-44   
gb|KCW59915.1|  hypothetical protein EUGRSUZ_H02639                     163   2e-44   
ref|XP_009141182.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       165   2e-44   
gb|ACR10263.1|  UDP-glucosyl transferase 74c1                           165   2e-44   
emb|CDY15370.1|  BnaC04g42530D                                          165   3e-44   
ref|XP_010679009.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    166   3e-44   
dbj|BAG80538.1|  UDP-glucose:glucosyltransferase                        165   3e-44   
emb|CDY19104.1|  BnaA04g18440D                                          165   3e-44   
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       165   3e-44   
ref|XP_008236256.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       165   3e-44   
gb|KDP35128.1|  hypothetical protein JCGZ_10662                         165   3e-44   
emb|CDY10139.1|  BnaC05g03820D                                          165   3e-44   
emb|CDY22741.1|  BnaA08g05710D                                          165   3e-44   
ref|XP_010069221.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       165   3e-44   
dbj|BAK55743.1|  UDP-glucose glucosyltransferase                        165   3e-44   
ref|XP_011464714.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    160   4e-44   
ref|XP_006342417.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       165   4e-44   
gb|EYU36667.1|  hypothetical protein MIMGU_mgv1a006023mg                165   4e-44   
ref|XP_010242475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       165   5e-44   
dbj|BAJ85997.1|  predicted protein                                      164   5e-44   
gb|KCW57497.1|  hypothetical protein EUGRSUZ_H00262                     160   5e-44   
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       164   6e-44   
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       164   6e-44   
gb|AFJ52955.1|  UDP-glycosyltransferase 1                               164   6e-44   
ref|XP_007033644.1|  Uridine diphosphate glycosyltransferase 74E2       166   6e-44   
ref|XP_011002951.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    165   6e-44   
ref|XP_009590343.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   6e-44   
ref|XP_004253028.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   6e-44   
ref|XP_010069222.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   7e-44   
ref|XP_002892308.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    164   8e-44   
gb|KEH25945.1|  UDP-glucosyltransferase family protein                  164   8e-44   
ref|XP_006661443.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       162   8e-44   
ref|XP_002462675.1|  hypothetical protein SORBIDRAFT_02g030040          164   8e-44   
ref|XP_008236255.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       164   8e-44   
dbj|BAB86925.1|  glucosyltransferase-7                                  160   8e-44   
ref|XP_007221276.1|  hypothetical protein PRUPE_ppa012496mg             156   9e-44   
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg             164   9e-44   
ref|XP_004290110.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       164   9e-44   
gb|KHN06762.1|  UDP-glycosyltransferase 74E1                            157   9e-44   
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    164   9e-44   
ref|XP_009403481.1|  PREDICTED: crocetin glucosyltransferase, chl...    164   1e-43   
ref|XP_007033374.1|  Uridine diphosphate glycosyltransferase 74E2...    166   1e-43   
ref|XP_009625439.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       164   1e-43   
gb|AFK43317.1|  unknown                                                 164   1e-43   
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   1e-43   
ref|XP_009783231.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       164   1e-43   
gb|KJB60859.1|  hypothetical protein B456_009G328300                    162   1e-43   
gb|KGN47941.1|  hypothetical protein Csa_6G418410                       164   1e-43   
ref|XP_004137037.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       164   1e-43   
emb|CDY70064.1|  BnaC08g46320D                                          163   1e-43   
ref|XP_003629941.1|  UDP-glucose glucosyltransferase                    164   1e-43   
ref|XP_010239703.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    164   1e-43   
ref|XP_006858836.1|  hypothetical protein AMTR_s00066p00178960          164   1e-43   
ref|XP_002467184.1|  hypothetical protein SORBIDRAFT_01g021110          164   1e-43   
ref|XP_006855046.1|  hypothetical protein AMTR_s00031p00082410          164   1e-43   
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    164   1e-43   
ref|XP_010069223.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       164   1e-43   
gb|KCW57498.1|  hypothetical protein EUGRSUZ_H00263                     164   1e-43   
ref|XP_006826757.1|  hypothetical protein AMTR_s00136p00071150          164   1e-43   
ref|XP_006417998.1|  hypothetical protein EUTSA_v10007603mg             163   1e-43   
ref|XP_006830014.1|  hypothetical protein AMTR_s02925p00003630          163   1e-43   
gb|KDP35130.1|  hypothetical protein JCGZ_10664                         163   1e-43   
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                  163   2e-43   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                        163   2e-43   
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative             163   2e-43   
ref|XP_010239702.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    164   2e-43   



>ref|XP_009601422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=470

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            LN SK QKEEIAKGL+EIK+PFLWVIRD+   + +E+EEKLSCM ELEKQG IVPWCSQ+
Sbjct  289  LNLSKDQKEEIAKGLIEIKKPFLWVIRDQENGKGDEKEEKLSCMMELEKQGKIVPWCSQL  348

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPS+GCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVR+ + E
Sbjct  349  EVLTHPSIGCFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRLKKNE  408

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DGVV SEEIKRCIE VMDGG+KGEE+RRNA+KW++LA EA +EGGSS+ NLK+F   V
Sbjct  409  DGVVESEEIKRCIEMVMDGGEKGEEMRRNAQKWKELAREAVKEGGSSEMNLKAFVQEV  466



>dbj|BAB88935.1| glucosyltransferase [Nicotiana tabacum]
Length=470

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            LN SK QKEEIAKGL+EIK+PFLWVIRD+   + +E+EEKLSCM ELEKQG IVPWCSQ+
Sbjct  289  LNLSKNQKEEIAKGLIEIKKPFLWVIRDQENGKGDEKEEKLSCMMELEKQGKIVPWCSQL  348

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPS+GCF++HCGWNSTLES+ SG  VVAFPHWTDQGTNAKLI+DVWKTGVR+ + E
Sbjct  349  EVLTHPSIGCFVSHCGWNSTLESLSSGVSVVAFPHWTDQGTNAKLIEDVWKTGVRLKKNE  408

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DGVV SEEIKRCIE VMDGG+KGEE+RRNA+KW++LA EA +EGGSS+ NLK+F   V
Sbjct  409  DGVVESEEIKRCIEMVMDGGEKGEEMRRNAQKWKELAREAVKEGGSSEMNLKAFVQEV  466



>dbj|BAG80544.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=469

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            LN S+ QKEEIAKGL+EIKRPFLWVIRD+   E  +EEE+LSCM ELEKQG IVPWCSQ+
Sbjct  291  LNLSRNQKEEIAKGLIEIKRPFLWVIRDQ---ENVKEEEELSCMMELEKQGKIVPWCSQL  347

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVRV   E
Sbjct  348  EVLTHPSLGCFVSHCGWNSTLESLSSGMPVVAFPHWTDQGTNAKLIEDVWKTGVRVKANE  407

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DGVV SEEIKRCIE VMDGG++GEE+R+NAKKW++LA EA +EGGSS+ NLK+F   V
Sbjct  408  DGVVESEEIKRCIEIVMDGGEEGEEMRKNAKKWKELAGEALKEGGSSEMNLKAFVQEV  465



>ref|XP_006358760.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklsc-meelEKQGLIVPWCSQ  543
            LN S+ QKEEIAKGL+EIKRPFLWVIRD+   +E E+EE+    M ELEKQG IVPWCSQ
Sbjct  291  LNLSRNQKEEIAKGLIEIKRPFLWVIRDQENIKEVEKEEEKLSCMMELEKQGKIVPWCSQ  350

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL HPSLGCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVR+   
Sbjct  351  LEVLTHPSLGCFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRMRVS  410

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            EDGVV SEEIKRCIE VMDGG+KGEE+R+NA+KW++LA EA +EGGSS+ NLK+F   V
Sbjct  411  EDGVVESEEIKRCIEIVMDGGEKGEEMRKNAQKWKELAREAVKEGGSSEVNLKAFVQEV  469



>ref|XP_009790237.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=468

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 3/178 (2%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            LN SK QKEEIAKGL+EIKRPFLWVIRD+   E  +EEEKLSCM ELEK G IVPWCSQ+
Sbjct  290  LNLSKDQKEEIAKGLIEIKRPFLWVIRDQ---ENGKEEEKLSCMMELEKHGKIVPWCSQL  346

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVR+ + E
Sbjct  347  EVLTHPSLGCFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRLKKNE  406

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DGVV +EEIKRCIE VMDGG+KGEE+RRNA+KW++LA EA +EGGSS+ NLK+F   V
Sbjct  407  DGVVENEEIKRCIEMVMDGGEKGEEMRRNAQKWKELAREAVKEGGSSEMNLKAFVQEV  464



>ref|XP_006368000.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklsc-meelEKQGLIVPWCSQ  543
            LN S+ QKEEIAKGL+EIKRPFLWVIRD+   +E E+EE+    M ELEKQG IVPWCSQ
Sbjct  291  LNLSRNQKEEIAKGLIEIKRPFLWVIRDQENIKEVEKEEEKLSCMMELEKQGKIVPWCSQ  350

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL HPSLGCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVR+   
Sbjct  351  LEVLTHPSLGCFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRMRVS  410

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            EDGVV SEEIKRCIE VMDGG+KGEE+R+NA+KW++LA EA +E GSS+ NLK+F   V
Sbjct  411  EDGVVESEEIKRCIEIVMDGGEKGEEMRKNAQKWKELAREAVKECGSSEVNLKAFVQEV  469



>gb|AAK54465.1| cold-induced glucosyl transferase [Solanum sogarandinum]
Length=473

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklsc-meelEKQGLIVPWCSQ  543
            LN S+ QKEEIAKGL+EIKRPFLWVIRD+   +E E+EE+    M ELEKQG IVPWCSQ
Sbjct  291  LNLSRNQKEEIAKGLIEIKRPFLWVIRDQENIKEVEKEEEKLSCMMELEKQGKIVPWCSQ  350

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL HPSLGCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAK I+DVWKTGVR+   
Sbjct  351  LEVLTHPSLGCFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKWIEDVWKTGVRMRVN  410

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            EDGVV SEEIKRCIE VMDGG+KGEE+R+NA+KW++LA EA +EGGSS+ NLK+F   V
Sbjct  411  EDGVVESEEIKRCIEIVMDGGEKGEEMRKNAQKWKELAREAVKEGGSSEVNLKAFVQEV  469



>ref|XP_004247894.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 3/178 (2%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            LN S+ QKEEIAKGL+EI+RPFLWVIRD+   EEE+EEEKLSCM ELEKQG IVPWCSQ+
Sbjct  292  LNLSRNQKEEIAKGLIEIQRPFLWVIRDQ---EEEKEEEKLSCMMELEKQGKIVPWCSQL  348

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF++HCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVR+   E
Sbjct  349  EVLTHPSLGCFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRMRVNE  408

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DGVV S+EIKRCIE VMDGG+KGEE+R+NA+KW++LA  A +EGGSS+ NLK+F   V
Sbjct  409  DGVVESDEIKRCIEIVMDGGEKGEEMRKNAQKWKELARAAVKEGGSSEVNLKAFVLQV  466



>dbj|BAM28983.1| UDP-glucose crocetin glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            L   K Q EEIA+GLL+  RPFLWVIR K   EEE+EE++L CMEELE+QG+IVPWCSQI
Sbjct  288  LTLPKQQMEEIARGLLKSGRPFLWVIRAKENGEEEKEEDRLICMEELEEQGMIVPWCSQI  347

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF+THCGWNSTLES+  G PVVAFPHWTDQGTNAKLI+DVW+TGVRV   E
Sbjct  348  EVLTHPSLGCFVTHCGWNSTLESLVCGVPVVAFPHWTDQGTNAKLIEDVWETGVRVVPNE  407

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            DG V S+EIKRCIETVMD G+KG ELRRNAKKW++LA EA +E GSSD NLK+F
Sbjct  408  DGTVESDEIKRCIETVMDDGEKGVELRRNAKKWKELAREAMQEDGSSDKNLKAF  461



>sp|F8WKW0.1|UGT1_GARJA RecName: Full=Crocetin glucosyltransferase, chloroplastic; AltName: 
Full=UDP-glucose glucosyltransferase 1; Short=GjUGT1; 
AltName: Full=UDP-glycosyltransferase 75L6; Flags: Precursor 
[Gardenia jasminoides]
 dbj|BAK55736.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            L   K Q EEIA+GLL+  RPFLWVIR K   EEE+EE++L CMEELE+QG+IVPWCSQI
Sbjct  288  LTLPKQQMEEIARGLLKSGRPFLWVIRAKENGEEEKEEDRLICMEELEEQGMIVPWCSQI  347

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF+THCGWNSTLE++  G PVVAFPHWTDQGTNAKLI+DVW+TGVRV   E
Sbjct  348  EVLTHPSLGCFVTHCGWNSTLETLVCGVPVVAFPHWTDQGTNAKLIEDVWETGVRVVPNE  407

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            DG V S+EIKRCIETVMD G+KG EL+RNAKKW++LA EA +E GSSD NLK+F
Sbjct  408  DGTVESDEIKRCIETVMDDGEKGVELKRNAKKWKELAREAMQEDGSSDKNLKAF  461



>emb|CDP15115.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 4/175 (2%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            L PSK Q EEIA+GLLE KRPFLWVIR +    ++ EEEKLSC++ELE++GLIVPW SQ+
Sbjct  277  LTPSKHQMEEIARGLLECKRPFLWVIRAR----DDGEEEKLSCIKELEQKGLIVPWSSQL  332

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            +VLKHPSLGCF+THCGWNSTLE+I  G PVVAFP W DQGTNAKLIQDVWK GVRV   E
Sbjct  333  QVLKHPSLGCFVTHCGWNSTLETITLGVPVVAFPLWADQGTNAKLIQDVWKIGVRVVPNE  392

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
            DG+V S+EIKRCIE VMDGG+ G E   NAKKW+DLA EA  EGG SDTNLK+FA
Sbjct  393  DGLVESDEIKRCIELVMDGGENGLEFGGNAKKWKDLAGEAMVEGGLSDTNLKAFA  447



>ref|XP_002262883.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SKTQKEEIA+GLL+  +PFLWVIR     EE +EE+KLSC EELEK+G+IVPWCSQIEVL
Sbjct  285  SKTQKEEIARGLLDCGQPFLWVIRAPENGEEVKEEDKLSCREELEKKGMIVPWCSQIEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+ SG PVVAFP W DQGTNAKLI+D+WK G+RV   E+G+
Sbjct  345  THPSLGCFVSHCGWNSTLESLVSGVPVVAFPQWADQGTNAKLIEDIWKIGIRVIVNEEGI  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+EIKRC+E  M GG KGEE++RNA+KW++LA EA ++GGSSD NLK F   V
Sbjct  405  VESDEIKRCLEIAMRGGVKGEEMKRNAEKWKNLAREAVKDGGSSDMNLKGFVDEV  459



>emb|CAN67608.1| hypothetical protein VITISV_036779 [Vitis vinifera]
Length=469

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SKTQKEEIA+GLL+  +PFLWVIR     EE +EE+KLSC EELEK+G+IVPWCSQIEVL
Sbjct  285  SKTQKEEIARGLLDCGQPFLWVIRAPENGEEVKEEDKLSCREELEKKGMIVPWCSQIEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+ SG PVVAFP W DQGTNAKLI+D+WK G+RV   E+G+
Sbjct  345  THPSLGCFVSHCGWNSTLESLVSGVPVVAFPQWADQGTNAKLIEDIWKIGIRVIVNEEGI  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+EIKRC+E  M GG KGEE++RNA+KW++LA EA ++GGSSD NLK F   V
Sbjct  405  VESDEIKRCLEIAMRGGVKGEEMKRNAEKWKNLAREAVKDGGSSDMNLKGFVDEV  459



>dbj|BAA89009.1| anthocyanin 5-O-glucosyltransferase [Petunia x hybrida]
Length=468

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            +NPS +Q EEI+KGL++I RPFLWVI++  E  +EEE +KL C+EELEK G IVPWCSQ+
Sbjct  288  MNPSISQMEEISKGLIDIGRPFLWVIKEN-EKGKEEENKKLGCIEELEKIGKIVPWCSQL  346

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVLKHPSLGCF++HCGWNS LES+  G PVVAFP WTDQ TNAK ++DVWK+GVRV   E
Sbjct  347  EVLKHPSLGCFVSHCGWNSALESLACGVPVVAFPQWTDQMTNAKQVEDVWKSGVRVRINE  406

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DGVV SEEIKRCIE VMDGG+KGEELR+NAKKW++LA EA +EGGSS  NLK+F  +V
Sbjct  407  DGVVESEEIKRCIELVMDGGEKGEELRKNAKKWKELAREAVKEGGSSHKNLKAFIDDV  464



>ref|XP_002263700.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SKTQKE+IA+ LL+   PFLWVIR     EE +E++KLSC EELE++G+IV WCSQIEVL
Sbjct  285  SKTQKEDIARALLDCGHPFLWVIRAPENGEEVKEQDKLSCREELEQKGMIVSWCSQIEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+D+WK G+RVT  E+G+
Sbjct  345  THPSLGCFVSHCGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDMWKIGIRVTVNEEGI  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+E KRC+E VM GG+KGEE+RRNA+KW++LA EA ++GGSSD NLK F   V
Sbjct  405  VESDEFKRCLEIVMGGGEKGEEMRRNAEKWKNLAREAVKDGGSSDKNLKGFVDEV  459



>ref|XP_011101605.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=315

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRD--KPeneeeeeeeklscmeelEKQGLIVPWCSQIEV  534
            K Q EEIAKGLL+  RPFLWVIRD  K   E++E++E+LSCMEELEK G IVPWCSQ+EV
Sbjct  136  KAQMEEIAKGLLDSSRPFLWVIRDNEKANEEKKEDDERLSCMEELEKVGRIVPWCSQLEV  195

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNSTLESI  G PVVAFPHWTDQGTNAKLI+DVW+TGVRV   EDG
Sbjct  196  LTHPSLGCFVTHCGWNSTLESISCGIPVVAFPHWTDQGTNAKLIEDVWRTGVRVRGNEDG  255

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            VV S EI+RCIE VMDG +K  +LR N +KW+DLA EA  E G S+ NLK+F   +
Sbjct  256  VVESSEIRRCIEEVMDGREKSRKLRENTEKWKDLAREAMEENGCSNKNLKAFFDEI  311



>ref|XP_002263301.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=464

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL   RPFLWVIR K   EEE+E++KLSC+EELE+QG+IVPWCSQ+EVL
Sbjct  286  SKQQSEEIARGLLASGRPFLWVIRAKENGEEEKEDDKLSCVEELEQQGMIVPWCSQVEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+  G PVVAFP WTDQ TNAKLI+DVWKTG+RV   ++G+
Sbjct  346  SHPSLGCFVSHCGWNSTLESLACGVPVVAFPQWTDQTTNAKLIEDVWKTGLRVMVNQEGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V   EIK+C+E VM  G+KG+E+RRNAKKW+DLA EA +EGGSSD NLK+F   +
Sbjct  406  VEGGEIKKCLELVMGCGEKGQEVRRNAKKWKDLAREAVKEGGSSDKNLKNFVNEI  460



>ref|XP_009337747.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 133/175 (76%), Gaps = 5/175 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAKGLL+  RPFLWVIRDK   + E+ E K        ++     G IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGRPFLWVIRDKVNKKGEDNEAKEEEKMLSCREELEELGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESLASGVPVVAFPQWTDQGTNAKLIEDAWKTGVRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            E G+V  EE+KRC+E VM+ G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F
Sbjct  415  EKGIVTGEELKRCLELVMESGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAF  469



>emb|CDP15111.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIA GLL+  RPFLWVIR K + EEE+EE++LSCMEELE++G+IVPWCSQIEVL+
Sbjct  294  KKQMEEIASGLLKSGRPFLWVIRAKEDGEEEKEEDRLSCMEELEEKGMIVPWCSQIEVLR  353

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            HPSLGCF+THCGWNSTLES+  G PV+AFPHW DQGTNAKLI+DVW+TGV+V   EDG V
Sbjct  354  HPSLGCFLTHCGWNSTLESLVCGVPVIAFPHWVDQGTNAKLIEDVWETGVKVVPNEDGTV  413

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             S+EI RCIETVMD  +KG ELRRNA KW++LA EA +EGGSSD N+K++
Sbjct  414  DSDEINRCIETVMDDEEKGIELRRNAMKWKELAREATQEGGSSDKNIKAY  463



>ref|XP_003632054.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=465

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RPFLWVIR K + EEE+EE+KLSC  ELE+QG+IVPWCSQ+EVL
Sbjct  287  SKQQSEEIARGLLDSGRPFLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVL  346

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +PSLGCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL +DVWKTGVRVT  ++G+
Sbjct  347  SNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGI  406

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+EIKRC+E VM  G++ +E+RRNAKKW+ LA EA  EGGSSD NLK+F   V
Sbjct  407  VESDEIKRCLELVMGDGEEAKEMRRNAKKWKGLAREAVMEGGSSDKNLKNFMDEV  461



>ref|XP_010650395.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=497

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RPFLWVIR K + EEE+EE+KLSC  ELE+QG+IVPWCSQ+EVL
Sbjct  319  SKQQSEEIARGLLDSGRPFLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVL  378

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +PSLGCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL +DVWKTGVRVT  ++G+
Sbjct  379  SNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGI  438

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+EIKRC+E VM  G++ +E+RRNAKKW+ LA EA  EGGSSD NLK+F   V
Sbjct  439  VESDEIKRCLELVMGDGEEAKEMRRNAKKWKGLAREAVMEGGSSDKNLKNFMDEV  493



>ref|XP_006349903.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=470

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 145/174 (83%), Gaps = 1/174 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            +NPS +Q +EI+KGL++I RPFLW+I++  E  +E E++ + C+EELEK G IVPWCSQ+
Sbjct  290  MNPSISQMDEISKGLIDIGRPFLWIIKED-EKNKENEKKTIGCIEELEKIGKIVPWCSQL  348

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL+HPSLGCF++HCGWNS LES+  G PVVAFP WTDQ TNAK I+DVWK+GVRV   E
Sbjct  349  EVLRHPSLGCFVSHCGWNSALESLACGVPVVAFPQWTDQMTNAKQIEDVWKSGVRVNVNE  408

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            DG+V SEE+KRCIE VMDGG KGEE+R+NAKKW++LA EA +EGGSS  NLK+F
Sbjct  409  DGIVESEELKRCIELVMDGGVKGEEMRKNAKKWKELAREAVKEGGSSHKNLKAF  462



>ref|XP_004252978.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            +NPS +Q EEI+KGL+ I RPFLW+I+ + E  +E E+  + C+EELEK G IVPWCSQ+
Sbjct  290  MNPSISQMEEISKGLIGIGRPFLWIIK-QDEKNKENEKNVIGCIEELEKIGKIVPWCSQL  348

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL+HPSLGCF++HCGWNS LES+  G PVVAFP WTDQ TNAK I+DVWK+GVRV   E
Sbjct  349  EVLRHPSLGCFVSHCGWNSALESLACGVPVVAFPQWTDQMTNAKQIEDVWKSGVRVNVNE  408

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            DG+V SEE+KRCIE VMDGG KGEE+R+NAKKW++LA EA +EGGSS  NLK+F   V
Sbjct  409  DGIVESEELKRCIECVMDGGVKGEEMRKNAKKWKELAREAVKEGGSSHKNLKAFIDEV  466



>gb|ABQ02258.1| O-glucosyltransferase 3 [Vitis labrusca]
Length=464

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q E+IA+ LL   RPFLWVIR  P N E EEE+     E  EK G+IV WC Q++VL
Sbjct  287  SKQQMEKIARALLHSSRPFLWVIRSAPGNGEVEEEKLSCREELEEK-GMIVAWCPQLDVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCFITHCGWNSTLE + SG PVVAFP WTDQGTNAKLI+D+WKTGVRVT  E+G+
Sbjct  346  SHPSLGCFITHCGWNSTLECLASGVPVVAFPQWTDQGTNAKLIEDLWKTGVRVTANEEGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V SEEIKRC++ VM  G++GEELRRNA KW+DLA EA ++GGSSD NLK+F
Sbjct  406  VESEEIKRCLDVVMGRGERGEELRRNAGKWKDLAREAVKDGGSSDYNLKAF  456



>emb|CDP15112.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIA GLL+  RPFLWVIR K + EEE+EE++LSCMEELE++G+IVPWCSQIEVL 
Sbjct  292  KKQMEEIASGLLKSGRPFLWVIRAKEDGEEEKEEDRLSCMEELEEKGMIVPWCSQIEVLT  351

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            HPSLGCF+THCGWNSTLES+  G  ++AFPHW+DQGTNAKLI+DVW+TGVRV   EDG V
Sbjct  352  HPSLGCFVTHCGWNSTLESLVCGVRMIAFPHWSDQGTNAKLIEDVWETGVRVIPNEDGTV  411

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             S+EIKRCIETVM  G KG ELRRNA  W++LA EA +EGGSSD NLK+F
Sbjct  412  ESDEIKRCIETVMGDGAKGIELRRNAMNWKELAREAMQEGGSSDKNLKAF  461



>ref|XP_009373577.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 134/179 (75%), Gaps = 5/179 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAKGLL+  RPFLWVIRDK E + +  E K        ++     G IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGRPFLWVIRDKVEKKGDNNEVKKEEEMLSCREELEELGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            + VL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTG+R+TQ 
Sbjct  355  VAVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGLRMTQN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            E+G+V  EE+KRC+E V+  G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F   +
Sbjct  415  EEGIVTGEELKRCLELVVGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDQI  473



>emb|CAN76093.1| hypothetical protein VITISV_027116 [Vitis vinifera]
Length=466

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q E+IA+ LL   RPFLWVIR  P   E EEE+     E  EK G+IV WC Q++VL
Sbjct  287  SKQQMEKIARALLHSGRPFLWVIRSAPGXGEVEEEKLSCREELEEK-GMIVAWCPQLDVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCFITHCGWNST E + SG PVVAFP WTDQGTNAKLI+D+WKTGVRVT  E+G+
Sbjct  346  SHPSLGCFITHCGWNSTFECLASGVPVVAFPQWTDQGTNAKLIEDLWKTGVRVTANEEGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V SEEIKRC+E VM  G++GEELRRNA KW+DLA EA ++GGSSD NLK+F
Sbjct  406  VESEEIKRCLEVVMGRGERGEELRRNAGKWKDLAREAVKDGGSSDYNLKAF  456



>ref|XP_002266628.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=498

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 134/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q E+IA+ LL   RPFLWVIR  P N E EEE+     E  EK G+IV WC Q++VL
Sbjct  319  SKQQMEKIARALLHSGRPFLWVIRSAPGNGEVEEEKLSCREELEEK-GMIVAWCPQLDVL  377

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCFITHCGWNSTLE + SG PVVAFP WTDQGTNAKLI+D+WKTGVRVT  E+G+
Sbjct  378  SHPSLGCFITHCGWNSTLECLASGVPVVAFPQWTDQGTNAKLIEDLWKTGVRVTANEEGI  437

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V SEEIKRC+E VM  G++GEELRRNA KW+DLA EA ++GGSSD NLK F
Sbjct  438  VESEEIKRCLEVVMGRGERGEELRRNAGKWKDLAREAVKDGGSSDYNLKVF  488



>ref|XP_008380456.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDK-----PeneeeeeeeklscmeelEKQGLIVPWCSQ  543
            K Q EEIAKGLL+  RPFLWVIR+K      +NE +EEEE LSC EELEK G IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGRPFLWVIREKVDKKGDDNESKEEEEMLSCREELEKLGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESMASGVPVVAFPQWTDQGTNAKLIEDAWKTGVRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            E G+V  EE+KRC+E VM  G+ GEE+RRNAKKW+DLA EA  EGGSSD NL++F   +
Sbjct  415  EKGIVTGEELKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLRAFLDRI  473



>ref|XP_007221319.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
 gb|EMJ22518.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
Length=474

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q EEIAKGLL+  RPFLWVIR+K E++ +++E      +   ++     G IVPWCS
Sbjct  294  SKPQMEEIAKGLLDSGRPFLWVIREKEESKGQDKEADKEEEKLSCREELEELGKIVPWCS  353

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT 
Sbjct  354  QVEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTP  413

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             ++G+V  EE+KRC+E VM  G+ GEELRRNAKKW+ LA EA  EGGSSD NLK+F   +
Sbjct  414  NDEGIVVGEELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  473



>emb|CAN75179.1| hypothetical protein VITISV_018406 [Vitis vinifera]
Length=497

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RPFLWVIR K + EEE+EE+KLSC  ELE+QG+IVPWCSQ+EVL
Sbjct  319  SKHQSEEIARGLLDSGRPFLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVL  378

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +PSLGCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL +DVWKTGVRVT  ++G+
Sbjct  379  SNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGI  438

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+EIKRC+E VM  G++ +E+RRNAKKW+ LA EA  E GSSD NLK+F   V
Sbjct  439  VESDEIKRCLELVMGDGEEAKEMRRNAKKWKGLAREAVMEXGSSDKNLKNFMDEV  493



>ref|XP_009373576.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=572

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 133/179 (74%), Gaps = 5/179 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAKGLL+  RPFLWVIRDK + + E+ E K        ++     G IVPWCSQ
Sbjct  393  KAQMEEIAKGLLDCGRPFLWVIRDKVDKKGEDNEVKEEEEMLSCREELEELGKIVPWCSQ  452

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTG RVT  
Sbjct  453  VEVLSSPSLGCFVTHCGWNSSLESLASGVPVVAFPQWTDQGTNAKLIEDTWKTGARVTPN  512

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            E G+V  EE+KRC+E VM  G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F   +
Sbjct  513  EKGIVTGEELKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDQI  571



>ref|XP_007221281.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
 gb|EMJ22480.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
Length=474

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q EEIAKGLL+  RPFLWVIR+K  +   ++E +    +   ++     G IVPWCS
Sbjct  294  SKPQMEEIAKGLLDSGRPFLWVIREKEGSNGRDKEAEKEEEKLSCREELEELGKIVPWCS  353

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT 
Sbjct  354  QVEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTP  413

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             ++G+V  EE+KRC+E VM  G+ GEELRRNAKKW+ LA EA  EGGSSD NLK+F   +
Sbjct  414  NDEGIVAGEELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  473



>ref|XP_008348418.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAKGLL+  RPFLWVIRDK   + E+ E K        ++     G IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGRPFLWVIRDKVNKKGEDNEAKEEEEMLSCREELEELGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES  SG PVVAFP WTDQGTNAKLI+D WKTG+RVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESFASGVPVVAFPQWTDQGTNAKLIEDAWKTGLRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            E G+V  +E+KRC+E VM  G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F   +
Sbjct  415  EKGIVTGDELKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDRI  473



>ref|XP_008222736.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=474

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q EEIAKGLL+  RPFLWVIR+K  +   ++E +    +   ++     G IVPWCS
Sbjct  294  SKPQMEEIAKGLLDSGRPFLWVIREKEGSNGRDKEAEKEEEKLSCREELEELGKIVPWCS  353

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT 
Sbjct  354  QVEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTP  413

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             ++G+V  EE+KRC+E VM  G+ GEELRRNAKKW+ LA EA  EGGSSD NLK+F   +
Sbjct  414  NDEGIVVGEELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  473



>ref|XP_011024782.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscme----elEKQGLIVPWCSQ  543
            SK Q EEIA+GL++   PFLWVIRD+ +  EE+EEE+          LE+QG+IVPWC Q
Sbjct  285  SKQQIEEIARGLVDSGLPFLWVIRDEQKKNEEKEEEEDHPSACREAILERQGMIVPWCCQ  344

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL HPS+GCF+THCGWNSTLES+ S  PVVAFPHWTDQGTNAKLI DVWKTGVRV   
Sbjct  345  VEVLSHPSIGCFVTHCGWNSTLESLVSEVPVVAFPHWTDQGTNAKLIADVWKTGVRVAAN  404

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            E+G+V  +EIKRC++ VM  G  GE++R+NAKKW+DLA +A +EGGSSD NLK+F   V
Sbjct  405  EEGIVKGDEIKRCLDLVMAHGKMGEDIRKNAKKWKDLARDAVKEGGSSDKNLKAFVQEV  463



>ref|XP_002267330.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=497

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RP LWVIR K + EEE+EE+KLSC  ELE+QG+IVPWCSQ+EVL
Sbjct  319  SKQQSEEIARGLLDSGRPLLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVL  378

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +PSLGCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL +DVWKTGVRVT  ++G+
Sbjct  379  SNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGI  438

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V +++IKRC+E VM  G++ +E+RRNA KW+DLA EA  EGGSSD NLK+F
Sbjct  439  VEADKIKRCLELVMGDGEEAKEMRRNANKWKDLAREAVMEGGSSDKNLKNF  489



>ref|XP_008380454.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 5/179 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAK LL+  RP+LWVIRDK E + ++ E K        ++     G IVPWCSQ
Sbjct  295  KAQMEEIAKALLDCGRPYLWVIRDKVEKKGDDNEAKKEEEMLSCREELEELGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            + VL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTG+RVTQ 
Sbjct  355  VAVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGLRVTQN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            E+G+V  EE KRC+E VM  G+ GEE+RRNAKKW+DLA EA  EGGSS+ N K+F   +
Sbjct  415  EEGIVTGEEFKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSNKNFKAFLDQI  473



>ref|XP_011097030.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like, 
partial [Sesamum indicum]
Length=281

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 140/176 (80%), Gaps = 3/176 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIAKGL++  RPFLWVIR    +  E+ EE LSC ++LEKQG IVPWC+Q+EVL
Sbjct  100  SKPQTEEIAKGLIKSGRPFLWVIRG--VDNSEKLEEMLSCGKDLEKQGKIVPWCTQVEVL  157

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGED-G  354
             HPS+GCF THCGWNS+LES+ SG PVVAFP W DQ  NAKLIQD W+TG+ V + ED G
Sbjct  158  SHPSVGCFFTHCGWNSSLESLASGVPVVAFPQWIDQTINAKLIQDFWRTGLSVGKPEDGG  217

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            VV ++EI+RC+E VMDGG++GEE+RR A+KWRDLA EA +EGG+S  NLK+FA  V
Sbjct  218  VVKADEIERCLEIVMDGGERGEEMRREARKWRDLAKEAAKEGGTSYVNLKTFADQV  273



>ref|XP_007099701.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY20331.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=466

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEV  534
            +K Q EEIA+ LL   RPFLWV+R++ +N E+E+EE      E  +Q G+IVPWCSQ+EV
Sbjct  285  AKLQVEEIARALLASGRPFLWVVRNQKQNGEKEKEEDKLSCREELEQFGMIVPWCSQVEV  344

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNSTLES+ +G PV+AFP WTDQGTNAKLIQDVW+TGVRVT  E+G
Sbjct  345  LSHPSLGCFVTHCGWNSTLESLVAGVPVMAFPQWTDQGTNAKLIQDVWETGVRVTANEEG  404

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V   EI RC++ VM  G++  ELRRNA+KW+DLA EA +EGGS D NLK+F  +V
Sbjct  405  IVERGEINRCLDLVMGNGERANELRRNAEKWKDLAREAAKEGGSLDMNLKAFIDDV  460



>ref|XP_008222735.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=473

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q EEIAKGLL+  RPFLWVIR+K ++  +++E +    +   ++     G IVPWCS
Sbjct  293  SKPQMEEIAKGLLDSGRPFLWVIREKEKSNGQDKEAEKEEEKLSCREELEELGKIVPWCS  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT 
Sbjct  353  QVEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTP  412

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             ++G+V  EE+KRC+E VM  G+ G+ELRRNAKKW+ LA EA  EGGSSD NLK+F   +
Sbjct  413  NDEGIVVGEELKRCLELVMGSGEIGKELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  472



>ref|XP_002263975.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RPFLWVIR K ENEEEE+E+KLSC+EELE+ G+IVPWCSQ+EVL
Sbjct  286  SKQQSEEIARGLLDSGRPFLWVIRAK-ENEEEEKEDKLSCVEELEQLGMIVPWCSQVEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+ SG PVVAFP WTDQ TNAKLI+DVWKTG+RV   ++G+
Sbjct  345  SHPSLGCFVSHCGWNSTLESLASGVPVVAFPQWTDQTTNAKLIEDVWKTGLRVMVNQEGI  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V   EIK+C+E VM GG++G+E+R NAKKW+DLA EA ++GGSSD NLK+F   +
Sbjct  405  VEGGEIKKCLELVMGGGERGQEVRSNAKKWKDLAREAVKDGGSSDKNLKNFVDEI  459



>gb|ACW82415.1| putative glucosyltransferase, partial [Olea europaea]
Length=263

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            L   K Q EEIAKGLLE  RPFLWVIR K    +E++++KLSC+ ELEK G IVPWCSQ+
Sbjct  82   LRLPKVQLEEIAKGLLECGRPFLWVIRVKENPRKEKDDDKLSCLVELEKLGKIVPWCSQL  141

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            +VL HPS+GCF+THCGWNSTLE I  G P+VAFP W DQGTNA+LIQDVW+TG+RV   E
Sbjct  142  DVLTHPSVGCFVTHCGWNSTLECISCGVPMVAFPFWADQGTNARLIQDVWRTGLRVKPRE  201

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
            DG V S+EIKRCIET+MD G+K  ELR NA+KW++ A EA +E GSS  NLK+F 
Sbjct  202  DGTVESDEIKRCIETIMDDGEKCRELRENARKWKNTAREAMQEDGSSTKNLKAFV  256



>ref|XP_008380455.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=481

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 5/180 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAKGLL+   PFLWVIRDK + + ++ E K        ++     G+IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGLPFLWVIRDKVDKKGDDNEAKKEEEMLRCREELEELGMIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDYWKTGVRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            E+G+V  EE+KRC++ V+  G+ GE++RRNAKKW+DLA EA  EG SSD NLK+F   ++
Sbjct  415  EEGIVTGEELKRCLDLVLGSGEIGEDVRRNAKKWKDLAREAVSEGDSSDKNLKAFLDQIK  474



>gb|AAX16493.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Malus domestica]
Length=481

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 134/180 (74%), Gaps = 5/180 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCSQ  543
            K Q EEIAKGLL+   PFLWVIRDK   + ++ E K        ++     G+IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGLPFLWVIRDKVGKKGDDNEAKKEEEMLRCREELEELGMIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDYWKTGVRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            E+G+V  EE+KRC++ V+  G+ GE++RRNAKKW+DLA EA  EG SSD NL++F   ++
Sbjct  415  EEGIVTGEELKRCLDLVLGSGEIGEDVRRNAKKWKDLAREAVSEGDSSDKNLRAFLDQIK  474



>gb|EYU22114.1| hypothetical protein MIMGU_mgv1a026355mg, partial [Erythranthe 
guttata]
Length=312

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIAKGLLE  RPFLWVIR   + + EEE+EKLSC++ELEK G IVPWCSQ+EVL 
Sbjct  138  KAQMEEIAKGLLESDRPFLWVIRINEDKKNEEEKEKLSCLDELEKIGKIVPWCSQLEVLT  197

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVT-QGEDGV  351
            HPS+GCF++HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+DVWK+GVRV   G DGV
Sbjct  198  HPSIGCFVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGLGGDGV  257

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V S EIKRCIE VMDGG K  ELR NA++W+ LA EA  E GSS  NLK+F
Sbjct  258  VESGEIKRCIEEVMDGGGKSRELRVNAREWKCLAREAMDENGSSSNNLKAF  308



>ref|XP_008380634.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Malus domestica]
Length=472

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 134/179 (75%), Gaps = 4/179 (2%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ----GLIVPWCSQI  540
            K Q EEIAKGLL+  RPFLWVIRDK E + ++ E K   +    ++    G I+PWC Q+
Sbjct  294  KAQTEEIAKGLLDCGRPFLWVIRDKIEKKGDDNESKKEEILSCREELEELGRILPWCGQV  353

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL   SLGCF+THCGWNS+LES+ SG P+VAFP W DQGTNAKLI+D WKTGVRVT  E
Sbjct  354  EVLSSASLGCFVTHCGWNSSLESLVSGVPMVAFPQWMDQGTNAKLIEDSWKTGVRVTPNE  413

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            +G+V  EE+KRC+E VM+ G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F   + 
Sbjct  414  EGIVTGEELKRCLELVMESGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDQIH  472



>gb|AAY27090.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Pyrus communis]
Length=481

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDK-----PeneeeeeeeklscmeelEKQGLIVPWCSQ  543
            K Q EEIAKGLL+   PFLWVIRDK      +NE ++EE  LSC  ELE+ G IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGLPFLWVIRDKVDKKGDDNEAKQEEAMLSCRVELEELGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDFWKTGVRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
             +G+V  EE+KRC++ V+  G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F   ++
Sbjct  415  VEGIVTGEELKRCLDLVLGSGEIGEEVRRNAKKWKDLAREAVNEGGSSDKNLKAFLDQIK  474



>ref|XP_002301754.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
 gb|EEE81027.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
Length=469

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 137/180 (76%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscm-----eelEKQGLIVPWCS  546
            SK Q EEIA+GL++   PFLWVIRD+    E +EEE+   +       LE+QG+IVPWC 
Sbjct  285  SKRQMEEIARGLVDSDLPFLWVIRDEQNKNEVKEEEEEDHLRACREAILERQGMIVPWCC  344

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+ VL HPS+GCF+THCGWNSTLES+    PVVAFPHWTDQGTNAKLI DVWKTGVRV  
Sbjct  345  QVGVLSHPSIGCFVTHCGWNSTLESLVCEVPVVAFPHWTDQGTNAKLIADVWKTGVRVVA  404

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E+G+V  +EIKRC++ VM  G  GE++R+NAKKW+DLA +A +EGGSSD NLK+F  +V
Sbjct  405  NEEGIVEGDEIKRCLDLVMAHGKTGEDIRKNAKKWKDLARDAVKEGGSSDKNLKAFVQDV  464



>ref|XP_011081386.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=475

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 142/180 (79%), Gaps = 2/180 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIR--DKPeneeeeeeeklscmeelEKQGLIVPWCS  546
            L+  K+Q EEIAKGLL+  RPFLWV R  +K + E++EE E LSCMEELEK G IV WCS
Sbjct  288  LSLPKSQMEEIAKGLLDSGRPFLWVRRVNEKAKEEKKEENENLSCMEELEKVGRIVSWCS  347

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL HPSLGCF+THCGWNSTLESI  G PVVAFPHWTDQGTNAKLI+DVWKTGVRV  
Sbjct  348  QLEVLTHPSLGCFMTHCGWNSTLESISCGVPVVAFPHWTDQGTNAKLIEDVWKTGVRVRA  407

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             EDGVV   EI+RCIE VMDGG+K  ELR NA+KW+ LA EA  E GSS+ NLK+F   V
Sbjct  408  NEDGVVECAEIRRCIEEVMDGGEKSIELRHNAEKWKSLAGEAMEENGSSNMNLKAFLEEV  467



>gb|KCW45597.1| hypothetical protein EUGRSUZ_L006312, partial [Eucalyptus grandis]
Length=198

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QK E+A+GLLE  RPFLWV+      + + ++++L   EE++K+G+IVPWCSQIEVL
Sbjct  26   SKAQKREMARGLLETGRPFLWVM-----GKGDGDDDELIYKEEIDKRGVIVPWCSQIEVL  80

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             HPS+GCF+THCGWNST+ES+  G P+VAFP W DQ TNAKL++DVWK GVRV++   E 
Sbjct  81   SHPSIGCFLTHCGWNSTIESLVCGIPMVAFPQWADQMTNAKLVEDVWKVGVRVSEIDQEG  140

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             +V + EIK+C+E VM GG++G+E+RRNAKKW+DL MEA++EGGSSD NLK+F   +
Sbjct  141  IIVEAGEIKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  197



>ref|XP_011101592.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=472

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIR--DKPeneeeeeeeklscmeelEKQGLIVPWCS  546
            L+  + Q EEIAKGLL+  RPFLWVIR  +K   E++EE+EKLSC+EELEK G IVPWCS
Sbjct  288  LSLPRAQMEEIAKGLLDSSRPFLWVIRVNEKANEEKKEEDEKLSCIEELEKAGRIVPWCS  347

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL HPSLGCF+THCGWNS+LESI  G P+VAFPHWTDQ TNAKLI+DVW+TGVRV +
Sbjct  348  QLEVLTHPSLGCFMTHCGWNSSLESISCGVPMVAFPHWTDQCTNAKLIEDVWRTGVRVRR  407

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             EDGV  S EI+RCIE VMDGG+K  ELR N +KW+ LA EA  E GSS+ NLK+F   V
Sbjct  408  NEDGVAESSEIRRCIEEVMDGGEKSRELRENVEKWKGLAREAVEENGSSNKNLKAFLEGV  467



>ref|XP_002321086.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|EEE99401.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=467

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 3/178 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscm---eelEKQGLIVPWCSQI  540
            S  Q EEI++GL++   PFLWV+RD+   ++E+EE+          LEKQG++VPWC Q+
Sbjct  285  SNRQMEEISRGLVQGGLPFLWVVRDEQNKKKEKEEDDQLSACREAILEKQGMVVPWCCQV  344

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPS+GCF+THCGWNSTLES+ SG PVVAFPHWTDQGTNAKLI+DVWKTGVRV   E
Sbjct  345  EVLSHPSIGCFVTHCGWNSTLESLVSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRVVANE  404

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +G+V  +EIKR ++ VM  G  GE+ R+NAKKW+DLA++A ++GGSSD NLK+F   V
Sbjct  405  EGIVEGDEIKRSLDLVMADGKTGEDFRKNAKKWKDLALDAVKDGGSSDKNLKAFVDEV  462



>emb|CDP15120.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            Q EEIA+GLL+ K+PFLWV+R  P+ E+ EE+       E  KQGLIV WCSQ+EVL HP
Sbjct  290  QLEEIAQGLLQSKKPFLWVLRKSPKGEKLEEKLSCKDELE--KQGLIVSWCSQVEVLSHP  347

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GCF++HCGWNS+LES+ SG PVVA P WTDQ TNAK IQDVWKTG+R T  E+G V +
Sbjct  348  SVGCFVSHCGWNSSLESLASGVPVVAIPLWTDQTTNAKFIQDVWKTGIRPTANEEGTVEA  407

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +EI+R +E VMDGG +GEE+R+ AKKWR+LA+EA ++GGSS  N+K+F   V
Sbjct  408  DEIRRSLEIVMDGGVRGEEMRKTAKKWRELAVEAAKDGGSSSLNVKAFVNEV  459



>ref|XP_009373578.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=481

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDK-----PeneeeeeeeklscmeelEKQGLIVPWCSQ  543
            K Q EEIAKGLL+   PF WVIRD       +NE ++EE  LSC  ELE+ G IVPWCSQ
Sbjct  295  KAQMEEIAKGLLDCGLPFFWVIRDNVDKKGDDNEAKKEEAMLSCRVELEELGRIVPWCSQ  354

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL  PSLGCF+THCGWNS+LES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRVT  
Sbjct  355  VEVLSSPSLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDFWKTGVRVTPN  414

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
             +G+V  EE+KRC++ V+  G+ GEE+RRNAKKW+DLA EA  EGGSSD NLK+F   ++
Sbjct  415  VEGIVTGEELKRCLDLVLGSGEIGEEVRRNAKKWKDLAREAVNEGGSSDKNLKAFLDQIK  474



>ref|XP_007034186.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY05112.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=465

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEV  534
            +K Q EEIA+ LL   RPFLWVIR++ +N EEE+EE      E  +Q G+IVPWCSQ+EV
Sbjct  285  AKQQVEEIARALLASGRPFLWVIRNQKQNGEEEKEEDKLSCREELEQFGMIVPWCSQVEV  344

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNSTLES+ +G  VVAFP WTDQGTNAKLIQDVW+TGVRV+  E+G
Sbjct  345  LSHPSLGCFVTHCGWNSTLESLVAGVSVVAFPQWTDQGTNAKLIQDVWETGVRVSANEEG  404

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V   EI RC++ VM  G++  ELRR A+KW+DLA EA +EGGS D NLK+F  +V
Sbjct  405  IVERGEINRCLDLVMGDGERANELRRTAEKWKDLAREAAKEGGSLDMNLKAFIDDV  460



>gb|AHL68667.1| UDP-glucose: anthocyanin 5-O-glucosyltransferase [Vitis amurensis]
Length=464

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  Q EEIA+GLLE  RPFLWVIR K   EE +EE+KLSC EELEKQG+++ WCSQ+EVL
Sbjct  286  SMQQMEEIARGLLESGRPFLWVIRAKENGEENKEEDKLSCQEELEKQGMLIQWCSQMEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF+THCGWNS++ES+ SG P++AFP W DQGTN KLI+DVWKTGVR+   E+ +
Sbjct  346  SHPSLGCFVTHCGWNSSIESLASGVPMIAFPQWADQGTNTKLIKDVWKTGVRLMVNEEEI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S+E++RC+E VM  G+KG+E+R+NAKKW+ LA EA +EGGSS  NLK+F   V
Sbjct  406  VTSDELRRCLELVMGDGEKGQEMRKNAKKWKILAKEALKEGGSSHKNLKNFVDEV  460



>ref|XP_010023602.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=470

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EE+A  LL+  RPFLWVIR K   EEE++E++LS M+ELE++G+IVPWCSQ+EVL
Sbjct  289  SKRQAEELACALLDCGRPFLWVIRAKQNGEEEKDEDRLSRMQELEEKGMIVPWCSQLEVL  348

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+  G PVVAFP WTDQGTNAKLI+DVW+TG+RV    +G+
Sbjct  349  SHPSLGCFLSHCGWNSTLESLALGIPVVAFPQWTDQGTNAKLIEDVWRTGIRVRPNGEGL  408

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V + EI+RC+ETVM  G+  EE+RRNA KW++ A EA REGGSSD NLK+F   V
Sbjct  409  VEAGEIRRCLETVMADGEMREEVRRNAAKWKESAREAAREGGSSDRNLKAFIEEV  463



>ref|XP_002267526.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 4/178 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RPFLWVIR     EE EEE+ LSC EELE+QG++VPWCSQ+EVL
Sbjct  286  SKQQSEEIARGLLDGGRPFLWVIR----LEENEEEKTLSCHEELERQGMMVPWCSQVEVL  341

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+TH GWNSTLES+ SG PVVAFP W+DQ TNAKLI+ VWKTG+R    ++G+
Sbjct  342  SHPSMGCFVTHSGWNSTLESLTSGVPVVAFPQWSDQATNAKLIEVVWKTGLRAMVNQEGI  401

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRNH  177
            V ++EIKRC+E VM  G++GEE+RRNA KW+ LA EA +EGGSSD NLK+F   V ++
Sbjct  402  VEADEIKRCLELVMGSGERGEEMRRNATKWKVLAREAVKEGGSSDKNLKNFMNEVMHN  459



>ref|XP_002301753.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|ABK96313.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81026.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=472

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscm--------eelEKQGLIVP  555
            SK Q EEIA+GL++    FLWVIRD+ +  E +EEE+              LE+QG+IVP
Sbjct  285  SKRQIEEIARGLVDSGLTFLWVIRDEQKKNEVKEEEEEEEEDHLRACREAILERQGMIVP  344

Query  554  WCSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVR  375
            WC Q+EVL HPS+GCF+THCGWNSTLES+    PVVAFPHWTDQGTNAKLI DVWKTGVR
Sbjct  345  WCCQVEVLSHPSIGCFVTHCGWNSTLESLVCEVPVVAFPHWTDQGTNAKLIADVWKTGVR  404

Query  374  VTQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
            V   E+G+V  +EIKRC++ VM  G  GE++R+NAKKW+DLA +A +EGGSSD NLK+F 
Sbjct  405  VVANEEGIVEGDEIKRCLDLVMAHGKTGEDIRKNAKKWKDLARDAVKEGGSSDKNLKAFV  464

Query  194  GNV  186
             +V
Sbjct  465  QDV  467



>ref|XP_007221288.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
 gb|EMJ22487.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
Length=474

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 133/182 (73%), Gaps = 5/182 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q EEIAKGLL+  RPFLWVIR+K E   ++ E +    +   ++     G IV WCS
Sbjct  293  SKDQMEEIAKGLLDYGRPFLWVIREKEERNGQDNETEKEEEKFSCREELKELGKIVLWCS  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL +PSLGCF+THCGWNS++ES+ SG PVVAFP WTDQ TNAKLI+D WKTGVRV  
Sbjct  353  QLEVLSNPSLGCFVTHCGWNSSMESLVSGVPVVAFPLWTDQRTNAKLIEDTWKTGVRVAP  412

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E+G+V  EE+KRC+E VM  G+ GEELRRNAKKW+ LA EA  EGGSSD NL +F   +
Sbjct  413  NEEGIVVGEELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDKNLMAFLDQI  472

Query  185  RN  180
             N
Sbjct  473  GN  474



>ref|XP_010023609.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59919.1| hypothetical protein EUGRSUZ_H02643 [Eucalyptus grandis]
Length=465

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 140/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ L+E  RPFLWVIR+    +EE +E++LS  EEL+K G+IVPWCSQ+EVL
Sbjct  286  SKPQKEEMARALVEAGRPFLWVIRES--GKEERDEDRLSFKEELDKIGMIVPWCSQVEVL  343

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+ CF+THCGWNST ES+  G P+VAFP W+DQ TNAKL+ DVW+TGVR+T  E G+
Sbjct  344  SHPSVACFVTHCGWNSTSESLVCGVPMVAFPQWSDQQTNAKLVADVWRTGVRITPNEQGL  403

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            V S E++RC+E VM  G +GEE+RRNA+K+RDLA EA +EGGSSD NL++F   VR
Sbjct  404  VESGEMRRCLELVMGDGKEGEEMRRNARKFRDLAREAVKEGGSSDKNLRAFVDEVR  459



>emb|CDP15119.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            Q EEIA+GLL+ K+PFLWVIR  P+ E+  E+       E  KQGLIV WCSQ+EVL HP
Sbjct  290  QLEEIAQGLLQSKKPFLWVIRKSPKGEKLGEKLSCKDELE--KQGLIVSWCSQVEVLSHP  347

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GCF++HCGWNS+LES+ SG PVVA P WTDQ TNAK IQDVWKTG+R    E+G V +
Sbjct  348  SVGCFVSHCGWNSSLESLASGVPVVAIPIWTDQTTNAKFIQDVWKTGIRPMGNEEGTVEA  407

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +EI+R +E VMDGG +GEE+R+ AKKWR+LA+EA ++GGSS  N+K+F   V
Sbjct  408  DEIRRSLEIVMDGGVRGEEMRKTAKKWRELAVEAAKDGGSSSLNVKAFVDEV  459



>ref|XP_010040347.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45290.1| hypothetical protein EUGRSUZ_L01046 [Eucalyptus grandis]
Length=411

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QK E+A+GLLE  RPFLWV+R     + + ++++L   EEL+K+G+IVPWCSQIEVL
Sbjct  239  SKAQKREMARGLLETGRPFLWVMR-----KGDGDDDELIYKEELDKRGVIVPWCSQIEVL  293

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             HPS+GCF+THCGWNST+ES+  G P+VAFP W DQ TNAKL++DVWK GVRV++   E 
Sbjct  294  SHPSIGCFLTHCGWNSTIESLVCGIPMVAFPQWIDQMTNAKLVEDVWKVGVRVSEIDQEG  353

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             +V   EIK+C+E VM GG++G+E+RRNAKKW+DL MEA++EGGSSD NLK+F   +
Sbjct  354  IIVEGGEIKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  410



>ref|XP_010039940.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45599.1| hypothetical protein EUGRSUZ_L00632 [Eucalyptus grandis]
Length=456

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QK E+A+GLLE  RPFLWV+R       + ++++L C EEL+K+G+IVPWCSQIEVL
Sbjct  284  SKAQKREMARGLLETGRPFLWVMRKD-----DGDDDELICKEELDKRGVIVPWCSQIEVL  338

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             HPS+GCF+THCGWNST+ES+  G P+VAFP W DQ TNAKL++DVWK GVRV++   E 
Sbjct  339  SHPSIGCFLTHCGWNSTIESLVCGIPMVAFPQWIDQMTNAKLVEDVWKVGVRVSEIDQEG  398

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             +V   EIK+C+E VM GG++G+E+RRNAKKW+DL MEA++EGGSSD NLK+F   +
Sbjct  399  IIVEGGEIKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  455



>gb|ABL85474.1| glycosyltransferase UGT75L4 [Maclura pomifera]
Length=472

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 139/175 (79%), Gaps = 5/175 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q EEIAKGLLE  RPFLW+IR+  + +E++EEEKLS  EEL+K G IVPWC Q+EVL
Sbjct  297  SRAQMEEIAKGLLESGRPFLWIIRED-KEKEKKEEEKLSFEEELQKLGKIVPWCRQVEVL  355

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             + SLGCF+THCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+DVWK GVRV   E G+
Sbjct  356  SNTSLGCFMTHCGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDVWKIGVRVKPNEKGI  415

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V SEE+ RC+E VM+    GEELR NAKKW+DLA EA +EGGSS+ NLK+F   V
Sbjct  416  VESEEVTRCLELVME----GEELRENAKKWKDLAREAAKEGGSSNENLKAFVAEV  466



>ref|XP_010023610.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010023611.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59920.1| hypothetical protein EUGRSUZ_H02644 [Eucalyptus grandis]
Length=462

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ L+E+ RPFLW+IR+    +EE +E++LS  EEL+K G+IVPWCSQ+ VL
Sbjct  285  SKPQKEEMARALVEVGRPFLWIIRES--GKEERDEDRLSFQEELDKLGMIVPWCSQVAVL  342

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+THCGWNST ES+  G PVVAFP W+DQ TNAKL+ DVW+TGV++T  E G+
Sbjct  343  SHPSVGCFLTHCGWNSTSESLVCGVPVVAFPQWSDQQTNAKLLADVWRTGVKLTPNELGL  402

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            V S E+KRC++ V+  G++G E+RRNAKK+RDLA EA +EGGSSD NL++F   VR
Sbjct  403  VESSEVKRCLDLVVGDGEEGNEMRRNAKKFRDLAREAVKEGGSSDKNLRAFVDEVR  458



>ref|XP_010650398.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 144/174 (83%), Gaps = 1/174 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIA+GLL+  +PFLWVIR K ENEEEE+E+KLSC+EELE+ G+IVPWCSQ+EVL 
Sbjct  287  KQQSEEIARGLLDSGQPFLWVIRAK-ENEEEEKEDKLSCVEELEQLGMIVPWCSQVEVLS  345

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            HPSLGCF++HCGWNS LES+ SG PVVAFP WTDQ  NAKLI+DVWKTG+RV   ++G+V
Sbjct  346  HPSLGCFVSHCGWNSALESLASGVPVVAFPQWTDQTINAKLIEDVWKTGLRVMVNQEGLV  405

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
               EIK+C+E VM GG++G+E+R NAKKW+DLA E  ++GGSSD NLK+F   +
Sbjct  406  EGGEIKKCLELVMGGGERGQEVRSNAKKWKDLATEVVKDGGSSDKNLKNFVDEI  459



>ref|XP_010023603.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59914.1| hypothetical protein EUGRSUZ_H02638 [Eucalyptus grandis]
Length=470

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  Q EE+A  LL+  RPF+WVIR K   EEE++E++LSCM+ELE++G+IVPWCSQ+EVL
Sbjct  289  SMRQAEELACALLDCGRPFMWVIRAKQNGEEEKDEDRLSCMQELEEKGMIVPWCSQLEVL  348

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF++HCGWNSTLES+  G P+VAFP WTDQGTNAKLI+DVW+TGVRV    +G+
Sbjct  349  SHPSLGCFLSHCGWNSTLESLALGVPMVAFPQWTDQGTNAKLIEDVWRTGVRVRPNGEGL  408

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V + EI+RC+ETVM  G++ EE+RRNA KW++ A E  REGGSSD NLK+F   V
Sbjct  409  VEAGEIRRCLETVMADGERREEVRRNAAKWKESAREVAREGGSSDRNLKAFIEEV  463



>ref|XP_010069411.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=456

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QK E+A+GLLE  RPFLWV+      + + ++++L   EE++K+G+IVPWCSQIEVL
Sbjct  284  SKAQKREMARGLLETGRPFLWVM-----GKGDGDDDELIYKEEIDKRGVIVPWCSQIEVL  338

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             HPS+GCF+THCGWNST+ES+  G P+VAFP W DQ TNAKL++DVWK GVRV++   E 
Sbjct  339  SHPSIGCFLTHCGWNSTIESLVCGIPMVAFPQWADQMTNAKLVEDVWKVGVRVSEIDQEG  398

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             +V + EIK+C+E VM GG++G+E+RRNAKKW+DL MEA+++GGSSD NLK+F   +
Sbjct  399  IIVEAGEIKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKDGGSSDKNLKAFVEEI  455



>ref|XP_010025933.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW57753.1| hypothetical protein EUGRSUZ_H00502 [Eucalyptus grandis]
Length=166

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = -2

Query  689  IAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSLGC  510
            +A+GLLE  RPFLWV+R    +++E   ++        K+G+IVPWCSQIEVL HPS+GC
Sbjct  1    MARGLLETGRPFLWVMRKDDGDDDELICKEELD-----KRGVIVPWCSQIEVLSHPSIGC  55

Query  509  FITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GEDGVVGSEE  336
            F+THCGWNST+ES+  G P+VAFP W DQ TNAKL++DVWK GVRV++   E  +V   E
Sbjct  56   FLTHCGWNSTIESLVCGIPMVAFPQWIDQMTNAKLVEDVWKVGVRVSEIDQEGIIVEGGE  115

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            IK+C+E VM GG++G+E+RRNAKKW+DL MEA++EGGSSD NLK+F   +
Sbjct  116  IKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  165



>ref|XP_010052789.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=472

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ L+E+ RPFLWVIR+    +EE +E++LS  EEL+K G+IV WCSQ+EVL
Sbjct  295  SKPQKEEMARALVEVGRPFLWVIRES--GKEERDEDRLSFQEELDKLGMIVLWCSQVEVL  352

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+THCGWNST ES+  G P+VAFP W+DQ TNAKL+ DVW+TGV++T  E G+
Sbjct  353  SHPSVGCFVTHCGWNSTSESLVCGVPMVAFPQWSDQLTNAKLVADVWRTGVKMTPNELGL  412

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            V S E+KRC+E V+  G++GEE+RRNA+K+RDLA EA +EGGSSD NL++F    R
Sbjct  413  VESGEMKRCLELVVGDGEEGEEMRRNARKFRDLAREAVKEGGSSDKNLRAFVDEAR  468



>gb|KHN12357.1| UDP-glycosyltransferase 75D1 [Glycine soja]
Length=424

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            KTQ EE+A+ LL+   PFLWVI++K    + E +E+LSC+EELE++G IV WCSQ+EVL 
Sbjct  247  KTQMEELARALLDCGSPFLWVIKEKENKSQVEGKEELSCIEELEQKGKIVNWCSQVEVLS  306

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GEDG  354
            H S+GCF+THCGWNST+ES+ SG P+VAFP W +Q TNAKLI+DVWKTGVRV +   EDG
Sbjct  307  HGSVGCFVTHCGWNSTMESLASGVPMVAFPQWVEQKTNAKLIEDVWKTGVRVDKQVNEDG  366

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V +EEI+RC+E VM  G+KG+ELR NA+KWR LA EA +EGGSSD NL++F  +V
Sbjct  367  IVENEEIRRCLEEVMGSGEKGQELRNNAEKWRGLAREAVKEGGSSDKNLRAFLDDV  422



>ref|XP_009622554.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 130/176 (74%), Gaps = 6/176 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K   EEIA+GLL+ +RPFLWV+  +         E LSC EELEKQG IV WCSQ+EVL+
Sbjct  295  KQMMEEIAQGLLQSERPFLWVVNGE------NTMENLSCKEELEKQGKIVSWCSQVEVLQ  348

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            HPSLGCF+THCGWNSTLES+ SG PVVA P WTDQG N+KLIQDVWKTGVRV   EDG V
Sbjct  349  HPSLGCFLTHCGWNSTLESLVSGIPVVACPLWTDQGCNSKLIQDVWKTGVRVNVNEDGFV  408

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRN  180
               E KRCIE VM  G +GEELR+NAKKWRD A +  +E GSS+ NLK++   V N
Sbjct  409  EGAEFKRCIEIVMADGKEGEELRKNAKKWRDSAKDTIQEDGSSNVNLKAYVDEVLN  464



>ref|XP_004298222.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 135/174 (78%), Gaps = 7/174 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscm---eelEKQGLIVPWCSQI  540
            SKTQ EE+AKGLL+  RPFLWVIR+  +N   +EE++   +    ELE+ G IVPWCSQ+
Sbjct  294  SKTQMEELAKGLLDYGRPFLWVIRENQKNGGGKEEKEEQELSCRAELEELGKIVPWCSQV  353

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL +PSLGCF+THCGWNS++ES+ SG PVVAFP WTDQ TNAKLI++ WKTG+RV   E
Sbjct  354  EVLSNPSLGCFVTHCGWNSSMESLVSGVPVVAFPQWTDQCTNAKLIEETWKTGIRVAPNE  413

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +GVV  EE+ RC+E VM     GEELRRNAKKW++LA EA  EGGSSD NLK+F
Sbjct  414  EGVVVDEELTRCLELVMG----GEELRRNAKKWKELAREAVSEGGSSDKNLKAF  463



>emb|CAN62624.1| hypothetical protein VITISV_001657 [Vitis vinifera]
Length=456

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+ LL   RPFLWVIR    N E EEE+     E  EK G+IV WC Q++VL
Sbjct  277  SKQQMEEIARALLHSGRPFLWVIRSASGNGEVEEEKLSCREELEEK-GMIVAWCPQLDVL  335

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCFITHCGWNSTLE + SG PVVAFP WTDQGTN KLI+DVWKTGVRVT  E+G+
Sbjct  336  SHPSLGCFITHCGWNSTLECLASGVPVVAFPQWTDQGTNGKLIEDVWKTGVRVTANEEGI  395

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  EEIKRC+E VM GG++GEELRRNA KW+DLA EA ++GGSSD NLK+F
Sbjct  396  VEGEEIKRCLEVVMGGGERGEELRRNAGKWKDLAREAVKDGGSSDNNLKAF  446



>ref|XP_010039960.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=166

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 135/170 (79%), Gaps = 7/170 (4%)
 Frame = -2

Query  689  IAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSLGC  510
            +A+GLLE  RPFLWV+      + + ++++L   EE++K+G+IVPWCSQIEVL HPS+GC
Sbjct  1    MARGLLETGRPFLWVM-----GKGDGDDDELIYKEEIDKRGVIVPWCSQIEVLSHPSIGC  55

Query  509  FITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GEDGVVGSEE  336
            F+THCGWNST+ES+  G P+VAFP W DQ TNAKL++DVWK GVRV++   E  +V + E
Sbjct  56   FLTHCGWNSTIESLVCGIPMVAFPQWADQMTNAKLVEDVWKVGVRVSEIDQEGIIVEAGE  115

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            IK+C+E VM GG++G+E+RRNAKKW+DL MEA++EGGSSD NLK+F   +
Sbjct  116  IKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  165



>ref|XP_003531212.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=465

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            KTQ EE+A+ LL+   PFLWVI++K    + E +E+LSC+EELE++G IV WCSQ+EVL 
Sbjct  288  KTQMEELARALLDCGSPFLWVIKEKENKSQVEGKEELSCIEELEQKGKIVNWCSQVEVLS  347

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GEDG  354
            H S+GCF+THCGWNST+ES+ SG P+VAFP W +Q TNAKLI+DVWKTGVRV +   EDG
Sbjct  348  HGSVGCFVTHCGWNSTMESLASGVPMVAFPQWVEQKTNAKLIEDVWKTGVRVDKQVNEDG  407

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V +EEI+RC+E VM  G+KG+ELR NA+KWR LA EA +EGGSSD NL++F  +V
Sbjct  408  IVENEEIRRCLEEVMGSGEKGQELRNNAEKWRGLAREAVKEGGSSDKNLRAFLDDV  463



>ref|XP_010099953.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB80936.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=493

 Score =   210 bits (534),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 136/183 (74%), Gaps = 12/183 (7%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklsc--------meelEKQGLIVP  555
            S+ Q EEIAKGLL+  RPFLWVIR+K + +E E++ +            EEL K G+IVP
Sbjct  303  SRPQMEEIAKGLLDCGRPFLWVIREKAKKKESEKKNEEREEEEEKLSCHEELSKLGMIVP  362

Query  554  WCSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVR  375
            WC Q+EVL   SLGCF+THCGWNSTLES+  G PVVAFP WTDQGTNAKLI+D+WKTGVR
Sbjct  363  WCRQVEVLSSASLGCFVTHCGWNSTLESLVCGVPVVAFPQWTDQGTNAKLIEDMWKTGVR  422

Query  374  VTQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
            V   E G+V S++IKRC++ VM+    GEELRRNA +WRDLA EA +EGGSSD NLK+F 
Sbjct  423  VKPNEKGIVESQDIKRCLDLVME----GEELRRNAVRWRDLAREAAKEGGSSDKNLKAFV  478

Query  194  GNV  186
              +
Sbjct  479  AEM  481



>ref|XP_004297014.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ----GLIVPWCSQ  543
            SK Q EE+AKGLL+  RPFLWVIR+  +  E +EE++         +    G+IVPWCSQ
Sbjct  296  SKNQMEELAKGLLDCGRPFLWVIRENQKKGEGKEEKEEEEELSCRAELEELGMIVPWCSQ  355

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL +PSLGCF+THCGWNSTLES+  G PVVAFP W+DQGTNAKLI+D WKTGVRV + 
Sbjct  356  VEVLSNPSLGCFVTHCGWNSTLESLVCGVPVVAFPQWSDQGTNAKLIEDSWKTGVRVERN  415

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            E+GVV  EEIKRC++ VM+     +++RRNAKKW+DLA EA  EGGSS  NLK+F
Sbjct  416  EEGVVVGEEIKRCLDLVME----SDKMRRNAKKWKDLAREAVSEGGSSHKNLKAF  466



>dbj|BAG80545.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=467

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 137/179 (77%), Gaps = 3/179 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S    EEIA+GL++  RPFLWVIR+      E  EE L+C EELEK G IV WCSQ+EVL
Sbjct  290  SSQLMEEIAQGLVKYGRPFLWVIRE--GQNGENPEENLTCKEELEKHGKIVRWCSQVEVL  347

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +H SLGCF+THCGWNSTLES+CSG PVVA P WTDQG NAKL+QDVWKTGVRV   +DG+
Sbjct  348  QHLSLGCFLTHCGWNSTLESVCSGVPVVACPLWTDQGCNAKLVQDVWKTGVRVNANKDGI  407

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV-RNH  177
            V  +E KRCIE VM+ G+K +EL++NAKKW+DLA EA +E GSS+ NL+++   +  NH
Sbjct  408  VERDEFKRCIEIVMEDGEKRDELKKNAKKWKDLAKEAMKENGSSNLNLRAYVNEILLNH  466



>ref|XP_002266919.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 135/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA GLL   RPFLWVIR+ P+  E ++EE L C EELE++G+IVPWCSQ+EVL
Sbjct  286  SKPQMEEIACGLLNSDRPFLWVIRE-PDKGEMKDEEMLGCREELEQRGMIVPWCSQLEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF+THCGWNSTLES+  G PVVAFP  TDQ TNAKLI D+WKTG+RV   E+G+
Sbjct  345  THPSLGCFVTHCGWNSTLESMVCGVPVVAFPQGTDQATNAKLITDMWKTGIRVWVNEEGM  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +EIK C+E VM  G++ E LRRNA+KW++LA EA + GG SD NLK+F   V
Sbjct  405  VERDEIKMCLEIVMGDGERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  459



>ref|XP_002263422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=456

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+ LL   RPFLWVIR    N E EEE+     E  EK G+IV WC Q++VL
Sbjct  277  SKQQMEEIARALLHSGRPFLWVIRSASGNGEVEEEKLSCREELEEK-GMIVAWCPQLDVL  335

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCFITHCGWNSTLE + SG PVVAFP WTDQGTN KLI+DVWK+GVRVT  E+G+
Sbjct  336  SHPSLGCFITHCGWNSTLECLASGVPVVAFPQWTDQGTNGKLIEDVWKSGVRVTANEEGI  395

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  EEIKRC+E VM GG++GEELRRNA KW+DLA EA ++GGSSD NLK+F
Sbjct  396  VEGEEIKRCLEVVMGGGERGEELRRNAGKWKDLAREAVKDGGSSDNNLKAF  446



>gb|AFI98393.1| UDP-glucosyltransferase, partial [Fragaria x ananassa]
Length=332

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 130/175 (74%), Gaps = 8/175 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ----GLIVPWCSQ  543
            SK Q EE+AKGLL+  RPFLWVIR+  +  E +EE++         +    G+IVPWCSQ
Sbjct  153  SKNQMEELAKGLLDCGRPFLWVIRENQKKGEGKEEKEEEEELSCRAELEELGMIVPWCSQ  212

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVL +PSLGCF+THCGWNSTLES+  G PVVAFP W+DQGTNAKLI+D WKTGVRV   
Sbjct  213  VEVLSNPSLGCFVTHCGWNSTLESLVCGVPVVAFPQWSDQGTNAKLIEDSWKTGVRVEPN  272

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            E+G+V  EEIKRC++ VM+     +++RRNAKKW+DLA EA  EGGS   NLK+F
Sbjct  273  EEGIVVGEEIKRCLDLVME----SDKMRRNAKKWKDLAREAVSEGGSFHKNLKAF  323



>ref|XP_010650447.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=665

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklsc---meelEKQGLIVPWCSQIE  537
            K Q EEIA+ LL+  RPFLWV+R +     ++++++       EELE++G+IVPWCSQ+E
Sbjct  296  KPQMEEIARALLDSGRPFLWVLRSQGSGNVKDKDQEEEKWSCREELEEKGMIVPWCSQLE  355

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGED  357
            VL HPSLGCF+THCGWNSTLE +  G P+VAFP W+DQ TNAKLI ++WKTGVR    E+
Sbjct  356  VLSHPSLGCFVTHCGWNSTLEGLACGVPIVAFPQWSDQRTNAKLITEMWKTGVRALVNEE  415

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            G+V S+E+KRC+E VM+ G++  E+RRNA+KW+DLA EA +EGGSSD NLK+F   V
Sbjct  416  GIVESDEMKRCLEIVMEDGERAREMRRNAEKWKDLAREAVKEGGSSDRNLKAFVDEV  472



>ref|XP_003601705.1| O-glucosyltransferase [Medicago truncatula]
 gb|AES71956.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscme-----elEKQGLIVPWCS  546
            SK Q EEIA+ LL+    FLWVIRDK   +++EEE     +      E    G IV WCS
Sbjct  293  SKRQMEEIARALLDSGFSFLWVIRDKKLQQQKEEEVDDDELSCREELENNMNGKIVKWCS  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL H SLGCF+THCGWNSTLES+ SG P+VAFP WTDQ TNAKLI+DVWKTG+R+  
Sbjct  353  QVEVLSHRSLGCFMTHCGWNSTLESLGSGVPMVAFPQWTDQTTNAKLIEDVWKTGLRMEH  412

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E+G+V  EEI++C+E VM  G+KGEELRRNAKKW+DLA  A +EGGSS+ NL+S+  ++
Sbjct  413  DEEGMVKVEEIRKCLEVVMGKGEKGEELRRNAKKWKDLARAAVKEGGSSNRNLRSYLNDI  472



>ref|XP_002266967.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA  LL   RPFLWVIR   EN E EEE+     E  EK G+IV WC Q++VL
Sbjct  286  SKQQMEEIAHALLHSGRPFLWVIRSASENGEVEEEKLSCRKELEEK-GMIVVWCPQLDVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCFITHCGWNSTLE + SG PVVAFP WTDQGTN KLI+DVWKTGVRVT  E+G+
Sbjct  345  SHPSLGCFITHCGWNSTLECLASGVPVVAFPQWTDQGTNGKLIEDVWKTGVRVTANEEGI  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  EEIKRC+E VM GG++GEELRRNA KW+DLA EA ++GGSSD NLK+F
Sbjct  405  VEGEEIKRCLEVVMGGGERGEELRRNAGKWKDLAREAVKDGGSSDCNLKAF  455



>ref|XP_004298223.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 137/175 (78%), Gaps = 5/175 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIAKGLL   RPFLWVIR+  +   E+EE+K+SC EELE+ G+IVPWCSQ+EVL
Sbjct  297  SKIQMEEIAKGLLISGRPFLWVIREN-QKNGEKEEDKVSCREELEELGMIVPWCSQVEVL  355

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +PSLGCF+THCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRV   E+GV
Sbjct  356  SNPSLGCFVTHCGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVEPNEEGV  415

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  EEIKRC++ VM+     +++R NAKKW+DLA EA  EGGSS  N+K F   +
Sbjct  416  VVGEEIKRCLDLVME----SDKMRMNAKKWKDLAREAVSEGGSSGKNMKVFLDQI  466



>ref|XP_010023606.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59917.1| hypothetical protein EUGRSUZ_H02641 [Eucalyptus grandis]
Length=463

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ L+E  RPFLWVIR     +EE +E++LSC EEL+  G+IVPWCSQ+EVL
Sbjct  286  SKPQKEEMARALVEAGRPFLWVIRTS--GKEERDEDRLSCEEELKNLGMIVPWCSQVEVL  343

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+THCGWNST ES+  G PVVAFP W+DQ TNAKL+ DVW+TGV+VT  E G+
Sbjct  344  SHHSVGCFVTHCGWNSTSESLVCGVPVVAFPQWSDQQTNAKLVTDVWRTGVKVTPNEQGL  403

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            V S E++RC+E VM    +G+E+RRNA+K+RDLA EA +EGGSSD NL++F   VR
Sbjct  404  VESGEMRRCLELVMGDEKEGDEMRRNAQKFRDLAREAAKEGGSSDKNLRAFVDEVR  459



>gb|KJB28073.1| hypothetical protein B456_005G025400 [Gossypium raimondii]
Length=469

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEVL  531
            K Q EEIA+ L+  +RPFLWV+R++ +  EEE+EE      E  +Q G++VPWCSQ+EVL
Sbjct  289  KQQVEEIARALISSRRPFLWVMRNRKDRGEEEKEEDKLTCREELEQIGMVVPWCSQVEVL  348

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF+THCGWNSTLES+ +G P+VAFP WTDQGT+AKLI+DVW TGVRV+  E+G+
Sbjct  349  SHPSLGCFVTHCGWNSTLESLVAGVPMVAFPQWTDQGTSAKLIEDVWGTGVRVSTNEEGM  408

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +EI RC++ VM   +KG E+++N +KW+ LA EA  EGGS D NLK+F  +V
Sbjct  409  VERDEIVRCLDVVMGDDEKGMEVKKNVEKWKGLAREAAMEGGSMDMNLKAFVDDV  463



>ref|XP_010673328.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 140/183 (77%), Gaps = 10/183 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIR----DKPeneeeeeeeklscmeelEKQGLIVPWCSQ  543
            SK Q EE+AK L++I RPFLWVIR    D+ +  EE  E +LSCMEEL+  GLIVPWCSQ
Sbjct  294  SKAQMEELAKALIQIHRPFLWVIRENEKDEKDLREEHNEGELSCMEELKALGLIVPWCSQ  353

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVR--VT  369
            +EVL HPS+GCF+THCGWNSTLES+  G P+V FP WTDQ TN+KLI+DVWK GVR  V+
Sbjct  354  VEVLSHPSIGCFVTHCGWNSTLESLTCGVPMVGFPQWTDQTTNSKLIEDVWKIGVRVKVS  413

Query  368  QGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN  189
            + E G+V SEEIKRC+E VM+     EE++ NAK W++LA+EA +EGGSSD NLK+F   
Sbjct  414  KEEGGLVKSEEIKRCLEVVME----SEEMKENAKNWKELAVEAAKEGGSSDRNLKAFMEE  469

Query  188  VRN  180
            + N
Sbjct  470  LFN  472



>ref|XP_009787090.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=466

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 128/178 (72%), Gaps = 9/178 (5%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIR-DKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            K   EEIA+GL+  +RPFLWVI  +KP      +EE         KQG IV WCSQ+EVL
Sbjct  296  KQMMEEIAQGLIGSERPFLWVINGEKPMENLSCKEELE-------KQGKIVSWCSQVEVL  348

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSLGCF+THCGWNSTLES+  G PVVA P WTDQG N+ LIQD+WKTGVRV   E+GV
Sbjct  349  QHPSLGCFLTHCGWNSTLESLVFGIPVVACPLWTDQGCNSTLIQDIWKTGVRVNANEEGV  408

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRNH  177
             G+ E KRCIE VM  G +GEELR+ AKKWRDLA +A +E GSS+ NLK++   + NH
Sbjct  409  EGA-EFKRCIEIVMGDGKEGEELRKKAKKWRDLAKDAMKEDGSSNENLKAYVDEILNH  465



>gb|KJB28074.1| hypothetical protein B456_005G025500 [Gossypium raimondii]
Length=469

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEVL  531
            K Q EEIA+ L+  +RPFLWV+R++ +  EEE+EE      E  +Q G++VPWCSQ+EVL
Sbjct  289  KQQVEEIARALISSRRPFLWVVRNRKDRGEEEKEEDKLTCREELEQFGMVVPWCSQVEVL  348

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF+THCGWNSTLES+ +G PVVAFP WTDQGT+AKLI+DVW TGVRV+  E+G+
Sbjct  349  SHPSLGCFVTHCGWNSTLESLVAGVPVVAFPQWTDQGTSAKLIEDVWGTGVRVSGNEEGI  408

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +EI RC++ VM   +KG E+++N +KW+ LA E   EGGS D NLK+F  +V
Sbjct  409  VERDEIVRCLDLVMGDDEKGMEVKKNVEKWKGLAREVAMEGGSMDMNLKAFVDDV  463



>ref|XP_010522273.1| PREDICTED: UDP-glycosyltransferase 75B2-like [Tarenaya hassleriana]
Length=548

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 128/176 (73%), Gaps = 8/176 (5%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ------GLIVPWCS  546
            K Q +E+AK L+E KRPFLWVI DKP     EEEE        + +      G++V WCS
Sbjct  349  KKQMQELAKALIETKRPFLWVITDKPNKRANEEEEGEEIGNIADFRQELEEIGMVVTWCS  408

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q +VLKH S+GCF+THCGWNSTLES+  G PVVAFP WTDQ TNAKL++D WKTGVRV +
Sbjct  409  QTQVLKHKSVGCFLTHCGWNSTLESLVLGVPVVAFPQWTDQPTNAKLLEDWWKTGVRVKE  468

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             E+G+V S EI+RC+E  M+  DK EELRRNA KWRDLA EA  EGGSSDTN+ +F
Sbjct  469  NEEGLVESGEIRRCLEAAME--DKAEELRRNAGKWRDLAAEAGGEGGSSDTNIAAF  522



>ref|XP_002263498.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 1/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA GLL   RPFLWVIR+ P+  E ++EE L C EELE++G+IVPWCSQ+EVL
Sbjct  286  SKPQMEEIACGLLNSDRPFLWVIRE-PDKGEVKDEEMLGCREELEQRGMIVPWCSQLEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF+THCGWNSTLES+  G PVVAFP  TDQ T AKLI D+WKTG+RV   E+G+
Sbjct  345  THPSLGCFVTHCGWNSTLESMVCGVPVVAFPQGTDQATTAKLITDMWKTGIRVWVNEEGM  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +EIK C+E VM  G++ E LRRNA+KW++LA EA + GG SD NLK+F   V
Sbjct  405  VERDEIKMCLEIVMGDGERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  459



>ref|XP_010039945.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45604.1| hypothetical protein EUGRSUZ_L00636 [Eucalyptus grandis]
Length=460

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  QKEE+A+GLL   RPFLWVIR   E E E EE++LSCMEEL+++G+IV WCSQ+EVL
Sbjct  286  SNAQKEEMARGLLGTGRPFLWVIRKDKEEEGEGEEDQLSCMEELKQKGMIVSWCSQVEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+THCGWNST ES+  G P+VAFP WTDQ TNA L+++ WK GVRV   E G+
Sbjct  346  SHASVGCFVTHCGWNSTFESLACGVPMVAFPQWTDQQTNAMLVENEWKVGVRVNTNEGGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  +E KRC+E V+  G++GEE+RRNAKKW+ LA EA +EGGSSD NLK+F
Sbjct  406  VEGDEFKRCLELVVGNGEEGEEIRRNAKKWKGLAREAAKEGGSSDRNLKAF  456



>ref|XP_010103920.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB97437.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 9/180 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIR-----DKPeneeeeeeeklscmeelEKQGLIVPWCS  546
            +K Q EEIAKGLL+  RPFLWVIR     +K E    EEEEK+S  EELEK G IVPWC 
Sbjct  293  TKPQMEEIAKGLLDFGRPFLWVIRENDNKNKDERGGGEEEEKVSFKEELEKVGKIVPWCC  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL + +LGCF+THCGWNSTLES+  G PVVAFP   DQ TNAKLI+D WKTGV+V  
Sbjct  353  QVEVLSNNALGCFVTHCGWNSTLESLVCGVPVVAFPQSVDQLTNAKLIEDFWKTGVKVKA  412

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E+G+V  +EIKRC+E+VM     GEE+RRNA+KWRDLA EA+++GGSSDTNLK+F  +V
Sbjct  413  NEEGIVEGQEIKRCLESVM----GGEEMRRNAQKWRDLAWEASKDGGSSDTNLKAFVSDV  468



>ref|XP_003629628.1| UDP-glucose flavonoid 7-O-glucosyltransferase [Medicago truncatula]
 gb|AET04104.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=465

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 135/177 (76%), Gaps = 5/177 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q+EEIA  LL+   PFLWV+R+K   E E  EE     EELE++G IV WCSQ+E+L
Sbjct  290  SERQREEIAHALLDCGFPFLWVLREK---EGENNEEGFKYREELEEKGKIVKWCSQMEIL  346

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             HPSLGCF+THCGWNSTLES+  G P+VAFP WTDQ TNAKLI+DVWK GVRV +   ED
Sbjct  347  SHPSLGCFLTHCGWNSTLESLVKGVPMVAFPQWTDQMTNAKLIEDVWKIGVRVDEEVNED  406

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            G+V  +EI+RC+E VM  G+KGEELRR+ KKW++LA EA +EGGSS+ NL+SF   V
Sbjct  407  GIVRGDEIRRCLEVVMGSGEKGEELRRSGKKWKELAREAVKEGGSSEKNLRSFLDGV  463



>gb|KJB18350.1| hypothetical protein B456_003G047900 [Gossypium raimondii]
Length=453

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 7/177 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            +K Q E +AKGLLE  RPFLWVIR+     +E+E++ LS + EL+K G+IVPWC Q++VL
Sbjct  283  AKPQMELLAKGLLETGRPFLWVIRES---TDEQEKDPLSRLNELKKLGMIVPWCPQVQVL  339

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+TH GWNST ES+ SG P+V FP W DQGTN+KL+QDVWKTGVR+ + EDG+
Sbjct  340  SHPSIGCFLTHSGWNSTFESLVSGVPMVTFPQWVDQGTNSKLVQDVWKTGVRLRENEDGM  399

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRN  180
            V + EIKRC+E VM     GEE+++NAKKW+DLA EA  EGG+S  N+K+F   + N
Sbjct  400  VEAGEIKRCLEMVMG----GEEIKKNAKKWKDLAKEAVEEGGTSYNNIKAFVEELTN  452



>gb|KJB28075.1| hypothetical protein B456_005G025600 [Gossypium raimondii]
Length=467

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEV  534
            +K Q EEIA+ L+  +RPFLWV+R++ +  EEE+EE      E  +Q G +VPWCSQ+EV
Sbjct  288  TKQQVEEIARALISSRRPFLWVVRNRKDGGEEEKEEDKLTCREELEQYGRVVPWCSQVEV  347

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNSTLES+ +G PVVAFP WTDQGTNAKLI+DVW  GVRV+  E+G
Sbjct  348  LSHPSLGCFVTHCGWNSTLESMVAGVPVVAFPQWTDQGTNAKLIEDVWGNGVRVSANEEG  407

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V  +EI RC++ VM   +KG E+++N +KW+ LA EA+ EGGS D  LK+F  +V
Sbjct  408  MVERDEIVRCLDLVMGDDEKGMEVKKNVEKWKGLAREASMEGGSMDMKLKAFVDDV  463



>ref|XP_010096066.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXC42235.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 138/180 (77%), Gaps = 9/180 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIR-----DKPeneeeeeeeklscmeelEKQGLIVPWCS  546
            +K Q EEIAKGLL+  RPFLWVIR     +K E    EEEEK+S  EELEK G IVPWC 
Sbjct  293  TKPQMEEIAKGLLDFGRPFLWVIRENDNKNKDERGGGEEEEKVSFKEELEKVGKIVPWCC  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL + +LGCF+THCGWNSTLES+  G PVVAFP   DQ TNAKLI+D WKTGV+V  
Sbjct  353  QVEVLSNNALGCFVTHCGWNSTLESLVCGVPVVAFPQSVDQLTNAKLIEDFWKTGVKVKA  412

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E+G+V  +EIKRC+E+VM     GEE+RRNA+KWRDLA EA+++GGSSDTNLK+F  +V
Sbjct  413  NEEGIVEGQEIKRCLESVM----GGEEMRRNAQKWRDLAWEASKDGGSSDTNLKAFVSDV  468



>ref|XP_007034187.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034188.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034189.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05113.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05114.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05115.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
Length=463

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 135/174 (78%), Gaps = 6/174 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            +K Q EEIA GLL    PFLWVIR+       E+EEKLS +EEL+KQG+IVPWCSQ+EVL
Sbjct  287  TKQQMEEIANGLLGTGYPFLWVIRE----GAGEKEEKLSRIEELKKQGMIVPWCSQVEVL  342

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG--ED  357
             HPS+GCF+THCGWNS LES+ SG P+V FP  TDQGTNAKL++D+WKTGVRVT+   E 
Sbjct  343  SHPSVGCFLTHCGWNSALESLVSGVPMVTFPQLTDQGTNAKLVEDLWKTGVRVTRNPEER  402

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             VV   EIKRC+E +M+GG+KGEELR+N KKW+ LA EA +E GSS  NL++F 
Sbjct  403  IVVEGHEIKRCLELIMEGGEKGEELRKNGKKWKYLAREAVKEDGSSLKNLEAFV  456



>gb|KDP32582.1| hypothetical protein JCGZ_13132 [Jatropha curcas]
Length=463

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+GLL+  RPFLWVIR+ P  ++EEE+  +SC +ELE++G+IVPWC Q+EVL
Sbjct  287  SKKQTEEIARGLLKSNRPFLWVIREDPNKKQEEEDGDISCRKELEEKGMIVPWCDQVEVL  346

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             + SLGCFI+HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+D W+ GVRV   E+G+
Sbjct  347  SNQSLGCFISHCGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDDWEIGVRVVPNEEGI  406

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  EEI RC++ VM  G+KG+++R+NAKKW+DLA EA +E GSSD NLK+F   V
Sbjct  407  VEGEEITRCLDLVMGDGEKGKDVRKNAKKWKDLAREAVKESGSSDKNLKAFVDEV  461



>ref|XP_004297003.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 137/175 (78%), Gaps = 4/175 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIAKGLL   RPFLWVIR+  +N E +EE+K+SC EELE+ G+IVPWCSQ+EVL
Sbjct  339  SKIQMEEIAKGLLLSGRPFLWVIRENQKNGEGKEEDKVSCREELEELGMIVPWCSQVEVL  398

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +PSLGCF+THCGWNST+ES+ SG PVVAFP WTDQGTNAKLI+D WKTGVRV   E+G 
Sbjct  399  SNPSLGCFVTHCGWNSTMESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVEPNEEGG  458

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  EEIKRC++ VM+     +++R NAKKW+ LA EA  EGGSSD N+K F   +
Sbjct  459  VVGEEIKRCLDLVME----SDKMRMNAKKWKGLAREAVGEGGSSDKNMKVFLDQI  509



>ref|XP_010023605.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59916.1| hypothetical protein EUGRSUZ_H02640 [Eucalyptus grandis]
Length=463

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ L+E  RPFLWVIR     +EE +E++LSC EEL+  G+IVPWCSQ+EVL
Sbjct  286  SKPQKEEMARALVEAGRPFLWVIRTS--GKEERDEDRLSCEEELKNLGMIVPWCSQVEVL  343

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+THCGWNST ES+  G PVVAFP W DQ TNAKL+ DVW+TGV+VT  E G+
Sbjct  344  SHHSVGCFVTHCGWNSTSESLVCGVPVVAFPQWGDQQTNAKLVTDVWRTGVKVTPNEQGL  403

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            V S+E++ C+E VM    +G+E+RRNA+K+RDLA EA +EGGSSD NL++F   VR
Sbjct  404  VESDEMRSCLELVMGDEKEGDEMRRNAQKFRDLAREAAKEGGSSDKNLRAFVDEVR  459



>sp|Q9ZR25.1|5GT_VERHY RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
HGT8; Flags: Precursor [Glandularia x hybrida]
 dbj|BAA36423.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase [Glandularia 
x hybrida]
Length=461

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 6/179 (3%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            +N +K+Q EEIA+GLL+  RPFLWV+R       E EE  +SCMEEL++ G IV WCSQ+
Sbjct  285  VNTTKSQMEEIARGLLDCGRPFLWVVR-----VNEGEEVLISCMEELKRVGKIVSWCSQL  339

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF+THCGWNSTLESI  G P+VAFP W DQGTNAKL++DVW+TGVRV   E
Sbjct  340  EVLTHPSLGCFVTHCGWNSTLESISFGVPMVAFPQWFDQGTNAKLMEDVWRTGVRVRANE  399

Query  359  DG-VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +G VV  +EI+RCIE VMDGG+K  +LR +A KW+DLA +A  E GSS  NLK F   V
Sbjct  400  EGSVVDGDEIRRCIEEVMDGGEKSRKLRESAGKWKDLARKAMEEDGSSVNNLKVFLDEV  458



>dbj|BAD90935.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 135/171 (79%), Gaps = 0/171 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+GLL   RPFLWVIR     E E E+++LSC+EELE++G+IVPWCSQ+EVL
Sbjct  286  SKEQKEEMARGLLGTGRPFLWVIRKDKREEGEGEDDQLSCVEELEQKGMIVPWCSQVEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+TH GWNST ES+  G P+VAFP WTDQ TNA L+++ WK GVRV+  E G+
Sbjct  346  SHASVGCFVTHSGWNSTFESLACGVPMVAFPQWTDQQTNAMLVENEWKVGVRVSTNERGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  +E+KRC+E V+  G++GEE+RRNA+KW+ LA EA +EGGSSD NLK F
Sbjct  406  VEGDELKRCLELVVGDGEEGEEIRRNAEKWKGLAREAAKEGGSSDRNLKEF  456



>gb|KJB28076.1| hypothetical protein B456_005G025700 [Gossypium raimondii]
Length=469

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEV  534
            +K Q EEIA+ L+  +RPFLWV+R++ +  EEE+EE      E  +Q G +VPWCSQ+EV
Sbjct  288  TKQQVEEIARALISSRRPFLWVVRNRKDGGEEEKEEDKLTCREELEQFGRVVPWCSQVEV  347

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNSTLES+ +G PVVAFP W+DQGT AKLI+DVW  GVRV+  E+G
Sbjct  348  LSHPSLGCFVTHCGWNSTLESMVAGVPVVAFPQWSDQGTTAKLIEDVWGNGVRVSANEEG  407

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V  +EI RC++ VM   +KG E+++N +KW+ LA EA+ EGGS D NLK+F  +V
Sbjct  408  MVERDEIVRCLDLVMGDDEKGMEVKKNVEKWKGLAREASMEGGSMDMNLKAFVDDV  463



>ref|XP_002308970.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92493.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=472

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 144/176 (82%), Gaps = 3/176 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ LLE  RPFLWVIR      EE+EE+KLSC EELEKQG IVPWCSQ+EVL
Sbjct  290  SKPQKEEMARALLETGRPFLWVIRAD--RGEEKEEDKLSCKEELEKQGKIVPWCSQVEVL  347

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG-EDG  354
             HPS+GCF+THCGWNST ES+ SG P+VAFP WTDQ TNAK+++DVWKTGVRVT   ++G
Sbjct  348  SHPSIGCFVTHCGWNSTFESLASGVPMVAFPQWTDQLTNAKMVEDVWKTGVRVTSSNKEG  407

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            VV  EEI+RC+E VM GG++G E+R+NAKKW++LA ++++EGGSS  NLK+F   +
Sbjct  408  VVEGEEIERCLEVVMGGGERGNEMRKNAKKWKELARQSSKEGGSSYNNLKAFVDEI  463



>ref|XP_009612652.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 134/175 (77%), Gaps = 3/175 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S    EEIA+GL++  RPFLWVIR+    E E    KLSC EELEK+G IV WCSQ+EVL
Sbjct  305  SSQLMEEIAQGLVKCGRPFLWVIRE--GKEGENLGGKLSCKEELEKKGKIVSWCSQVEVL  362

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSLGCF+THCGWNSTLES+ SG PVVA P WTDQG NAKLIQDVWKTGVRV   E+G+
Sbjct  363  QHPSLGCFLTHCGWNSTLESLSSGIPVVACPLWTDQGCNAKLIQDVWKTGVRVNANEEGL  422

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +E KRCIE VM+ G+K EELR NAKKW+DLA EA  E GSS+ NLK++   +
Sbjct  423  VERDEFKRCIEIVME-GEKREELRGNAKKWKDLAKEAMNENGSSNVNLKAYVNEI  476



>dbj|BAD90934.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 0/171 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+GLL    PFLWVIR   + E E E++ LSCMEELE++G+IVPWCSQ+EVL
Sbjct  286  SKAQKEEMARGLLGTGHPFLWVIRKDKDEEGEGEQDHLSCMEELEQKGMIVPWCSQVEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+TH GWNST ES+  G P+VAFP W DQ TNA L+++ WK GVRV   E GV
Sbjct  346  SHASVGCFVTHSGWNSTFESLACGVPMVAFPQWNDQLTNAMLVENEWKVGVRVNVNEGGV  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  +EIKRC+E V+  G++GEE+RRNAKKW+ LA EA +EGGSSD NLK+F
Sbjct  406  VEGDEIKRCLELVVGDGEQGEEIRRNAKKWKHLAREAAKEGGSSDRNLKAF  456



>ref|XP_010068983.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW57189.1| hypothetical protein EUGRSUZ_H00004 [Eucalyptus grandis]
Length=465

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 136/174 (78%), Gaps = 7/174 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QK EIA GLLE  RPFLWV+R     +   ++++L   EEL+K+G+I+PWCSQ+EVL
Sbjct  290  SKAQKLEIAHGLLETGRPFLWVVR-----KTVGDDDELIYKEELDKRGMIIPWCSQMEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ-GEDG  354
             H S+GCF THCGWNSTLES+  G P+VAFP +TDQ TN+KL++DVWK GVRV++  EDG
Sbjct  345  SHRSIGCFFTHCGWNSTLESLACGIPMVAFPQFTDQMTNSKLVEDVWKVGVRVSEINEDG  404

Query  353  -VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             +V   EIK+C+E VM  G+ G+ +RRNA+KW++LAMEA++EGGSSD NL++F 
Sbjct  405  IIVKGGEIKKCLELVMGSGETGDGIRRNARKWKNLAMEASKEGGSSDKNLRAFV  458



>ref|XP_010246964.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=476

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 142/191 (74%), Gaps = 8/191 (4%)
 Frame = -2

Query  716  NPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeee---eeeklscmeelEKQGLIVPWCS  546
            N  + Q +EIA+GLL+ +RPFLWVIR    + E +    E  +  +EEL+++G+IV WCS
Sbjct  286  NLQQQQMKEIARGLLDSRRPFLWVIRTPLMSSEAKEIGTEAIMDNIEELKREGMIVSWCS  345

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL HPS+GCF+THCGWNSTLE I +G P+V FP W+DQGTNAKLI+DVWKTGVR+  
Sbjct  346  QVEVLCHPSVGCFLTHCGWNSTLEGIVAGVPMVGFPQWSDQGTNAKLIEDVWKTGVRLRV  405

Query  365  GEDG----VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             E G    +V +EEIKRC+  VM+ G+ G+E+R+NAK WRDL++EA +EGGS+D NL++F
Sbjct  406  KEGGEGGDLVDAEEIKRCLCMVME-GETGKEMRKNAKNWRDLSLEAVKEGGSTDKNLRAF  464

Query  197  AGNVRNH*YYV  165
               +R   Y V
Sbjct  465  LEEIRGGDYSV  475



>ref|XP_011020320.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=472

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 143/176 (81%), Gaps = 3/176 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ LLE  RPFLWVIR      EE+EE KLSC EELEKQG IVPWCSQ+EVL
Sbjct  290  SKPQKEEMARALLETGRPFLWVIRAD--RGEEKEEGKLSCNEELEKQGKIVPWCSQVEVL  347

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG-EDG  354
             HPS+GCF+THCGWNST ES+ SG P+VAFP WTDQ TNAK+++DVWKTGVRVT   ++G
Sbjct  348  SHPSIGCFVTHCGWNSTFESLSSGVPMVAFPQWTDQLTNAKMVEDVWKTGVRVTSSNKEG  407

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            VV  EEI+RC+E VM GG++G E+R+NAKKW++LA ++++EGGSS  NLK+F   +
Sbjct  408  VVEGEEIERCLELVMGGGERGSEIRKNAKKWKELARQSSKEGGSSYNNLKAFVDEI  463



>emb|CBI39387.3| unnamed protein product [Vitis vinifera]
Length=131

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  566  LIVPWCSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWK  387
            +IVPWCSQ+EVL +PSLGCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL +DVWK
Sbjct  1    MIVPWCSQVEVLSNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWK  60

Query  386  TGVRVTQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNL  207
            TGVRVT  ++G+V S+EIKRC+E VM  G++ +E+RRNAKKW+ LA EA  EGGSSD NL
Sbjct  61   TGVRVTVNQEGIVESDEIKRCLELVMGDGEEAKEMRRNAKKWKGLAREAVMEGGSSDKNL  120

Query  206  KSFAGNV  186
            K+F   V
Sbjct  121  KNFMDEV  127



>ref|XP_004247895.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=468

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 2/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S    EEI +GL++  RPFLWVIR++   E    EEKL+C EELEKQG IV WCSQ+EVL
Sbjct  290  SSQLMEEIGQGLVKCGRPFLWVIREE--KEGGHPEEKLTCKEELEKQGKIVRWCSQVEVL  347

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSLGCF+THCGWNSTLES+ SG P+VA P WTDQG NAKL+QDVWK GVRV   ++GV
Sbjct  348  QHPSLGCFLTHCGWNSTLESLSSGMPIVACPLWTDQGCNAKLVQDVWKIGVRVNASKEGV  407

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +E KRCIE VM  G+K  EL++NAKKW+DLA EA +E GSS+ NLK++   +
Sbjct  408  VERDEFKRCIEIVMKDGEKRVELKKNAKKWKDLAKEATKENGSSNVNLKAYVNEI  462



>ref|XP_008458144.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Cucumis melo]
Length=468

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 127/175 (73%), Gaps = 5/175 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  QKEE+A+GLL  KRPFLWVIRD      E EE+ LS  E+LE QG IVPWCSQ+EVL
Sbjct  297  SNQQKEEMARGLLSTKRPFLWVIRD-----TEAEEDSLSFKEKLETQGKIVPWCSQLEVL  351

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
              P+ GCF+THCGWNS LES+  G P VAFP W+DQ TN+K+IQD+ +TGVR+  GEDGV
Sbjct  352  SSPATGCFLTHCGWNSCLESLACGVPTVAFPQWSDQATNSKIIQDLSETGVRLEAGEDGV  411

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  EEI+RC+  VM    KGE++RRNA KW+ LA EA  EGGSS  N K+F   V
Sbjct  412  VKGEEIERCLTLVMGDSKKGEDIRRNALKWKKLAKEAASEGGSSFANFKAFVDQV  466



>emb|CAN62622.1| hypothetical protein VITISV_001655 [Vitis vinifera]
Length=463

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA GLL   RPFLWVIR+ P+  E ++EE L C EELE++G+IVPWCSQ+EVL
Sbjct  286  SKPQMEEIACGLLNSDRPFLWVIRE-PDKGEVKDEEMLGCREELEQRGMIVPWCSQLEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPSLGCF+THCGWNSTLES+  G  VVAFP  TDQ T AKLI D+WKTG+RV   E+G+
Sbjct  345  THPSLGCFVTHCGWNSTLESMVCGVLVVAFPQGTDQATTAKLITDMWKTGIRVWVNEEGM  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  +EIK C+E VM  G++ E LRRNA+KW++LA EA + GG SD NLK+F   V
Sbjct  405  VERDEIKMCLEIVMGDGERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  459



>dbj|BAF75879.1| glucosyltransferase [Dianthus caryophyllus]
Length=475

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 136/185 (74%), Gaps = 11/185 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIR------DKPeneeeeeeeklscmeelEKQGLIVPWC  549
            S+ Q+EE+A+ L++  RPFLWVIR      DK   E   +E +LSCMEEL + G IVPWC
Sbjct  295  SRAQQEELARALIQTHRPFLWVIRENNDKKDKEVEEGNTDEGELSCMEELRRVGKIVPWC  354

Query  548  SQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVT  369
            SQ+EVL HPS+GCF+THCGWNSTLESI  G P+V FP WTDQ TNAKL++DVWK GVRV 
Sbjct  355  SQLEVLSHPSVGCFVTHCGWNSTLESITCGVPMVGFPQWTDQTTNAKLVEDVWKIGVRVN  414

Query  368  QG-EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
               EDG+V  EEI RC+E VM+     EE+R NAKK+++LA++A +EGG SD NLKSF  
Sbjct  415  SNEEDGLVKDEEIMRCLERVME----SEEIRNNAKKFKELAVQAAKEGGGSDNNLKSFIE  470

Query  191  NVRNH  177
             V +H
Sbjct  471  EVTSH  475



>ref|XP_006418014.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
 dbj|BAJ33712.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36367.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
Length=456

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 135/182 (74%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEK-------QGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DK   E + E E  + +E++ +        G+IV W
Sbjct  271  SKKQIEELARALIEWKRPFLWVITDKSNREAKTEGEDETEIEKIAEFRHELEDVGMIVSW  330

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL++D WKTGVRV
Sbjct  331  CSQVEVLRHRAVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEDSWKTGVRV  390

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + E+G+V   EI+RC+E VM  G+K EELR NA+KW+ LA+EA REGGSSD N+++F  
Sbjct  391  RENEEGLVERGEIRRCLEAVM--GEKAEELRENAEKWKRLAVEAGREGGSSDKNMEAFVD  448

Query  191  NV  186
             +
Sbjct  449  EI  450



>gb|AFI71902.1| flavonol 5-O-glucosyltransferase [Paeonia lactiflora]
Length=465

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EE+ +GL++   PFLWV+R + EN + ++EE+    E+LEKQG++VPWC+Q+EVL 
Sbjct  287  KRQMEEMVRGLVDTALPFLWVVRVE-ENRDGDKEEEYKLSEDLEKQGMVVPWCNQLEVLS  345

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
              S+GCF+THCGWNS+LES+  G PVVAFP W DQ TNAK I+DVWKTGVR+   EDGVV
Sbjct  346  RKSVGCFLTHCGWNSSLESLVCGAPVVAFPQWADQATNAKPIEDVWKTGVRMVVNEDGVV  405

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
               EIKRC+E VM GG++GEE+RRN +KW++LA EA ++G SSD NLK+F   V
Sbjct  406  EGCEIKRCLEMVMGGGERGEEMRRNVEKWKELAREAVKDGESSDKNLKAFVNEV  459



>ref|XP_010039944.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45603.1| hypothetical protein EUGRSUZ_L00635 [Eucalyptus grandis]
Length=467

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  QKEE+A+GLL    PFLWVIR   E E   +E++LSCMEELE++G+IVPWCSQ+EVL
Sbjct  286  SNAQKEEMARGLLSTSHPFLWVIRKDKEEEVGGQEDQLSCMEELEQKGMIVPWCSQVEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+TH GWNST ES+  G P+VAFP W DQ TNA L+++ WK GVRV   E G+
Sbjct  346  SHASVGCFVTHSGWNSTFESLTCGVPMVAFPQWGDQQTNAMLVENEWKVGVRVNTNERGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            V  +EIKRC+E V+  G++GEE+RRNAKKW+ LA EA +EGGSSD NL +F   ++
Sbjct  406  VEGDEIKRCLELVVGDGEEGEEIRRNAKKWKGLAREAAKEGGSSDRNLNAFLEEIQ  461



>gb|KJB28077.1| hypothetical protein B456_005G025900 [Gossypium raimondii]
Length=469

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEV  534
            +K Q EEIA+ L+  +RPFLWV+R++    EEE+EE      E  +Q G++VPWCSQ+EV
Sbjct  288  TKRQVEEIARALISSRRPFLWVVRNRTNGGEEEKEEDKLTCREELEQFGMVVPWCSQVEV  347

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNSTLES+ +G PVVAFP WTDQ TNAKLI+DVW  GVRV+  E+G
Sbjct  348  LFHPSLGCFVTHCGWNSTLESMAAGVPVVAFPQWTDQRTNAKLIEDVWGNGVRVSANEEG  407

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V  +EI RC++ VM    KG E+++N +KW+ LA EA  EGGS D  LK+F  ++
Sbjct  408  MVERDEIVRCLDLVMGDDKKGMEVKKNVEKWKGLASEAAMEGGSLDMKLKAFVDDI  463



>ref|XP_010039943.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45602.1| hypothetical protein EUGRSUZ_L00634 [Eucalyptus grandis]
Length=467

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  QKEE+A+GLL   RPFLWVIR   E E EE+E++LSC+EELE++G+IVPWCSQ+EVL
Sbjct  286  SNAQKEEMARGLLGTDRPFLWVIRKDKEEEVEEDEDQLSCLEELEQKGMIVPWCSQVEVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+TH GWNST ES+  G P+VAFP W DQ TNA L+++ WK GVRV   E G+
Sbjct  346  SHASVGCFVTHSGWNSTFESLTCGVPMVAFPQWGDQQTNAMLVENEWKVGVRVNTNERGI  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  +EIKRC+E V+  G++GEE+RRNAKKW+ LA EA ++GGSSD NL +F
Sbjct  406  VEGDEIKRCLELVVGDGEEGEEIRRNAKKWKGLAREAAKKGGSSDRNLNAF  456



>dbj|BAF49301.1| putative glycosyltransferase [Clitoria ternatea]
Length=469

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 137/179 (77%), Gaps = 4/179 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPenee--eeeeeklscmeelEKQGLIVPWCSQIE  537
            SK Q EEIA+ LL+    FLWVIR+K +++    + EE++S  EEL K+G +V WCSQ+E
Sbjct  289  SKRQTEEIARALLDCGCQFLWVIREKKDSQVDGTKSEEEMSFREELGKKGKMVTWCSQME  348

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--G  363
            VL HPSLGCF++H GWNST+ES+ SG P+VAFP WTDQ TNAKLI+DVWK GVRV     
Sbjct  349  VLSHPSLGCFLSHSGWNSTMESLVSGVPIVAFPQWTDQKTNAKLIEDVWKIGVRVDDHVN  408

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            EDGVV +E+IKRC+E VM  G KGEELR+NAKKW+ LA +A+++GGSS+ NL+ F   V
Sbjct  409  EDGVVEAEKIKRCLEVVMGCGKKGEELRKNAKKWKALARDASKKGGSSEKNLRVFLDAV  467



>ref|XP_011033298.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEEIA+ LL+  RPFLWVIR      EE+EE+KLSC EELEKQG IVPWCSQ+ VL
Sbjct  287  SKPQKEEIARALLDTGRPFLWVIRTD--GGEEKEEDKLSCTEELEKQGKIVPWCSQVVVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+THCGWNST ES+ SG PVVAFP WTDQ TNAK+++ VW+TGVRV+  ++G+
Sbjct  345  SHPSIGCFVTHCGWNSTFESLASGVPVVAFPQWTDQLTNAKMVEAVWETGVRVSANKEGI  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +  EEI++C+E VM GG++G+E+R+NAKKW+DLA E++REGG+S  NL+ F   +
Sbjct  405  IEGEEIEKCLELVMGGGERGKEMRKNAKKWKDLARESSREGGTSYQNLQDFFNEI  459



>gb|KDP32590.1| hypothetical protein JCGZ_13140 [Jatropha curcas]
Length=455

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 124/172 (72%), Gaps = 11/172 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q EE+A  L +I  PFLWVIR+                E+L K GL VPWC+Q+EVL
Sbjct  282  SEQQIEEMAIALEKIGSPFLWVIREN-----------AIVKEKLNKGGLTVPWCNQVEVL  330

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +P++GCFITHCGWNST ES+  G P+V FP WTDQ TNAKL+QD+WK GVRV   E+G+
Sbjct  331  SNPAIGCFITHCGWNSTFESLTCGVPMVGFPQWTDQMTNAKLVQDLWKVGVRVVVNEEGI  390

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
            V ++EI+RC+E VM  GD G+E+R++AKKW+DLA EA  EGGS+D N+K+F 
Sbjct  391  VEAKEIRRCLELVMGDGDGGKEMRKSAKKWKDLAREAINEGGSTDKNVKAFV  442



>ref|XP_003601706.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES71957.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 130/180 (72%), Gaps = 5/180 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEK-----QGLIVPWCS  546
            S  Q EEI + LL+    FLWVIRD+   +++EEE     +   E+      G IV WCS
Sbjct  293  SNRQMEEIGRALLDSGFYFLWVIRDEKVMQQKEEEGDSDELSCREELERNVNGKIVKWCS  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL H SLGCF+THCGWNSTLES+ SG P+VAFP WTDQ TNAKLI+DVWKTGVR+  
Sbjct  353  QVEVLSHRSLGCFMTHCGWNSTLESLGSGVPMVAFPQWTDQTTNAKLIEDVWKTGVRMEC  412

Query  365  GEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E+G+V +EEI++C E VM  G+KGEELRRNA KW+DLA  A +EGGSS+ NL +F  ++
Sbjct  413  DEEGMVKAEEIRKCFEVVMGKGEKGEELRRNAMKWKDLARAAVKEGGSSNKNLSNFLDDI  472



>ref|XP_010040348.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45291.1| hypothetical protein EUGRSUZ_L01047 [Eucalyptus grandis]
Length=468

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 133/178 (75%), Gaps = 7/178 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPen-------eeeeeeeklscmeelEKQGLIVPW  552
            SK QKEE+A+GLL   RPFLWVI+            ++EE E++LSCMEEL+KQG+IVPW
Sbjct  284  SKPQKEEMARGLLSTGRPFLWVIKKALIMDGGDGDGKQEESEDQLSCMEELQKQGMIVPW  343

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL HPS+GCF+THCGWNSTLES+  G P+VAFP W DQ  NA LIQDVWK GVRV
Sbjct  344  CSQVEVLSHPSVGCFVTHCGWNSTLESVVCGVPMVAFPLWADQLANAMLIQDVWKVGVRV  403

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +  E GVV  EE+ RC+E V+ GG++ E +R NAK+ +D A EA +EGG +D NLK+ 
Sbjct  404  SGNERGVVEGEELTRCLEMVLGGGERSEGMRGNAKRLKDAAREAGKEGGCADKNLKAL  461



>ref|XP_003532736.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=512

 Score =   200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 136/179 (76%), Gaps = 3/179 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPen-eeeeeeeklscmeelEKQGLIVPWCSQIEV  534
            SK Q EEIA+GLL+  RPFLWV+R+K  N ++EEEEE     EELEK G IV WCSQ+EV
Sbjct  323  SKRQMEEIARGLLDCGRPFLWVVREKVINGKKEEEEELCCFREELEKWGKIVTWCSQVEV  382

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GE  360
            L H S+GCF+THCGWNST+ES+ SG P+VAFP WTDQ TNAKLI+DVWK GVRV      
Sbjct  383  LSHSSVGCFLTHCGWNSTMESLVSGVPMVAFPQWTDQMTNAKLIEDVWKIGVRVDHHVNA  442

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            +G+V  +EI+ C++ VM  GD+  E R+NAKKW+ LA +A +EGGSS+ NL++F  +VR
Sbjct  443  NGIVEGKEIEACLDVVMGSGDRASEFRKNAKKWKVLARDAAKEGGSSEKNLRAFVDDVR  501



>ref|XP_003629627.1| Indole-3-acetate beta-glucosyltransferase [Medicago truncatula]
 gb|AET04103.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 129/177 (73%), Gaps = 10/177 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q EEIA  LL     FLWV+R+K        EE+L   +ELEK+G IV WCSQ+EVL
Sbjct  293  SERQTEEIASALLNCGFSFLWVMREK--------EEELKFKDELEKKGKIVKWCSQVEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             H SLGCF+THCGWNSTLES+ SG P+VAFP WTDQ TNAKLI+DVWK GVRV     ED
Sbjct  345  SHSSLGCFLTHCGWNSTLESLVSGVPLVAFPQWTDQKTNAKLIEDVWKIGVRVDDKVDED  404

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            G+VG  EIK+C+E VM  G+KGEELR+NA KW+ LA EA +EGG ++ NL+ F  ++
Sbjct  405  GIVGGNEIKKCLEEVMGRGEKGEELRKNAMKWKGLAREAGKEGGPAEKNLRKFLDDI  461



>ref|XP_004502258.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14117.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEK-QGLIVPWCSQIEVL  531
            K Q EE A+ LL+    FLWVIR+K  +E++E++E     E  +   G IV WCSQ+EVL
Sbjct  292  KKQMEEFARALLDSGLNFLWVIREKKVDEKKEDDELSCKEELEKNVNGKIVKWCSQVEVL  351

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV--TQGED  357
             H S+GCF+THCGWNST ES+ SG P+VAFP WTDQ TNAKLI+DVWK GVR+   + E+
Sbjct  352  SHSSVGCFVTHCGWNSTTESLVSGVPMVAFPQWTDQSTNAKLIEDVWKCGVRMDNNRDEE  411

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            G+V ++EI+RC+E V+ GG+KGEEL+RNA+KW+ L  EA +EGGSSD NLKSF  ++
Sbjct  412  GIVKADEIRRCLELVIGGGEKGEELKRNAEKWKSLGREAVKEGGSSDKNLKSFLHHI  468



>ref|XP_002322699.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
 gb|EEF04460.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
Length=471

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEE+A+ LL+  RPFLWVIR      EE+EE+KLSC EELEKQG IVPWCSQ+ VL
Sbjct  290  SKPQKEEMARALLDTGRPFLWVIRTD--GGEEKEEDKLSCTEELEKQGKIVPWCSQVVVL  347

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+THCGWNST ES+ SG PVVAFP WTDQ TNAK+++ VW+TGVRV+  ++G+
Sbjct  348  SHPSIGCFVTHCGWNSTFESLASGVPVVAFPQWTDQLTNAKMVEAVWETGVRVSANKEGI  407

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  EEI++C+E VM GG++G+E+R+NAKKW+DLA E+++EGGSS  NL+ F   +
Sbjct  408  VEGEEIEKCLELVMGGGERGKEMRKNAKKWKDLARESSKEGGSSYQNLQDFFNEI  462



>ref|XP_009778639.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=465

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 127/171 (74%), Gaps = 2/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRD-KPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            K QKEEI  GLLE +RPFLWV+R  K E EE    +       L K+G+I+PWC+Q+EVL
Sbjct  292  KEQKEEILHGLLESERPFLWVMRKGKEEVEEGNNYKNEFDDILLNKKGIIIPWCAQMEVL  351

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+THCGWNSTLES+ +G P+V  P ++DQ TNAK++++VW TGVR    E GV
Sbjct  352  FHKSVGCFVTHCGWNSTLESMVAGVPIVGCPQFSDQTTNAKMVEEVWGTGVRANAVE-GV  410

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            VG EE+KRC+E +M  G+KGEE++RN KKWRDLA+EA + GGSS  NLK F
Sbjct  411  VGREELKRCLEILMGNGEKGEEIKRNVKKWRDLAVEAVKVGGSSYDNLKKF  461



>ref|NP_563742.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 sp|Q9LR44.1|U75B1_ARATH RecName: Full=UDP-glycosyltransferase 75B1; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 1; AltName: Full=IAA-Glu synthase 1; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAF79730.1|AC005106_11 T25N20.21 [Arabidopsis thaliana]
 gb|AAK32944.1|AF367358_1 At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AAK37839.1|AF196777_1 UDP-glucosyltransferase [Arabidopsis thaliana]
 gb|AAL77752.1| At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AEE27854.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 gb|AHL38968.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=469

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 135/182 (74%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DK   E + E E+ + +E++        + G+IV W
Sbjct  272  SKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMIVSW  331

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL H ++GCF+THCGW+STLES+  G PVVAFP W+DQ TNAKL+++ WKTGVRV
Sbjct  332  CSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRV  391

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + +DG+V   EI+RC+E VM+  +K  ELR NAKKW+ LAMEA REGGSSD N+++F  
Sbjct  392  RENKDGLVERGEIRRCLEAVME--EKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVE  449

Query  191  NV  186
            ++
Sbjct  450  DI  451



>ref|XP_007163802.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
 gb|ESW35796.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
Length=531

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q EEIA+ LL+   PFLWVIR+   N +E   ++LSC +ELE++G IV WC+Q+EVL
Sbjct  348  SQRQMEEIARALLDSGYPFLWVIRES--NGKEGTLQELSCRKELEQRGKIVKWCTQVEVL  405

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             H S+GCF+THCGWNST+ES+ SG P+V FP WTDQGTNAKL++DVWKTGVRV     E+
Sbjct  406  SHGSVGCFVTHCGWNSTMESLSSGVPMVGFPQWTDQGTNAKLVEDVWKTGVRVDDKVNEE  465

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            G+V + EI++C+E VM  G K EELRRNA+KW+ LA EA +EGGSSD N+ +F   V
Sbjct  466  GIVEAMEIRKCLEVVMGNGGKAEELRRNAQKWKCLAREAVKEGGSSDRNMNTFLDYV  522



>dbj|BAG80537.1| putative glycosyltransferase [Lycium barbarum]
Length=471

 Score =   196 bits (499),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI +GLL+  RPFLWVIR+ P  E+ EE+       E  K+G IV WCSQ+EVLKHPS+
Sbjct  298  EEIGQGLLKCGRPFLWVIREGPNGEKPEEKLSCKDALE--KKGEIVRWCSQVEVLKHPSI  355

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLESI SG PVVA P W DQ  NAKL+QDVWK GVRV  GE  +    E
Sbjct  356  GCFLTHCGWNSTLESIASGVPVVACPIWNDQVCNAKLVQDVWKNGVRVNVGEGSITQRIE  415

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +RCIE  M G  +GEELR+NAKKWRDLA  A +E  SS+ NLK++  
Sbjct  416  FERCIEIAMGGSKEGEELRKNAKKWRDLAKAAMKENDSSNVNLKAYVN  463



>ref|XP_003552552.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=465

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 10/175 (6%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            Q +E+A+ LL+    FLWVIRD        +  + +C EELE++G IV WCSQ+EVL H 
Sbjct  289  QMKELARALLDSGYLFLWVIRD-------MQGIEDNCREELEQRGKIVKWCSQVEVLSHG  341

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV---TQGEDGV  351
            SLGCF+THCGWNST+ES+ SG P+VAFP WTDQGTNAK++QDVWKTGVRV      E+G+
Sbjct  342  SLGCFVTHCGWNSTMESLGSGVPMVAFPQWTDQGTNAKMVQDVWKTGVRVDDKVNVEEGI  401

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V +EEI++C++ VM  G KG+E RRNA KW+ LA EA  EGGSSD+N+++F  +V
Sbjct  402  VEAEEIRKCLDVVMGSGGKGQEFRRNADKWKCLAREAVTEGGSSDSNMRTFLHDV  456



>ref|XP_004229323.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=467

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI  GLL+  RPFLWVIR++   + ++ E+KLSC +ELEKQG IV WCSQ+EVLKHPS+
Sbjct  293  EEIGHGLLKCGRPFLWVIREE--QDGDKMEDKLSCKDELEKQGKIVSWCSQVEVLKHPSV  350

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNS LESI S  P+VA P W DQ  NAKLIQD+WK GVRV   E GVV  +E
Sbjct  351  GCFLTHCGWNSILESIASKVPIVACPLWNDQVCNAKLIQDIWKNGVRVNVSEGGVVKRDE  410

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
              RCI  VM  G +G+ELRRN KKW DLA EA +E G+S  NLK+FA  +
Sbjct  411  FYRCITIVMGDGAEGKELRRNVKKWSDLAKEAMKENGTSSVNLKAFANEI  460



>ref|XP_003601707.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES71958.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=479

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEK-----QGLIVPWCS  546
            SK Q EEI + LL+    FLWVIRD+   +++EEE     +   E+      G IV WCS
Sbjct  293  SKRQMEEIGRALLDSGFYFLWVIRDEKVMQQKEEEGDSDELSCREELERNVNGKIVKWCS  352

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q+EVL H SLGCF+THCGWNSTLES+ SG P+VAFP WTDQ TNAKLI+D+WKTG+RV +
Sbjct  353  QVEVLSHRSLGCFMTHCGWNSTLESLGSGVPMVAFPQWTDQTTNAKLIEDLWKTGLRVER  412

Query  365  GED-GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN  189
             E+ G+V + EI +C+E VM  G+KGEELRRNAKKW+ LA EA +EGGSS+ NL  F  +
Sbjct  413  DEEAGIVKAGEIMKCLEVVMGKGEKGEELRRNAKKWKSLASEAMKEGGSSNKNLSKFLDD  472

Query  188  V  186
            +
Sbjct  473  I  473



>ref|XP_006307449.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
 gb|EOA40347.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
Length=462

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 134/182 (74%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI +KP  + + E E  + +E++        K G+IV W
Sbjct  274  SKKQIEELARALIEGKRPFLWVITEKPNRQAKTEGEDETEVEKIAGFRDELEKVGMIVSW  333

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+ + W+TGVRV
Sbjct  334  CSQVEVLRHRAVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLDESWRTGVRV  393

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +GVV S EI+RC+E VM+  +K +ELR NA+KW+ LA+EA  EGGSSD N+++F  
Sbjct  394  RENSEGVVESGEIRRCLEAVME--EKSDELRENAEKWKRLAIEAGGEGGSSDKNVEAFVE  451

Query  191  NV  186
             +
Sbjct  452  EI  453



>ref|XP_010457643.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=465

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 131/182 (72%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeee-------eeeklscmeelEKQGLIVPW  552
            SK QKEE+A+ L+E KRPFLWVI DKP  E +         E+  +  +ELE+ G+IV W
Sbjct  273  SKKQKEELARALIEGKRPFLWVITDKPNRETKAEGEDETEVEKIAAFRDELEEVGMIVSW  332

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H S+GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ W TGVRV
Sbjct  333  CSQIEVLRHRSVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWMTGVRV  392

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EIKRC+E VM   +K  ELR NA+KW+ LA EA  EGGSSD N+++F  
Sbjct  393  RENSEGLVERGEIKRCLEAVMK--EKSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVE  450

Query  191  NV  186
             +
Sbjct  451  EI  452



>dbj|BAF49300.1| putative glycosyltransferase [Clitoria ternatea]
Length=472

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 133/179 (74%), Gaps = 4/179 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE--KQGLIVPWCSQIE  537
            SK Q EE+A+ LL+  RPFLWVIR+K +   E EEE+       E  ++G IV WCSQ+E
Sbjct  292  SKIQMEELARALLDSGRPFLWVIREKEKKVGETEEEEEELRCREELEQRGKIVKWCSQVE  351

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGED  357
            VL HPSLGCF+THCGWNSTLES+ SG P+VAFP WTDQ TNAKL++DVWKTGVRV    +
Sbjct  352  VLSHPSLGCFVTHCGWNSTLESLVSGIPMVAFPQWTDQKTNAKLVEDVWKTGVRVDHHVN  411

Query  356  --GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
              G+V  EEIKRC+E VM  G+KGEELR NAKKW+DL  E  +EGGS + N+K+F  +V
Sbjct  412  EEGIVEGEEIKRCLEVVMGSGEKGEELRMNAKKWKDLVKETVKEGGSLEKNMKTFLDSV  470



>ref|XP_010475253.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=318

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DKP  E + E E+ + +E++        + G+IV W
Sbjct  125  SKKQIEELARALIEGKRPFLWVITDKPNRETKIEGEEETDIEKIAGLRDELEEVGMIVSW  184

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H ++GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ W+TGVRV
Sbjct  185  CSQIEVLRHRAVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWRTGVRV  244

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EI+RC+E VM+      ELR NA+KW+ LA EA  EGGSSD N+++F  
Sbjct  245  KENSEGLVERAEIRRCLEAVME-EKSSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVE  303

Query  191  NV  186
             +
Sbjct  304  EI  305



>ref|XP_009778637.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009778638.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=463

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 125/175 (71%), Gaps = 12/175 (7%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRD-----KPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            EEIA+GL+  KRPFLWVIRD     KP  +   +EE         + G  V WCSQ+EVL
Sbjct  292  EEIAQGLVLCKRPFLWVIRDGLNGEKPFEKLSCKEELE-------ELGKTVSWCSQVEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSL CF+THCGWNST+ES+ SG PVVA P WTDQ  NAKLIQDVWKTGVRV   ++GV
Sbjct  345  QHPSLACFLTHCGWNSTIESLASGVPVVACPLWTDQLCNAKLIQDVWKTGVRVNTNDEGV  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +   E +RCIE V+  G+K EELR++AKKWR+LA +A +E GSS+ NLK++   V
Sbjct  405  IERNEFERCIEIVVGDGEKREELRKSAKKWRNLAKDAMKEEGSSNVNLKAYVHEV  459



>ref|XP_009765810.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=313

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI++GLL+  RPFLWVIR+      E+ EEKL+C +ELEK G IV WCSQ+EVLKH S+
Sbjct  141  EEISQGLLKCGRPFLWVIRE--TLNGEKPEEKLTCKDELEKIGRIVCWCSQMEVLKHSSV  198

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLES+ SG P+VA P W DQ  NAKLIQDVWK GVRV   ++G+V  +E
Sbjct  199  GCFLTHCGWNSTLESLASGVPIVACPIWNDQICNAKLIQDVWKIGVRVNANKEGIVKRDE  258

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             ++CIE VM   ++GEELR+NA+KW+DLA E+ +E  SS+ NLK++  
Sbjct  259  FQKCIEIVMGDAEEGEELRKNAQKWKDLAKESTKENSSSNVNLKAYVN  306



>ref|XP_006373420.1| hypothetical protein POPTR_0017s13620g [Populus trichocarpa]
 gb|ERP51217.1| hypothetical protein POPTR_0017s13620g [Populus trichocarpa]
Length=460

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            + Q E+I  GL    RPFLWVIR  P    + E E+    +  E+ GLIVPWCSQ+EVL 
Sbjct  288  RNQMEKILLGLTSNCRPFLWVIR--PSGSNDREFEEKIRDKVNEEVGLIVPWCSQMEVLT  345

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GCF+ HCGWNSTLES+ +G PVV FP ++DQ TNAK++++VW+TGVR    EDG +
Sbjct  346  HESIGCFMMHCGWNSTLESLATGVPVVGFPQFSDQTTNAKMVEEVWRTGVRARVNEDGTL  405

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             +EEI RC++ VM GG +GEE+RRNAKKW+ L +EA  EGGSS  NL +F
Sbjct  406  EAEEIARCLDMVMGGGQRGEEIRRNAKKWKGLTLEAVMEGGSSYNNLNAF  455



>ref|XP_006492998.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Citrus sinensis]
Length=470

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeee--eeeklscmeelEKQGLIVPWCSQIEV  534
            K Q EEIA+GLL+   PFLWVIR+    ++++  ++  +   EEL ++G+IVPWCSQ+EV
Sbjct  294  KRQVEEIARGLLDSGHPFLWVIREHENKDKDKGEDDVVMKYKEELNEKGMIVPWCSQVEV  353

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L H ++GCF+THCGWNS+LES+  G PVVAFP WTDQGTNAK+I D  KTGVRV   E+G
Sbjct  354  LSHEAVGCFVTHCGWNSSLESLVCGVPVVAFPQWTDQGTNAKIIVDFCKTGVRVKANEEG  413

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN  189
            ++ S+EIKRC+E VM  GD   E R N+ KW+DLA EA ++GGSS  NLK+F  +
Sbjct  414  ILESDEIKRCLELVMGEGD---EFRGNSLKWKDLAREAAKQGGSSYKNLKAFVDD  465



>ref|XP_002516389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF46006.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 127/175 (73%), Gaps = 8/175 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q EE AK L++I RPFLWV+R+         +  +   +EL+++G+IV WC Q+EVL
Sbjct  290  SEKQMEETAKALIDIDRPFLWVMREN--------DIGVKHRKELQQKGIIVDWCCQVEVL  341

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+THCGWNST+ES  SG PVVA P W+DQGTNAKL+ DVW TG+R+   E G+
Sbjct  342  SHPSVGCFVTHCGWNSTMESFVSGVPVVALPQWSDQGTNAKLVTDVWMTGIRMVPNERGI  401

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
               E++K+ ++ VM   +K +E+R+NA+KW+DLA +A +EGG+SD NLK+F   +
Sbjct  402  FEGEQLKKGVQLVMGEREKAKEMRKNARKWKDLARDAVKEGGTSDKNLKTFLDEI  456



>ref|XP_004252977.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=463

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 124/175 (71%), Gaps = 12/175 (7%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRD-----KPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            EEIA GL+  KRPFLW+IR+     KP  +   +EE         + G  V WCSQ+EVL
Sbjct  292  EEIAHGLVLCKRPFLWIIREGANGEKPFEKLSCKEELE-------ELGKTVDWCSQVEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSL CF+THCGWNS++ES+ SG PVVA P W DQ +NAKLIQDVWKTGVRV   ++GV
Sbjct  345  QHPSLACFLTHCGWNSSMESLASGVPVVACPLWIDQLSNAKLIQDVWKTGVRVNANDEGV  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +   E  RC+E V+  G+KG+E+R+NAKKWRDLA +A +E GSS+ NLK++   +
Sbjct  405  IERNEFARCMEIVVGDGEKGDEIRKNAKKWRDLAKDAMKENGSSNVNLKAYVNEI  459



>ref|XP_009612651.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X2 [Nicotiana tomentosiformis]
Length=313

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 126/168 (75%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI++GLL+  +PFLWVIR+      E+ EEKL+C +EL K G+IV WCSQ+EVLKHPS+
Sbjct  141  EEISQGLLKCGKPFLWVIRE--TLNGEKPEEKLTCKDELAKTGIIVRWCSQMEVLKHPSV  198

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLES+ SG P+VA P W DQ  NAKLIQDVWK GVRV   E+G V  +E
Sbjct  199  GCFLTHCGWNSTLESLASGVPIVACPIWNDQVCNAKLIQDVWKIGVRVNTNEEGTVKRDE  258

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +RCIE V    ++G ELR+N +KW+DLA EA +E  SS+ NLK++  
Sbjct  259  FRRCIEIVTGNNEEGVELRKNVQKWKDLAKEAMKENCSSNVNLKAYVN  306



>ref|XP_010246531.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 133/181 (73%), Gaps = 7/181 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ---GLIVPWCSQIE  537
            K Q EE+A  L+E  RPFLWVIR      EE ++E+ + +  +E+Q   G+IVPWCSQ+E
Sbjct  286  KRQMEELASALIESGRPFLWVIRKNENASEETKKEEEAFLSRIEEQKREGMIVPWCSQVE  345

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE-  360
            VL HPS+GCF++HCGWNSTLES+ +G  VVAFP WTDQ TNA LI+ V+ TGVRV + E 
Sbjct  346  VLSHPSVGCFLSHCGWNSTLESLVTGVRVVAFPQWTDQATNAMLIEGVFGTGVRVREKEG  405

Query  359  --DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
              DGVV  EEIKRC++ V + G+ GEE++RNA+KW++LA +A +E GSSD NL+ F   +
Sbjct  406  EGDGVVEREEIKRCLDMVTE-GENGEEMKRNARKWKELAKKAVKEDGSSDKNLRRFVEEI  464

Query  185  R  183
            R
Sbjct  465  R  465



>emb|CDY10124.1| BnaC05g03670D [Brassica napus]
Length=466

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ Q  E+A  L+E KRPFLWVI DK   E + E E  S +E++ + G+IV WCSQ+EVL
Sbjct  276  SRKQIGELAGALIEGKRPFLWVITDKSNREAKLEGEDESEIEKIAEVGMIVSWCSQVEVL  335

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +H ++GCF+THCGW+STLES+  G PVVAFP W+DQ TNAKL++++W+TGVRV + E+G+
Sbjct  336  RHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEELWRTGVRVRENEEGL  395

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V   EI+RC+E VMD  +K  ELR NA++WR LA+EA REGGS D N+++F   +
Sbjct  396  VERGEIRRCLEAVMD--EKLVELRENAEEWRRLAVEAGREGGSCDKNIEAFVDEI  448



>ref|XP_006421040.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|ESR34280.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|KDO49186.1| hypothetical protein CISIN_1g041902mg [Citrus sinensis]
Length=470

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 130/176 (74%), Gaps = 5/176 (3%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeee--eeeklscmeelEKQGLIVPWCSQIEV  534
            K Q EEIA+GLL+   PFLWVIR+    ++++  ++  +   EEL ++G+IVPWCSQ+EV
Sbjct  294  KRQVEEIARGLLDSGHPFLWVIREHENKDKDKGEDDVVMKYKEELNEKGMIVPWCSQVEV  353

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L H ++GCF+THCGWNS+LES+  G PVVAFP WTDQGTNAK+I D  KTGVRV   E+G
Sbjct  354  LSHEAVGCFVTHCGWNSSLESLVCGVPVVAFPQWTDQGTNAKIIVDFCKTGVRVKANEEG  413

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            ++ S+EIKRC+E VM  GD   E R N+ KW+DLA EA ++GGSS  NLK+F  + 
Sbjct  414  ILESDEIKRCLELVMGEGD---EFRGNSLKWKDLAREAAKQGGSSYKNLKAFVDDF  466



>ref|XP_011021104.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=461

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 124/170 (73%), Gaps = 1/170 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q E+I  GL    RPFLWV+R      ++ E E+    +  E++GLIVPWCSQ+EVL 
Sbjct  288  KNQMEKILLGLTGTCRPFLWVVRPS-AGSDDREFEEKIRDKVNEEEGLIVPWCSQMEVLA  346

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GCF+ HCGWNSTLES+ +G PVV FP ++DQ TNAK++++VW+TGVR    +DG +
Sbjct  347  HESIGCFMMHCGWNSTLESLATGVPVVGFPQFSDQTTNAKMVEEVWRTGVRARVNDDGTL  406

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             +EEI+RC+E VM GG +GEE+RRNAKKW+ L +EA  EGGSS  NL +F
Sbjct  407  EAEEIERCLEMVMGGGQRGEEIRRNAKKWKGLTLEAVMEGGSSYNNLNAF  456



>gb|EYU31586.1| hypothetical protein MIMGU_mgv1a005918mg [Erythranthe guttata]
Length=465

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIAKGLLE  RPFLWVIR   +N+ EEEEEKLSC++ELEK G  VPWCSQ+EVL 
Sbjct  291  KAQMEEIAKGLLESDRPFLWVIRINEDNKNEEEEEKLSCLDELEKIGKFVPWCSQLEVLT  350

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GCF++HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+DVWK+GVRV       V
Sbjct  351  HASVGCFVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGDGV  410

Query  347  G-SEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
              S EI RCIE VMDGG++  ELR NA++W+ LA EA  E GSS  NLK+F
Sbjct  411  VESGEINRCIEEVMDGGERSRELRANAREWKSLAREAMDENGSSCNNLKAF  461



>ref|XP_009590508.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 122/175 (70%), Gaps = 12/175 (7%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRD-----KPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            EEIA+GL+  KRPFLWVIR+     KP      +EE         + G  VPWCSQ+EVL
Sbjct  292  EEIAQGLVLCKRPFLWVIREGLNGEKPFENLSCKEELE-------ELGKTVPWCSQVEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSL CF+THCGWNST+ES+ SG PVVA P WTDQ  NAKLIQDVWKTGVRV    +GV
Sbjct  345  QHPSLACFLTHCGWNSTIESLTSGVPVVACPLWTDQLCNAKLIQDVWKTGVRVNANNEGV  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +   E +RCIE V+  G+K EEL  NAKKW++LA +A +E GSS+ NLK++   V
Sbjct  405  IERNEFERCIEIVVGDGEKREELTNNAKKWKELAKDAMKEDGSSNVNLKAYVHEV  459



>ref|XP_010475249.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=415

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 131/182 (72%), Gaps = 8/182 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DKP  E + E E+ + +E++        + G+IV W
Sbjct  222  SKKQIEELARALVEGKRPFLWVITDKPNRETKIEGEEETDIEKIAGLRDELEEVGMIVSW  281

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H ++GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ W+TGVRV
Sbjct  282  CSQIEVLRHRAVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWRTGVRV  341

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EI+RC+E VMD      ELR NA+KW+ LA EA  EGGSSD N+++F  
Sbjct  342  RENSEGLVERGEIRRCLEAVMD-EKSSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVE  400

Query  191  NV  186
             +
Sbjct  401  EI  402



>ref|XP_004504379.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14114.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 129/172 (75%), Gaps = 10/172 (6%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIA+ LL+   PFLWVI++K        EE+L+C EELE++G IV WCSQ+E+L 
Sbjct  288  KKQMEEIARALLDCGFPFLWVIKEK--------EEELNCREELEEKGKIVKWCSQLEILS  339

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GEDG  354
            HPSLGCF+THCGWNST+ES+ SG P+V FP W DQ TNAKL++DVWK GVRV     +DG
Sbjct  340  HPSLGCFLTHCGWNSTIESLVSGVPLVVFPQWADQMTNAKLVEDVWKIGVRVDHKMNQDG  399

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +V  E+I+ C+E VM  G K EELR N+KKW++L+ EA +EGGSS+ NL+ F
Sbjct  400  IVIGEDIRNCLEVVMGSGGKCEELRENSKKWKELSREAVKEGGSSENNLRGF  451



>dbj|BAF49285.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 127/180 (71%), Gaps = 4/180 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeee----eklscmeelEKQGLIVPWCSQ  543
            S TQ +EIAKGLL   + FLWVI    +   + +E       + MEELE++G+IVPWC+Q
Sbjct  277  SMTQMKEIAKGLLASGKAFLWVITSNNDETVKNQEDGIEILNNMMEELEEKGMIVPWCAQ  336

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVLKHPS+GCF+THCGWNSTLES+  G P+V FP   DQGT +KL+ DVWK GVRV + 
Sbjct  337  LEVLKHPSIGCFLTHCGWNSTLESMVCGVPMVCFPKMFDQGTISKLVVDVWKVGVRVDEN  396

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            EDG+V  EEIK+CI+ VMDGG   +EL  NA+KW  L  EA  EGGSS  NLK+F   ++
Sbjct  397  EDGIVCQEEIKKCIDHVMDGGKFAQELGENARKWMSLGKEAVLEGGSSYYNLKAFVEEIK  456



>dbj|BAF49286.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
 dbj|BAF49287.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 127/180 (71%), Gaps = 4/180 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeee----eklscmeelEKQGLIVPWCSQ  543
            S TQ +EIAKGLL   + FLWVI    +   + +E       + MEELE++G+IVPWC+Q
Sbjct  277  SMTQMKEIAKGLLASGKAFLWVITSNNDETVKNQEDGIEILNNMMEELEEKGMIVPWCAQ  336

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            +EVLKHPS+GCF+THCGWNSTLES+  G P+V FP   DQGT +KL+ DVWK GVRV + 
Sbjct  337  LEVLKHPSIGCFLTHCGWNSTLESMVCGVPMVCFPKMFDQGTISKLVVDVWKVGVRVDEN  396

Query  362  EDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            EDG+V  EEIK+CI+ VMDGG   +EL  NA+KW  L  EA  EGGSS  NLK+F   ++
Sbjct  397  EDGIVCQEEIKKCIDHVMDGGKFAQELGENARKWMSLGKEAVLEGGSSYYNLKAFVEEIK  456



>gb|EYU31588.1| hypothetical protein MIMGU_mgv1a005398mg [Erythranthe guttata]
Length=485

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIR--DKPeneeeeeeeklscmeelEKQGLIVPWCSQIEV  534
            K Q E IAKGLLE  RPFLWVIR  +  +NEEEEEEEKLSC++ELEK G IVPWCSQ+EV
Sbjct  308  KAQMEGIAKGLLESDRPFLWVIRINEDKKNEEEEEEEKLSCLDELEKIGKIVPWCSQLEV  367

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPS+GCF++HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+DVWK+GVRV     G
Sbjct  368  LTHPSIGCFVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGG  427

Query  353  VVGSE--EIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
                E  EIKRCIE VMDGG++  ELR NA++W+  A EA  E GSS  NLK+F
Sbjct  428  DGVVESGEIKRCIEEVMDGGERSRELRANAREWKSFAREAMDENGSSFNNLKAF  481



>ref|XP_002263532.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=447

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWVIR       E E E+       E+QGLIV WCSQ+EVL 
Sbjct  275  KNQMEEIFHGLMESHRPFLWVIRS-----IESELEEKMNSSLSEEQGLIVQWCSQVEVLC  329

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNST+ES+ +G PVVA P ++DQ TNAKL+ +VW TGV+    E+GVV
Sbjct  330  HQAVGCFLTHCGWNSTMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVV  388

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN--VRNH  177
              EEIK+C+E VM+GG+KG+E+RRNA KW+ LA+E+   G S +TNLK F  +  +R H
Sbjct  389  EREEIKKCLEMVMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESLEIRTH  447



>gb|ABQ02257.1| O-glucosyltransferase 2 [Vitis labrusca]
Length=447

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 127/179 (71%), Gaps = 8/179 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWVIR       E E E+       E+QGLIV WCSQ+EVL 
Sbjct  275  KKQMEEIFHGLMESHRPFLWVIRS-----MESELEEKMNSSLSEEQGLIVQWCSQVEVLC  329

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNST+ES+ +G PVVA P ++DQ TNAKL+ +VW TGV+    E+GVV
Sbjct  330  HQAVGCFLTHCGWNSTMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVV  388

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN--VRNH  177
              EEIK+C+E VM+GG+KG+E+RRNA KW+ LA+E+   G S +TNLK F  +  VR H
Sbjct  389  EREEIKKCLEMVMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESLEVRTH  447



>ref|XP_006858834.1| hypothetical protein AMTR_s00066p00178410 [Amborella trichopoda]
 gb|ERN20301.1| hypothetical protein AMTR_s00066p00178410 [Amborella trichopoda]
Length=185

 Score =   183 bits (464),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 119/177 (67%), Gaps = 1/177 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  Q EEIA  L   K PFLWV+R   E+++          E   KQGL+VPWCSQ++VL
Sbjct  5    SAEQMEEIASALRLSKWPFLWVVRPPLEHQKGGNSLPEGFAEATSKQGLVVPWCSQLDVL  64

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H ++GCF+THCGWNS LE +  G P++A P W+DQ TN+K I DVW+ GVRV   E+ V
Sbjct  65   AHQAVGCFVTHCGWNSKLEGLSQGVPMIAAPLWSDQQTNSKFISDVWEVGVRVEVDENEV  124

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRN  180
            +   E++RCI+  M+ G++G++LR+NA KWRDLA EA  EGGSSD N K FA  V N
Sbjct  125  LRRGELERCIKEFME-GERGDQLRKNAHKWRDLAREAMNEGGSSDNNTKEFAAMVSN  180



>ref|XP_010485047.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X1 [Camelina 
sativa]
Length=465

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 129/182 (71%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeee-------eeeklscmeelEKQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DKP  E +         E+     +ELE+ G++V W
Sbjct  273  SKKQIEELARALIEGKRPFLWVITDKPNRETKAEGEDEIEVEKIAGFRDELEEVGMLVSW  332

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H S+GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ W TGVRV
Sbjct  333  CSQIEVLRHRSVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWMTGVRV  392

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EIKRC+E VM   +K  ELR NA+KW+ LA EA  EGGSSD N+++F  
Sbjct  393  RENSEGLVERGEIKRCLEAVMK--EKSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVE  450

Query  191  NV  186
             +
Sbjct  451  EI  452



>ref|XP_010243149.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 131/181 (72%), Gaps = 7/181 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ---GLIVPWCSQIE  537
            K Q EE+A  L+E  RPFLWVIR      EE ++E+ + +  +E+Q   G+IVPWCSQ+E
Sbjct  286  KRQMEELASALIESGRPFLWVIRKNENASEETKKEEEAFLSRIEEQKREGMIVPWCSQVE  345

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE-  360
            VL HPS+GCF++HCGWNSTLES+ +G  VVAFP WTDQ TNA LI+ V  TGVRV   E 
Sbjct  346  VLSHPSVGCFLSHCGWNSTLESLVTGVRVVAFPQWTDQATNAMLIEGVCGTGVRVRAKEG  405

Query  359  --DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
              DGVV  EEI RC++ VM+ G+ GEE++RNA+KW++LA +A +E GSSD NL+ F   +
Sbjct  406  EGDGVVEREEIMRCLDMVME-GENGEEMKRNARKWKELAKKAVKEDGSSDKNLRRFVEEI  464

Query  185  R  183
            R
Sbjct  465  R  465



>ref|XP_010485054.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X2 [Camelina 
sativa]
Length=465

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 129/182 (71%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeee-------eeeklscmeelEKQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DKP  E +         E+     +ELE+ G++V W
Sbjct  273  SKKQIEELARALIEGKRPFLWVITDKPNRETKAEGEDEIEVEKIAGFRDELEEVGMLVSW  332

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H S+GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ W TGVRV
Sbjct  333  CSQIEVLRHRSVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWMTGVRV  392

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EIKRC+E VM   +K  ELR NA+KW+ LA EA  EGGSSD N+++F  
Sbjct  393  RENSEGLVERGEIKRCLEAVMK--EKSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVE  450

Query  191  NV  186
             +
Sbjct  451  EI  452



>ref|XP_010434952.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 127/181 (70%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            +K Q  E+ K L++ +RPFLWVI DK     E+E+EK     +  ++     G++V WC 
Sbjct  292  NKKQLVELCKALIQSRRPFLWVITDKSYRSREDEKEKEEDCIKSFREELDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ +G PVVAFP WTDQ TNAKL++D WKTGVRV +
Sbjct  352  QFRVLNHRSIGCFVTHCGWNSTLESLVAGVPVVAFPQWTDQMTNAKLLEDCWKTGVRVME  411

Query  365  GEDG----VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             +D     +V SEEI+RCIE VM+G  K EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  412  KKDDEGVVLVESEEIRRCIEEVMEG--KAEEFRGNAARWKDLAAEAVREGGSSFNHLKAF  469

Query  197  A  195
            A
Sbjct  470  A  470



>ref|XP_009604418.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=465

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRD-KPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            K QKEEI  GLLE +RPFLWV+R  K E E+    +       L ++GLI+PWC+Q+EVL
Sbjct  292  KEQKEEILHGLLESERPFLWVMRKGKEEVEKGNNYKNEYDDSLLNEKGLIIPWCAQMEVL  351

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+THCGWNSTLES+ +G P+V  P ++DQ TNAK+ ++VW TGVR    E+ +
Sbjct  352  FHKSIGCFVTHCGWNSTLESLVAGVPIVGCPQFSDQTTNAKMAEEVWGTGVRANAVEE-L  410

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            VG EE+KRC+E +M  G+KGEE++RN KKW DLA+EA + GGSS  NLK F
Sbjct  411  VGREELKRCLEILMGSGEKGEEIKRNVKKWSDLAVEAVKIGGSSHDNLKIF  461



>gb|AJM89728.1| UDP-glucosyltransferase [Leonurus japonicus]
Length=455

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 131/174 (75%), Gaps = 6/174 (3%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            L  +K Q EEI KGL+E  RPFLWVIR      EE+EEE LSC++ELE+ G I+PWCSQ+
Sbjct  286  LRLAKPQMEEIGKGLVEANRPFLWVIR--ASEVEEKEEETLSCLKELERIGKIIPWCSQL  343

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL HPSLGCF+THCGWNSTLES+  G PVVAFP WTDQGTNAKLI+DVW++GVRV    
Sbjct  344  EVLTHPSLGCFVTHCGWNSTLESLSCGVPVVAFPGWTDQGTNAKLIEDVWRSGVRVRVNG  403

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +GVV   E++RCIE VM  GD   +LR NA KW+ LA EA  E GSS  NLK+F
Sbjct  404  EGVVEGGELRRCIEEVM--GDI--QLRDNAVKWKALAREAVGENGSSYKNLKAF  453



>sp|Q9ZR27.1|5GT1_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R4; Short=p3R4; Flags: Precursor [Perilla frutescens]
 dbj|BAA36421.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Perilla frutescens 
var. crispa]
Length=460

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 126/174 (72%), Gaps = 0/174 (0%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI KGLL   RPFLW+IR++  ++ EEEEE+LSC+ EL+K G IV WCSQ+EVL 
Sbjct  284  KAQMEEIGKGLLACGRPFLWMIREQKNDDGEEEEEELSCIGELKKMGKIVSWCSQLEVLA  343

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            HP+LGCF+THCGWNS +ES+  G PVVA P W DQ TNAKLI+D W TGVRV   E G V
Sbjct  344  HPALGCFVTHCGWNSAVESLSCGVPVVAVPQWFDQTTNAKLIEDAWGTGVRVRMNEGGGV  403

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
               EI+RC+E VMDGG+K + +R NA KW+ LA EA  E GSS  NL +F   V
Sbjct  404  DGSEIERCVEMVMDGGEKSKLVRENAIKWKTLAREAMGEDGSSLKNLNAFLHQV  457



>dbj|BAA19155.1| glucosyl transferase [Nicotiana tabacum]
Length=467

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI++GLL+  RPFLWVIR+      E+ EEKL+C +ELEK G IV WCSQ+EVLKH S+
Sbjct  295  EEISQGLLKCGRPFLWVIRE--TLNGEKPEEKLTCKDELEKIGRIVRWCSQMEVLKHSSV  352

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLES+ SG P+VA P W DQ  NAKLIQDVWK GVRV   ++G++  +E
Sbjct  353  GCFLTHCGWNSTLESLASGVPIVACPIWNDQICNAKLIQDVWKIGVRVNANKEGIIKRDE  412

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             ++CIE VM   ++GEELR+NA+KW+DLA E+ +E  SS+ NLK++  
Sbjct  413  FQKCIEIVMGDAEEGEELRKNAQKWKDLAKESTKENSSSNVNLKAYVN  460



>ref|XP_009105515.1| PREDICTED: UDP-glycosyltransferase 75B2 [Brassica rapa]
Length=470

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPenee-------eeeeeklscmeelEKQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DK   E         E E+      ELE+ G+IV W
Sbjct  270  SKKQIEELARALIECKRPFLWVITDKVNREAKIKGENETEIEKIAGLRHELEEVGMIVSW  329

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF+THCGW+STLES+  G PVVAFP W+DQ TNAKL++D+W+TGVRV
Sbjct  330  CSQVEVLRHRAVGCFLTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEDLWRTGVRV  389

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             + EDG+V   EI+RC+E VM+  +K  ELR N + W+ LA+EA RE GSSD N+++F 
Sbjct  390  RENEDGLVVRGEIRRCLEAVME--EKSVELRENGEAWKRLAVEAGREKGSSDKNMEAFV  446



>emb|CAN73416.1| hypothetical protein VITISV_017052 [Vitis vinifera]
Length=453

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 8/179 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWVIR       E E E+       E+QGLIV WC Q+EVL 
Sbjct  275  KKQMEEIFHGLMESHRPFLWVIRS-----IESELEEKMNSSLSEEQGLIVQWCFQVEVLC  329

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNST+ES+ +G PVVA P ++DQ TNAKL+ +VW TGV+    E+GVV
Sbjct  330  HQAVGCFLTHCGWNSTMESLVAGVPVVACPQFSDQXTNAKLV-EVWGTGVKAXANEEGVV  388

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN--VRNH  177
              EEIK+C+E VM+GG+KG+E+RRNA KW+ LA+E+   G S +TNLK F  +  +R H
Sbjct  389  EREEIKKCLEMVMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESLEIRTH  447



>ref|XP_009612650.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=467

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 126/168 (75%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI++GLL+  +PFLWVIR+      E+ EEKL+C +EL K G+IV WCSQ+EVLKHPS+
Sbjct  295  EEISQGLLKCGKPFLWVIRE--TLNGEKPEEKLTCKDELAKTGIIVRWCSQMEVLKHPSV  352

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLES+ SG P+VA P W DQ  NAKLIQDVWK GVRV   E+G V  +E
Sbjct  353  GCFLTHCGWNSTLESLASGVPIVACPIWNDQVCNAKLIQDVWKIGVRVNTNEEGTVKRDE  412

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +RCIE V    ++G ELR+N +KW+DLA EA +E  SS+ NLK++  
Sbjct  413  FRRCIEIVTGNNEEGVELRKNVQKWKDLAKEAMKENCSSNVNLKAYVN  460



>ref|XP_006342284.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=467

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 122/168 (73%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI  GLL+  RPFLW IR+    + E+ E+KLSC EELEKQG IV WCSQ+EVLKHPS+
Sbjct  293  EEIGHGLLKCGRPFLWAIRE--GQDGEKMEDKLSCKEELEKQGKIVNWCSQVEVLKHPSV  350

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLESI S  P+VA P W DQ  NAKLIQD+WK GVRV   E GVV  +E
Sbjct  351  GCFLTHCGWNSTLESIASKVPIVACPLWNDQVCNAKLIQDIWKNGVRVNVSEGGVVERDE  410

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
              RCI   M   ++GEELRRNAKKW +LA EA +E G+S   LK FA 
Sbjct  411  FNRCITIAMGSDEEGEELRRNAKKWSNLAKEAMKENGTSSLKLKDFAN  458



>ref|XP_009765809.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=485

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHPSL  516
            EEI++GLL+  RPFLWVIR+      E+ EEKL+C +ELEK G IV WCSQ+EVLKH S+
Sbjct  313  EEISQGLLKCGRPFLWVIRE--TLNGEKPEEKLTCKDELEKIGRIVCWCSQMEVLKHSSV  370

Query  515  GCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGSEE  336
            GCF+THCGWNSTLES+ SG P+VA P W DQ  NAKLIQDVWK GVRV   ++G+V  +E
Sbjct  371  GCFLTHCGWNSTLESLASGVPIVACPIWNDQICNAKLIQDVWKIGVRVNANKEGIVKRDE  430

Query  335  IKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             ++CIE VM   ++GEELR+NA+KW+DLA E+ +E  SS+ NLK++  
Sbjct  431  FQKCIEIVMGDAEEGEELRKNAQKWKDLAKESTKENSSSNVNLKAYVN  478



>gb|EYU31585.1| hypothetical protein MIMGU_mgv1a007491mg [Erythranthe guttata]
Length=405

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklsc-meelEKQGLIVPWCSQIEVL  531
            K Q E++AKGLLE  RPFLWVIR   + + EEEEE+    ++ELEK G IVPWCSQ+EVL
Sbjct  230  KAQMEKVAKGLLESDRPFLWVIRTNEDKKNEEEEEEKLSCLDELEKIGKIVPWCSQLEVL  289

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF++HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+DVWK+GVRV       
Sbjct  290  THPSIGCFVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGDG  349

Query  350  VG-SEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  S EIKRCIE VMDGG +  ELR NA++W+ LA  A  E GSS  NLK F
Sbjct  350  VVESGEIKRCIEEVMDGGKRSRELRANAREWKSLARGAMDENGSSCKNLKDF  401



>ref|XP_006305828.1| hypothetical protein CARUB_v10010859mg [Capsella rubella]
 gb|EOA38726.1| hypothetical protein CARUB_v10010859mg [Capsella rubella]
Length=449

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 129/179 (72%), Gaps = 9/179 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeee-------eeeklscmeelEKQGLIVPW  552
            SK Q  E+A  L+E +RPFLWVI DKP  E +         E+     +ELE+ G+IV W
Sbjct  269  SKKQLSELAIALIEWRRPFLWVITDKPNRETKTEGEDEIEVEKIAGFRDELEEVGMIVSW  328

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H S+GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ W+TGVRV
Sbjct  329  CSQIEVLRHRSVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWRTGVRV  388

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             +  +G+V   EI+RC+E VM+  +K  ELR+NA+KW+ L +EA  EGGSSD N+++F 
Sbjct  389  KENSEGLVDRGEIRRCLEAVME--EKSVELRQNAEKWKRLTIEAGEEGGSSDKNVEAFV  445



>ref|XP_008219026.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Prunus mume]
Length=471

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEK-QGLIVPWCSQIEVL  531
            K Q EE+  GL+E   P LWVIR   +  ++E +          K QGL+VPWCSQ+EVL
Sbjct  296  KDQIEEMLNGLIESGLPVLWVIRCVEKGGDQEAQIMKIKNRLKIKEQGLVVPWCSQMEVL  355

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+ HCGWNST+ES+ +G P+V F  ++DQ TNAKL+++VW  GVR  + E+GV
Sbjct  356  GHKSVGCFVMHCGWNSTVESLVAGVPMVGFAQFSDQNTNAKLVEEVWGVGVRAKENEEGV  415

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +G  EIKRC+E VM  G++GEE+RRN +KW+ LA EA +EGGSSD NL+ F G +
Sbjct  416  IGGAEIKRCLEIVMGDGERGEEIRRNCEKWKGLATEAVKEGGSSDYNLRHFIGGL  470



>ref|XP_006442002.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
 gb|ESR55242.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
Length=484

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 129/177 (73%), Gaps = 7/177 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ----GLIVPWCSQI  540
            K Q EEIA+GLL+   PFLWV R+    ++++++ +   M + +++    G+IVPWCSQ+
Sbjct  306  KRQVEEIARGLLDSGHPFLWVSRESDNKDKDKDKGEDDVMMKYKEELNEKGMIVPWCSQV  365

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL H ++GCF+THCGW+S+LES+  G PVVAFP WTDQGTNAK+I D  KTGVRV   E
Sbjct  366  EVLSHEAVGCFVTHCGWSSSLESLVYGVPVVAFPQWTDQGTNAKIIVDFCKTGVRVKANE  425

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN  189
            +G+V S+EI RC+E VM  GD   + RRN+ KW+DLA +A ++GGSS  NLK+F  +
Sbjct  426  EGIVESDEINRCLELVMGEGD---DFRRNSLKWKDLARDAVKQGGSSHKNLKAFVDD  479



>gb|AAB58497.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
Length=474

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 126/181 (70%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q  E+ K L++ +RPFLWVI DK    +E+E+EK        ++     G++V WC 
Sbjct  292  SKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSSEKSFDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP W DQ TNAKL++D WKTGVRV +
Sbjct  352  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMTNAKLLEDCWKTGVRVME  411

Query  365  G--EDG--VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               E+G  VV SEEI+RCIE VM+  DK EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  412  KKEEEGVVVVDSEEIRRCIEEVME--DKAEEFRGNATRWKDLAAEAVREGGSSFNHLKAF  469

Query  197  A  195
             
Sbjct  470  V  470



>gb|KFK42892.1| hypothetical protein AALP_AA1G052200 [Arabis alpina]
Length=464

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmee-------lEKQGLIVPW  552
            SK Q EE+A+ L++ KRPFLWVI DK   E + E E  + +E+       LE+ G+IV W
Sbjct  274  SKKQIEELARALIDGKRPFLWVITDKSNREAKTEGEDETEIEKIDGLRHELEEVGMIVSW  333

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H S+GCF+THCGWNSTLES+  G PVVAFP W+DQ TNAKL+++ WKTGVRV
Sbjct  334  CSQVEVLRHRSVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEEQWKTGVRV  393

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + E G+V   EI+RC+E VM+  +K  ELR NA+KW+ LA EA  EGGSSD N+++F  
Sbjct  394  RENEKGLVERGEIRRCLEAVME--EKAVELRENAEKWKRLAAEAVGEGGSSDKNMEAFVE  451

Query  191  NV  186
             +
Sbjct  452  EI  453



>ref|XP_010549173.1| PREDICTED: UDP-glycosyltransferase 75D1 [Tarenaya hassleriana]
Length=478

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 125/177 (71%), Gaps = 5/177 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPenee----eeeeeklscmeelEKQGLIVPWCSQ  543
            SK Q EEI+K L+  +RPFLWVI +K    E     EE+   S  ++L++QGLIV WC Q
Sbjct  293  SKKQYEEISKALIRSRRPFLWVISEKTYKSEEDRDNEEDNITSFRQQLDEQGLIVQWCDQ  352

Query  542  IEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQG  363
            ++VL H S+GCF+THCGWNSTLES+ SG PVVAFP  +DQ TNAKL+++ WKTGVRV   
Sbjct  353  LQVLNHRSIGCFVTHCGWNSTLESLVSGIPVVAFPQSSDQTTNAKLVEECWKTGVRVNVN  412

Query  362  ED-GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
            ED GVV S EI+RC+E VM      +E RRNA KWRDLA  + R GGSS  NLK+F 
Sbjct  413  EDEGVVESGEIRRCVEAVMAEETTADEFRRNAAKWRDLAAGSVRGGGSSCNNLKAFV  469



>ref|XP_004242781.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=466

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 129/175 (74%), Gaps = 6/175 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S    EEIA+GLL+  RPFLWVIR     + E  +EKL C EELEKQG IV WCSQ+EVL
Sbjct  293  SNQLMEEIAQGLLKSGRPFLWVIRK--GIKGENPKEKLRCKEELEKQGKIVTWCSQVEVL  350

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             HPS+GCF+THCGWNSTLES+ SG P+VA P W DQ  NAKLIQDVWK GVRV+  ++G+
Sbjct  351  HHPSVGCFLTHCGWNSTLESLASGVPIVACPLWNDQLCNAKLIQDVWKIGVRVSVNDEGI  410

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  ++ +RCI+ VM    KGEE R+NAKKW+DLA E  +E GSS+ N++++   +
Sbjct  411  VEKDDFERCIDVVM----KGEECRKNAKKWKDLAKEVMKENGSSNLNMQAYVNEI  461



>gb|AAL24226.1| AT4g15550/dl3815c [Arabidopsis thaliana]
 gb|AAM65349.1| AT4g15550/dl3815c [Arabidopsis thaliana]
Length=418

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 125/181 (69%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q  E+ K L++ +RPFLWVI DK    +E+E+EK        ++     G++V WC 
Sbjct  236  SKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSFREELDEIGMVVSWCD  295

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP W DQ  NAKL++D WKTGVRV +
Sbjct  296  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMMNAKLLEDCWKTGVRVME  355

Query  365  G--EDG--VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               E+G  VV SEEI+RCIE VM+  DK EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  356  KKEEEGVVVVDSEEIRRCIEEVME--DKAEEFRGNATRWKDLAAEAVREGGSSFNHLKAF  413

Query  197  A  195
             
Sbjct  414  V  414



>ref|XP_009781303.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=455

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 123/168 (73%), Gaps = 6/168 (4%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            QKEEI KGLLE +RPFLWVIR        E+ +  +    L  +G+IVPWCSQ+EVL H 
Sbjct  290  QKEEILKGLLESERPFLWVIR-----LSNEDGKNKNVNYGLNGKGMIVPWCSQMEVLFHK  344

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GCF++HCGWNSTLESI +  P++ +P ++DQ TN K++++VW TGVR  + E+G+V  
Sbjct  345  SIGCFVSHCGWNSTLESIVADVPLIGYPQFSDQVTNIKMVEEVWGTGVR-ARAEEGIVKR  403

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            EE+KRC++ +M  G+KG E+RRN KK++DLAMEA + GGSS  NL  F
Sbjct  404  EELKRCLKILMGDGEKGNEIRRNVKKYKDLAMEAVKGGGSSHYNLNKF  451



>emb|CDP15113.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 123/176 (70%), Gaps = 3/176 (2%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K +K EI +GL E  R ++ V+R     E E+EE K      L  +G IVPWCSQ+EVL 
Sbjct  252  KDEKLEILRGLEETGRHYMIVMR---AVENEDEEVKEMMENGLNGKGKIVPWCSQMEVLC  308

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GCF+THCGWNSTLES+ +G P+V  PH+ DQ TNAKLI++VW  GVR    EDGVV
Sbjct  309  HKSIGCFLTHCGWNSTLESLVAGVPIVGCPHFADQTTNAKLIEEVWSNGVRAKANEDGVV  368

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRN  180
            G EEIKRC++ +M GG+K EE+RRNA KWR LA+EA +E GSS  N K F  ++ N
Sbjct  369  GREEIKRCVDVLMGGGEKEEEIRRNAAKWRGLALEAMKENGSSHNNFKLFLDSLDN  424



>ref|XP_010025796.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=157

 Score =   179 bits (454),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  575  KQGLIVPWCSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQD  396
            KQG+IVPWCSQ+EVL HPS+GCF+THCGWNSTLES+  G P+VAFP W DQ TNA LIQD
Sbjct  25   KQGMIVPWCSQVEVLSHPSVGCFVTHCGWNSTLESVVCGVPMVAFPLWADQLTNAMLIQD  84

Query  395  VWKTGVRVTQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSD  216
            VWK GVRV+  E GVV  EE+ RC+E V+ GG++ E +R NAK+ +D A EA++EGG +D
Sbjct  85   VWKVGVRVSGNERGVVEGEELTRCLEMVLGGGERSEGMRGNAKRLKDAAREASKEGGCAD  144

Query  215  TNLKSF  198
             NLK+ 
Sbjct  145  KNLKAL  150



>ref|XP_010480357.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=189

 Score =   180 bits (457),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DK   E + E E  + +E++        + G+IV W
Sbjct  5    SKKQIEELARALIEYKRPFLWVITDKLNREAKIEGEDETEVEKIACFRHELEEVGMIVSW  64

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H + GCF+THCGW+STLES+  G PVVA P W+DQ TNAKL+++ WKTGVRV
Sbjct  65   CSQIEVLRHRAAGCFVTHCGWSSTLESLVLGVPVVALPMWSDQPTNAKLLEESWKTGVRV  124

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EI+RC+E VM+   + E+L+ + +KW+ LA+EA  EGGSSD N+K+F  
Sbjct  125  RENSEGLVERGEIRRCLEEVME--KRAEKLKESTEKWKRLAIEAGGEGGSSDKNIKAFVE  182

Query  191  NV  186
            ++
Sbjct  183  SL  184



>ref|XP_010434517.1| PREDICTED: UDP-glycosyltransferase 75D1 [Camelina sativa]
Length=474

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 127/181 (70%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            +K Q  E+ K L++ +RPFLWVI DK     E+E+EK     +  ++     G++V WC 
Sbjct  292  TKKQLGELCKALIQSRRPFLWVITDKSYRSREDEKEKEEDCIKSFREELDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL++D WKTGVRV +
Sbjct  352  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWTDQMTNAKLLEDCWKTGVRVME  411

Query  365  GEDG----VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             +D     +V SEEI+RCI+ VM+  +K EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  412  KKDEEGVVLVESEEIRRCIDEVME--EKAEEFRGNAARWKDLAAEAVREGGSSFNHLKAF  469

Query  197  A  195
            A
Sbjct  470  A  470



>emb|CAB10333.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78597.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=458

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 125/181 (69%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q  E+ K L++ +RPFLWVI DK    +E+E+EK        ++     G++V WC 
Sbjct  276  SKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSFREELDEIGMVVSWCD  335

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP W DQ  NAKL++D WKTGVRV +
Sbjct  336  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMMNAKLLEDCWKTGVRVME  395

Query  365  G--EDG--VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               E+G  VV SEEI+RCIE VM+  DK EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  396  KKEEEGVVVVDSEEIRRCIEEVME--DKAEEFRGNATRWKDLAAEAVREGGSSFNHLKAF  453

Query  197  A  195
             
Sbjct  454  V  454



>ref|XP_010440288.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=473

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 125/180 (69%), Gaps = 10/180 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            +K Q  E+ K L++ +RPFLWVI DK     E+E+EK     +  ++     G++V WC 
Sbjct  292  NKKQLVELCKALIQSRRPFLWVITDKSYRSREDEKEKEEDCIKSFREELDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP WTDQ TNAKL++D WKTGVRV +
Sbjct  352  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWTDQMTNAKLLEDCWKTGVRVME  411

Query  365  GEDG---VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             +D    +V  EEI+RCIE VM+G  K EE R NA +W+DLA EA  EGGSS  +LK+FA
Sbjct  412  KKDDEVVLVEGEEIRRCIEEVMEG--KAEEFRGNAARWKDLAAEAMSEGGSSFNHLKAFA  469



>ref|XP_009622557.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=454

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            QKEEI KGLLE +RPFLWVIR        E+++  +    L  +G+IVPWCSQ+E+L H 
Sbjct  290  QKEEILKGLLESERPFLWVIRSS-----NEDDKIKNENYGLNGKGMIVPWCSQMEILFHK  344

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GCF++HCGWNSTLESI  G P++ +P ++DQ TN K++++VW TGVR  + E+G+V  
Sbjct  345  SIGCFVSHCGWNSTLESIALGVPLIGYPQFSDQVTNIKMVEEVWGTGVR-ARAEEGIVKR  403

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            EE+KRC+E +M  G+KG E+RRN KK+ DLAMEA R GGSS  NL  F
Sbjct  404  EELKRCLEILMGNGEKGNEIRRNVKKYGDLAMEAVR-GGSSHYNLNKF  450



>emb|CBI39412.3| unnamed protein product [Vitis vinifera]
Length=646

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 129/179 (72%), Gaps = 8/179 (4%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWVIR       E E E+++     E+QGLIV WCSQ+EVL 
Sbjct  474  KKQMEEIFHGLMESHRPFLWVIRS-----TESEVEEMTNNSMSEEQGLIVQWCSQVEVLC  528

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNST+ES+ +G PVVA P ++DQ TNAKL+ +VW TGV+    E+GVV
Sbjct  529  HQAVGCFLTHCGWNSTMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVV  587

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN--VRNH  177
              EEIK+C+E VM+GG+KG+E+RRNA KW+ LA+E+   G S +TNLK F  +  +R H
Sbjct  588  EREEIKKCLEMVMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESLEIRTH  646



>ref|XP_003524181.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=488

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 129/171 (75%), Gaps = 6/171 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIA+ LL    PFLWVIR K   EE+EEEE+L   EELE +G +V WCSQ+EVL
Sbjct  315  SKRQTEEIARALLGCSFPFLWVIRVK--EEEKEEEEELCFREELEGKGKLVKWCSQVEVL  372

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+THCGWNST+ES+ SG P+VAFP W+DQ TNAKLI+DVWK GVRV    DG+
Sbjct  373  SHGSVGCFVTHCGWNSTMESLVSGVPMVAFPQWSDQKTNAKLIEDVWKIGVRVENDGDGI  432

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V  EEI++C+E VM  G    ELRRNA+KW+ LA EA +EGG S+ NLK+F
Sbjct  433  VEKEEIRKCVEEVMGSG----ELRRNAEKWKGLAREAAKEGGPSERNLKAF  479



>ref|NP_567471.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 sp|O23406.2|U75D1_ARATH RecName: Full=UDP-glycosyltransferase 75D1 [Arabidopsis thaliana]
 gb|AEE83624.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AHL38691.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=474

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 125/181 (69%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            SK Q  E+ K L++ +RPFLWVI DK    +E+E+EK        ++     G++V WC 
Sbjct  292  SKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSFREELDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP W DQ  NAKL++D WKTGVRV +
Sbjct  352  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMMNAKLLEDCWKTGVRVME  411

Query  365  G--EDG--VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               E+G  VV SEEI+RCIE VM+  DK EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  412  KKEEEGVVVVDSEEIRRCIEEVME--DKAEEFRGNATRWKDLAAEAVREGGSSFNHLKAF  469

Query  197  A  195
             
Sbjct  470  V  470



>ref|XP_006858828.1| hypothetical protein AMTR_s00066p00177320 [Amborella trichopoda]
 gb|ERN20295.1| hypothetical protein AMTR_s00066p00177320 [Amborella trichopoda]
Length=467

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 120/175 (69%), Gaps = 1/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  Q EE++  L   K  FLWV+R    NE+         ME   +QGL+VPWCSQ++VL
Sbjct  286  SAEQMEEVSGALRRSKWAFLWVVRPPSANEKAGNSLPEGFMEATSEQGLVVPWCSQLDVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H ++GCF+THCGWNSTLE +  G P+VA P W+DQ TN+KL+ DVWK GVRV   E  V
Sbjct  346  SHRAVGCFVTHCGWNSTLEGLTQGVPMVAIPQWSDQPTNSKLVSDVWKMGVRVEVDEKEV  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V S E++RCI  VM+ G++G ELRRNA++W+DLA EA  EGGSSD N+K F  N+
Sbjct  406  VRSGEVERCIREVME-GERGAELRRNAQRWKDLAWEAVAEGGSSDNNIKKFVANM  459



>gb|EYU31587.1| hypothetical protein MIMGU_mgv1a018203mg [Erythranthe guttata]
Length=465

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEIAKGLLE  RPFLWVIR   +N+ EEEEEKLSC++ELEK G  VPWCSQ+EVL 
Sbjct  291  KAQMEEIAKGLLESDRPFLWVIRINEDNKNEEEEEKLSCLDELEKIGKFVPWCSQLEVLT  350

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GCF++HCGWNSTLES+ SG PVVAFP WTDQGTNAKLI+DVWK+GVRV       V
Sbjct  351  HASVGCFVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGDGV  410

Query  347  G-SEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
              S EIKRCIE VMDGG +  ELR NA++W+ LA  A  E  SS  NLK+F
Sbjct  411  VESGEIKRCIEEVMDGGKRSRELRANAREWKSLARGAMDENRSSCKNLKAF  461



>ref|XP_003524180.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=460

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EE+A  LL+   PFLWV R+K       EEE+LSC EELE++G IV WCSQ+EVL
Sbjct  287  SKKQMEELALALLDCGSPFLWVSREK-------EEEELSCREELEQKGKIVNWCSQVEVL  339

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ--GED  357
             H S+GCF+THCGWNST+ES+ SG P+ AFP W +Q TNAKLI+DVWKTGVRV +   E+
Sbjct  340  SHRSVGCFVTHCGWNSTMESLASGVPMFAFPQWIEQKTNAKLIEDVWKTGVRVDKQVNEE  399

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREG-GSSDTNLKSFAGNVRN  180
            G+V  EEI +C+E  M  G KG+ELR NAK W+ LA EA +EG GSSD NL++F  ++  
Sbjct  400  GIVEKEEIIKCLEVAMGSGKKGQELRNNAKNWKGLAREAVKEGSGSSDKNLRAFLDDLCP  459

Query  179  H  177
            H
Sbjct  460  H  460



>ref|XP_004247896.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=476

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S    EEI +GLL+  RPFLWVIR+       +  + L+C +ELEK+G +V WCSQ EVL
Sbjct  306  SSQLMEEIGQGLLKCGRPFLWVIRE------GQNRKNLTCKDELEKKGKLVSWCSQAEVL  359

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            KHPS+GCF+THCGWNSTLESI SG PVVA P W DQ  NAKL+QDVWK GVRV  G+ G+
Sbjct  360  KHPSVGCFLTHCGWNSTLESIASGVPVVACPIWNDQLCNAKLVQDVWKNGVRVNIGDKGI  419

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
               +E +RCIE VM   ++G +LR N KKW +LA EA ++ GSS  NLK++A 
Sbjct  420  AERDEFERCIEIVMGNSEEGGKLRNNVKKWSNLAKEAMKKNGSSVMNLKTYAN  472



>gb|KJB28080.1| hypothetical protein B456_005G026200 [Gossypium raimondii]
Length=542

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 5/176 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-GLIVPWCSQIEV  534
            ++ Q EEIA+ L+  +RPFLWV+R++ +  EEE+EE      E  +Q G++VPWCSQ+EV
Sbjct  354  TEQQVEEIARALISSRRPFLWVVRNRKDGGEEEKEEDKLTCREELEQFGMVVPWCSQVEV  413

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPSLGCF+THCGWNS LES+ +G PVVAFP W    T AKLI+DVW  GVRV+  E+G
Sbjct  414  LFHPSLGCFVTHCGWNSRLESMVAGVPVVAFPQW----TTAKLIEDVWGNGVRVSANEEG  469

Query  353  VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +V  +EI RC++ VM   +KG E+++N +KW+ LA EA  EGGS D NLK+F  ++
Sbjct  470  MVERDEIVRCLDLVMGDDEKGMEVKKNVEKWKGLASEAAMEGGSMDMNLKAFVDDI  525



>ref|XP_004173025.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Cucumis sativus]
Length=214

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 3/171 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEI +GLL+    FLWV+R      E +    L  +E    +G +V WCSQ+EVL
Sbjct  43   SKAQLEEIGRGLLDYGGEFLWVMRKMSHGNERDMLSCLDELEA---KGKVVAWCSQLEVL  99

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +P++GCF+THCGWNS++ES+  G PVVAFP WTDQGTNAK+I+D+ K+GV++   E+G+
Sbjct  100  SNPAIGCFLTHCGWNSSMESLVCGVPVVAFPQWTDQGTNAKIIEDLSKSGVKLRVNENGI  159

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V   EIK+C+E VM  GD+GE  RRN KKW++LA +A  +GGSS  N+++F
Sbjct  160  VERGEIKKCLEMVMGKGDEGEGFRRNGKKWKELAKKAITKGGSSHLNIRNF  210



>ref|XP_010246537.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=472

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 7/179 (4%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ---GLIVPWCSQIEVL  531
            Q EE+A  L+E  RPFLWVIR      EE ++E+ + +  +E+Q   G+ VPWCSQ+EVL
Sbjct  289  QMEELASALIESGRPFLWVIRKNENASEETKKEEEAFLSGIEEQKREGMKVPWCSQVEVL  348

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE---  360
             HPS+GCF++HCGWNSTLES+ +G  VVAFP WTDQ TNA LI+ V  TGVRV   E   
Sbjct  349  SHPSVGCFLSHCGWNSTLESLVTGVRVVAFPLWTDQATNAMLIEGVCGTGVRVRAKEGEG  408

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVR  183
            DGVV  EEIKRC++ VM+ G+ GEE++RNA+KW++LA +A +E GSSD NL+ F   +R
Sbjct  409  DGVVEREEIKRCLDMVME-GENGEEMKRNARKWKELAKKAVKEDGSSDKNLRRFVEEMR  466



>emb|CDY47274.1| BnaA10g03720D [Brassica napus]
Length=472

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q  E+A+ L+E KRPFLWVI DK   E + E E  + +E++        + G+IV W
Sbjct  275  SKKQIGELARALIEGKRPFLWVITDKSNREAKLEGEDETEIEKIAGFRHELEEVGMIVSW  334

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF+THCGW+STLES+  G PVVAFP W+DQ TNAKL++++W TGVRV
Sbjct  335  CSQVEVLRHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEELWGTGVRV  394

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + E+G+V   EI+RC+E VMD  +K  ELR NA++WR LA+EA REGGS D N+++F  
Sbjct  395  RENEEGLVERGEIRRCLEAVMD--EKLVELRGNAEEWRRLAVEAGREGGSCDKNIEAFVD  452

Query  191  NV  186
             +
Sbjct  453  EI  454



>ref|XP_010246963.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=459

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            Q EEIA GLLE  RPFLWVIR      E  EE  L   EEL+++GLIVPWC+Q+EVL H 
Sbjct  285  QTEEIANGLLESGRPFLWVIRLN--RNETGEETMLGRWEELKERGLIVPWCTQVEVLSHS  342

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV-TQGEDGVVG  345
            S+GCF+THCGWNSTLES+ +G PVV  P  +DQ TN++LI+DVW+TGVR   + E+G+V 
Sbjct  343  SVGCFVTHCGWNSTLESLVAGVPVVTLPQISDQTTNSRLIEDVWRTGVRTKVKTEEGIVE  402

Query  344  SEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            S EIKRC++ VM G + G E+ RN KKW++++ EA ++GGSSD NLK F
Sbjct  403  SGEIKRCLDLVM-GSESGNEMTRNVKKWKEMSKEAVKDGGSSDKNLKRF  450



>ref|XP_004307485.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 123/168 (73%), Gaps = 1/168 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            Q EE+  GL++   P LWVIR K  NE ++E E L      ++QGLIVPWCSQ+EVL H 
Sbjct  283  QMEEMLHGLVDSGLPVLWVIR-KSGNEGDQETENLINNTLKKEQGLIVPWCSQVEVLSHK  341

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GC ++HCGWNST+ES+ +G PVV  PH+ DQ TNAKL++++W +GVR    E+GV+  
Sbjct  342  SVGCCVSHCGWNSTIESLAAGVPVVGCPHFADQTTNAKLVEELWGSGVRARANEEGVIER  401

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             EIKRC+E VM  G +GEE+RRNA+KW+ LAM+A  E GSSD NL++F
Sbjct  402  AEIKRCLEVVMGDGVRGEEMRRNAQKWKSLAMKAVNESGSSDDNLRNF  449



>gb|KFK39474.1| hypothetical protein AALP_AA3G248900 [Arabis alpina]
Length=475

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 125/180 (69%), Gaps = 10/180 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPenee--eeeeeklscmeelEKQGLIVPWCSQIE  537
            SK Q  E+ K L+E +RPFLWVI DK    +  EE +   S  EEL++ G++V WC Q  
Sbjct  294  SKKQLVELCKALIESRRPFLWVITDKSHRTKDDEEVDSIASFREELDEIGMVVSWCDQFR  353

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGED  357
            VLKH S+GCF+THCGWNSTLES+ SG PVVAFP W DQ TNAKL+ + WKTGVRV   ++
Sbjct  354  VLKHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMTNAKLLDESWKTGVRVIVKKE  413

Query  356  G------VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
                   VV SEEI+RCI+ VM+  +K E+ RRNA +WRDLA E  REGGSS  NLK+F 
Sbjct  414  EKEEEGCVVESEEIRRCIDEVME--EKAEDFRRNAARWRDLAAETIREGGSSFNNLKAFV  471



>ref|XP_002892298.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68557.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
Length=474

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DK   E + E E+ + +E++        + G++V W
Sbjct  271  SKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMMVSW  330

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQI+VL H ++GCF+THCGW+STLES+  G PVVAFP W+DQ TNAKL+++ WKTGVRV
Sbjct  331  CSQIDVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRV  390

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + E+G+V   EI+RC+E VM+  DK  ELR +AKKW+ LA+EA  EGGS D N+++F  
Sbjct  391  RENEEGLVERGEIRRCLEAVME--DKSVELRESAKKWKRLAIEAGGEGGSLDKNMEAFVE  448

Query  191  NV  186
             +
Sbjct  449  EI  450



>ref|XP_004253165.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=465

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 129/170 (76%), Gaps = 2/170 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q+ EI +GLLE +RPFLW  R K E+E +++  +   +   EK GLIVPWCSQ+EVL 
Sbjct  294  KEQEREILRGLLESERPFLWT-RRKGEDEGKKKNLECDDVITDEKLGLIVPWCSQMEVLC  352

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GCF+THCGWNSTLES+ SG P+V +P ++DQ TNAK++++VW  GVRV + E G+V
Sbjct  353  HKSIGCFVTHCGWNSTLESLVSGVPIVGYPQFSDQTTNAKMLEEVWGIGVRVKEVE-GLV  411

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
              EE+KRC+  +M+ G+KGEE+++N KKWR+LA++A + GGSS  N+K F
Sbjct  412  KKEELKRCLGILMENGEKGEEIKKNVKKWRNLALDALKIGGSSHDNIKKF  461



>ref|XP_007041389.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOX97220.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=459

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            + Q EEI  G++E    FLWVIR   E+ +EE  + +   +  E+QGLIVPWCSQ+EVL 
Sbjct  284  RNQMEEIFDGMVESGYTFLWVIRPS-EDGKEEGFKNVIKNKMKEEQGLIVPWCSQVEVLN  342

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNSTLE + +G P++A P + DQ TNAKL+ +VW+TGVRV   E   V
Sbjct  343  HRAVGCFVTHCGWNSTLEGLVAGVPMIALPQFADQMTNAKLVDEVWETGVRVKANEGAAV  402

Query  347  GS-EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               EEI+RC+E VM  G  GEELRRNAKKWR LA+EA  +GGSS  N K F
Sbjct  403  AEKEEIRRCLEMVMGNGQIGEELRRNAKKWRGLALEATSQGGSSANNFKVF  453



>ref|NP_172044.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 sp|Q9ZVY5.1|U75B2_ARATH RecName: Full=UDP-glycosyltransferase 75B2; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 2; AltName: Full=IAA-Glu synthase 2; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AAF79732.1|AC005106_13 T25N20.18 [Arabidopsis thaliana]
 gb|AEE27849.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 gb|AHL38969.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 131/182 (72%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E  RPFLWVI DK   E + E E+ + +E++        + G+IV W
Sbjct  275  SKKQIEELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMIVSW  334

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H ++GCF+THCGW+S+LES+  G PVVAFP W+DQ  NAKL++++WKTGVRV
Sbjct  335  CSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRV  394

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             +  +G+V   EI RC+E VM+   K  ELR NA+KW+ LA EA REGGSSD N+++F  
Sbjct  395  RENSEGLVERGEIMRCLEAVMEA--KSVELRENAEKWKRLATEAGREGGSSDKNVEAFVK  452

Query  191  NV  186
            ++
Sbjct  453  SL  454



>gb|EYU27003.1| hypothetical protein MIMGU_mgv1a024986mg [Erythranthe guttata]
Length=450

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 134/174 (77%), Gaps = 4/174 (2%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIR--DKPeneeeeeeeklscmeelEKQGLIVPWCSQIEV  534
            K Q EEIAKG+LE +RPFLWVIR  +  +NEEEEEEEKLSC+ ELEK G IVPWCSQ++V
Sbjct  273  KAQMEEIAKGILESERPFLWVIRINEDKKNEEEEEEEKLSCLYELEKIGKIVPWCSQLDV  332

Query  533  LKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDG  354
            L HPS+GCF++HCGWN TLES+ SG  VVAFP WTDQGTNAKLI+DVWK+GVRV     G
Sbjct  333  LTHPSIGCFVSHCGWNLTLESLSSGVLVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGG  392

Query  353  VVGSE--EIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
                E  EIKRCIE VMDGG K  ELR NA++W+ LA E   E GSS  NLK+F
Sbjct  393  DGVVESGEIKRCIEEVMDGGGKSWELRANAREWKSLAREDMDENGSSFNNLKAF  446



>ref|XP_007041390.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOX97221.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=460

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 118/171 (69%), Gaps = 1/171 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            + Q EEI  G++E    FLWVIR   + EEEE  E     +  E+QGLIVPWCSQ+EVL 
Sbjct  284  RNQMEEIFNGMVESGYTFLWVIRPSEDVEEEEGFENAIKDKIQEEQGLIVPWCSQVEVLN  343

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNSTLE + +G P++A P + DQ TNAKL+ +VW+TGVRV   E   V
Sbjct  344  HRAVGCFVTHCGWNSTLEGLVAGVPMIALPQFADQMTNAKLVDEVWETGVRVKVNEGTAV  403

Query  347  GS-EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               EEI+RC+E VM  G KGEEL R+ KKWR LA+EA  +GGSS  N K F
Sbjct  404  AEKEEIRRCLEMVMGNGQKGEELIRHVKKWRGLALEATNQGGSSANNFKVF  454



>ref|XP_006349902.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=459

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 120/175 (69%), Gaps = 16/175 (9%)
 Frame = -2

Query  695  EEIAKGLLEIKRPFLWVIRD-----KPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            EEIA GL+  KRPFLW+IR+     KP  +   +EE         + G  V WCSQ+EVL
Sbjct  292  EEIAHGLVLCKRPFLWIIREGANGEKPFEKLSCKEELE-------ELGKTVDWCSQVEVL  344

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            +HPSL CF+THCGWNS++ES+ SG PVVA P W DQ +NAKLIQDVWKTGVRV   ++GV
Sbjct  345  QHPSLACFLTHCGWNSSMESLASGVPVVACPLWIDQLSNAKLIQDVWKTGVRVNANDEGV  404

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +   E  RCIE V+  G    E+R+NAKKWRDLA +A +E GSS+ NLK++   +
Sbjct  405  IERNEFARCIEIVVGDG----EIRKNAKKWRDLAKDAMKENGSSNVNLKAYVNEI  455



>ref|XP_011043909.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=498

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 125/174 (72%), Gaps = 2/174 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+   RPFLW+IR    + ++ E +++   +  E++GLIVPWCSQ+EVL 
Sbjct  290  KDQMEEILLGLIGTCRPFLWIIRSS--DNKDTEFDEMVREKVNEEKGLIVPWCSQMEVLA  347

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GC + HCGWNST+ES+ +G PVV  P + DQ TNAK+I++VW+ GVR    E G+V
Sbjct  348  HESIGCCMMHCGWNSTMESLVAGIPVVGLPQFADQTTNAKMIEEVWRNGVRARVNEVGIV  407

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             +EEI+RC+E V+  G +G+E+R NAKKW  LA++A ++GGSS  NLK+F  NV
Sbjct  408  EAEEIRRCLEVVIGSGQRGQEIRSNAKKWSGLALDAVKDGGSSHNNLKAFLENV  461



>ref|XP_009119145.1| PREDICTED: UDP-glycosyltransferase 75B1 [Brassica rapa]
Length=472

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 132/182 (73%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q  E+A+ L+E KRPFLWVI DK   E + E E  + +E++        + G+IV W
Sbjct  275  SKKQIGELARALIEGKRPFLWVITDKSNREAKLEGEDETEIEKIAGFRHELEEVGMIVSW  334

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF+THCGW+STLES+  G PVVAFP W+DQ TNAKL++++W TGVRV
Sbjct  335  CSQVEVLRHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEELWGTGVRV  394

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + E+G+V   EI+RC+E VMD  +K  +LR NA++WR LA+EA REGGS D N+++F  
Sbjct  395  RENEEGLVERGEIRRCLEAVMD--EKLVKLRGNAEEWRRLAVEAGREGGSCDKNIEAFVD  452

Query  191  NV  186
             +
Sbjct  453  EI  454



>ref|XP_006414807.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
 gb|ESQ56260.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
Length=455

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-KQGLIVPWCSQIEVLKH  525
              E +  G+L   RPFLWV+R+K + ++++++ +   +   + + GL+V WCSQ  VL H
Sbjct  284  HMEALTSGVLATGRPFLWVVREKNQEDDKKKKNRFLDLIREDGRGGLVVGWCSQTAVLAH  343

Query  524  PSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVG  345
            PS+GCF+THCGWNSTLES+ SG PVVAFP + DQ T AKL++  W+ GVRV +GE+G V 
Sbjct  344  PSVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEATWRIGVRVKEGEEGHVE  403

Query  344  SEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             +E++RC+E VM GG++ EE+R NA +W+ LA++A  EGG SD NLK F
Sbjct  404  GDEVRRCLEKVMSGGEEAEEMRENAARWKTLAVDAAAEGGPSDLNLKRF  452



>ref|XP_006442000.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
 gb|ESR55240.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
Length=500

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 129/181 (71%), Gaps = 11/181 (6%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeee--------eklscmeelEKQGLIVPW  552
            K Q EEIA+GLL+   PFLWV R+    ++++++          +   EEL ++G+IVPW
Sbjct  306  KRQVEEIARGLLDSGHPFLWVSRENDNKDKDKDKDKDEGEDDVMMKYKEELNEKGMIVPW  365

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL H ++GCF+THCGW+S+LES+  G PVVAFP WTDQGTNAK+I D  KTGVRV
Sbjct  366  CSQVEVLSHEAVGCFVTHCGWSSSLESLVYGVPVVAFPQWTDQGTNAKIIVDFCKTGVRV  425

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
               E+G+V S+EI RC+E V+  GD   + RRN+ KW+DLA +A ++GGSS  NLK+F  
Sbjct  426  KANEEGIVESDEINRCLELVIGEGD---DFRRNSLKWKDLARDAVKQGGSSHKNLKAFVD  482

Query  191  N  189
            +
Sbjct  483  D  483



>ref|XP_007226459.1| hypothetical protein PRUPE_ppa024612mg [Prunus persica]
 gb|EMJ27658.1| hypothetical protein PRUPE_ppa024612mg [Prunus persica]
Length=471

 Score =   184 bits (466),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 121/175 (69%), Gaps = 1/175 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEK-QGLIVPWCSQIEVL  531
            + Q EE+  GL+E   P LWVIR   +  ++E +          K QGL+VPWCSQ+EVL
Sbjct  296  RDQIEEMLNGLVESGLPVLWVIRCAEKGGDQEAQIMKIKNRLKIKEQGLVVPWCSQMEVL  355

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H S+GCF+ HCGWNST+ES+ +G P+V F  ++DQ TNAKL+++VW  GVR  + E GV
Sbjct  356  GHKSVGCFVMHCGWNSTVESLVAGVPMVGFAQFSDQNTNAKLVEEVWGVGVRAKENEKGV  415

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +   EIKRC+E VM  G++GEE+RRN +KW+ LA EA +EGGSSD NL+ F G +
Sbjct  416  IEGAEIKRCLEIVMGDGERGEEIRRNCEKWKGLAKEAVKEGGSSDYNLRHFIGGL  470



>ref|XP_006858829.1| hypothetical protein AMTR_s00066p00177490 [Amborella trichopoda]
 gb|ERN20296.1| hypothetical protein AMTR_s00066p00177490 [Amborella trichopoda]
Length=463

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 117/175 (67%), Gaps = 1/175 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  + EEIA  L  IK PFLWV+R    +++         ++   +QGL+VPWC Q++VL
Sbjct  284  SAEKMEEIAGTLHSIKWPFLWVVRPPSAHQKGGNSLPEGFIDATSEQGLVVPWCPQLDVL  343

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H ++GCF+THCGWNSTLE +  G P+VA P  +DQ TN+K I DVWK GVR    E  V
Sbjct  344  AHRAVGCFVTHCGWNSTLEGLTQGVPMVAIPLRSDQPTNSKFISDVWKMGVRAEADEQEV  403

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V   E+KRCI  VM+ G++G ELRRNA++WRDLA+EA  EGGSSD N+K F   V
Sbjct  404  VRRGELKRCIREVME-GERGAELRRNAQRWRDLALEAVAEGGSSDNNIKEFVAKV  457



>ref|XP_006415092.1| hypothetical protein EUTSA_v10007589mg [Eutrema salsugineum]
 gb|ESQ33445.1| hypothetical protein EUTSA_v10007589mg [Eutrema salsugineum]
Length=458

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 130/182 (71%), Gaps = 9/182 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPenee-------eeeeeklscmeelEKQGLIVPW  552
            SK Q EE+A+ L++ KRPFLWVI +K   E         E E+      ELE+ G+IV W
Sbjct  269  SKKQIEELARALIDGKRPFLWVITEKSNREAKIEGEDETEIEKIAEFKHELEEVGMIVSW  328

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF+ HCGW+STLES+  G PVVAFP W+DQ TNAKL+++ WKTGV+V
Sbjct  329  CSQVEVLRHQAIGCFVNHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEEKWKTGVKV  388

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAG  192
             + E+G+V   EI+RC+E VM   +K EEL+ NA+KW+ LA+EA +E GSSD NL +F  
Sbjct  389  RENEEGLVERGEIRRCLEAVM--VEKAEELKVNAEKWKRLAVEAGKEEGSSDKNLVAFVD  446

Query  191  NV  186
            +V
Sbjct  447  SV  448



>emb|CDP21497.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = -2

Query  719  LNPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQI  540
            L+  K +K EI  GL E  R +L V+R    + E+EEE K        ++G+IVPWCSQ+
Sbjct  289  LSLKKEEKMEILHGLKEAGRSYLLVLR---ADNEQEEEVKAVVENISSEEGMIVPWCSQM  345

Query  539  EVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGE  360
            EVL H S+GCF+THCGWNSTLESI +G P+V  PH++DQ TNAKLI++VW  GVR    E
Sbjct  346  EVLCHRSIGCFLTHCGWNSTLESIVAGVPIVGCPHFSDQTTNAKLIEEVWGIGVRAKANE  405

Query  359  DGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            +GVV   EI+RC++ VM GG+KGEE+RRN+ KW  +A+EA +E GSS  N ++F  N+
Sbjct  406  EGVVERAEIRRCLDIVMGGGEKGEEIRRNSAKWSCMAIEAVKENGSSHNNFRNFLQNL  463



>emb|CAN70791.1| hypothetical protein VITISV_029654 [Vitis vinifera]
Length=429

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 9/180 (5%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWVIR       E E E+++     E+QGLIV WCSQ+EVL 
Sbjct  256  KKQMEEIFHGLMESHRPFLWVIRST-----ESEVEEMTNNSLSEEQGLIVQWCSQVEVLC  310

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNS +ES+ +G PVVA P ++DQ TNAKL++ VW TGV+    E+GVV
Sbjct  311  HQAVGCFLTHCGWNSIMESLVAGVPVVACPQFSDQTTNAKLVE-VWGTGVKARANEEGVV  369

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSS-DTNLKSFAGN--VRNH  177
              EEIK+C+E  M+ G KGEE+RRNA+KW+ LA+E  RE GSS + NLK F  +  +R H
Sbjct  370  EREEIKKCLEMAMEDGGKGEEMRRNAEKWKGLAVECMRECGSSGNINLKHFVESLEIRTH  429



>ref|XP_002305226.2| hypothetical protein POPTR_0004s08200g [Populus trichocarpa]
 gb|EEE85737.2| hypothetical protein POPTR_0004s08200g [Populus trichocarpa]
Length=496

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EE+  GL+   RPFLW+IR    + ++ E E++   +  +++GLIVPWCSQ+EVL 
Sbjct  290  KNQMEEMLLGLIGTCRPFLWIIRSS--DNKDTEFEEMVREKVNKEKGLIVPWCSQMEVLA  347

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H S+GC++ HCGWNST+ES+ +G PVV  P + DQ  NAK+I++VW  GVR    E G+V
Sbjct  348  HESIGCYMMHCGWNSTMESLVAGIPVVGLPQFADQTINAKMIEEVWGNGVRARVNEGGIV  407

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGN  189
             +EEI+RC+E V+  G+KG+E+R NAKKW  LA++A ++GGSS  NLK+F  N
Sbjct  408  EAEEIRRCLEVVIGSGEKGQEIRSNAKKWSGLALDAVKDGGSSHNNLKAFLEN  460



>ref|XP_002263497.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=448

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 127/180 (71%), Gaps = 9/180 (5%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWVIR       E E E+++     E+QGLIV WCSQ+EVL 
Sbjct  275  KKQMEEIFHGLMESHRPFLWVIRST-----ESEVEEMTNNSMSEEQGLIVQWCSQVEVLC  329

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNS +ES+ +G PVVA P ++DQ TNAKL++ VW TGV+    E+GVV
Sbjct  330  HQAVGCFLTHCGWNSIMESLVAGVPVVACPQFSDQTTNAKLVE-VWGTGVKARANEEGVV  388

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSS-DTNLKSFAGN--VRNH  177
              EEIK+C+E  M+ G KGEE+RRNA+KW+ LA+E  RE GSS + NLK F  +  +R H
Sbjct  389  EREEIKKCLEMAMEDGGKGEEMRRNAEKWKGLAVECMRECGSSGNINLKHFVESLEIRTH  448



>ref|XP_002892295.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68554.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 130/179 (73%), Gaps = 9/179 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDK-------PeneeeeeeeklscmeelEKQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI +K          EE E E+  S   ELE+ G+IV W
Sbjct  275  SKKQIEELARALIEGKRPFLWVITNKLNREAKIEGEEETEIEKIASFRHELEEVGMIVSW  334

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQIEVL+H ++ CF+THCGW+S+LES+  G PVVAFP W+DQ  NAKL++ +WKTGVRV
Sbjct  335  CSQIEVLRHRAVSCFVTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEKIWKTGVRV  394

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             +  +G+V   EIKRC+E VM+  +K EELR +A+KW+ LA+EA  EGGSSD N+++F 
Sbjct  395  RENSEGLVERGEIKRCLEAVME--EKSEELRESAEKWKRLAIEAGGEGGSSDKNVEAFV  451



>gb|ABQ02259.1| truncated O-glucosyltransferase 4 [Vitis labrusca]
Length=431

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWV R       E E E+++     E+QGLIV WCSQ+EVL 
Sbjct  258  KKQMEEIFHGLMESHRPFLWVTRST-----ESEVEEMTNNSLSEEQGLIVQWCSQVEVLC  312

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNS +ES+ +G PVVA P ++DQ TNA L+ +VW TGV+    E+GVV
Sbjct  313  HQAVGCFLTHCGWNSIMESLVAGVPVVACPQFSDQTTNAMLV-EVWGTGVKARTNEEGVV  371

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSS-DTNLKSFAGN--VRNH  177
              EEIK+C+E  M+GG KGEE+RRNA+KW+ LA+E  RE GSS + NLK F  +  VR H
Sbjct  372  EREEIKKCLEMAMEGGGKGEEMRRNAEKWKGLAVECMRECGSSANINLKHFVESLEVRTH  431



>emb|CDY71964.1| BnaAnng39390D [Brassica napus]
Length=470

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 128/179 (72%), Gaps = 9/179 (5%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelE-------KQGLIVPW  552
            SK Q EE+A+ L+E KRPFLWVI DK   E + + E    +E++        + G+IV W
Sbjct  270  SKKQIEELARALIECKRPFLWVITDKVNREAKIKGENEREIEKIAGLRHDLDQVGMIVSW  329

Query  551  CSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV  372
            CSQ+EVL+H ++GCF++HCGW+STLES+  G PVVAFP W+DQ TNAKL++D+W+TGVRV
Sbjct  330  CSQVEVLRHRAVGCFLSHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEDLWRTGVRV  389

Query  371  TQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
             + ED +V   EI+RC+E VM+  +K  E R N + W+ LA+EA RE GSSD N+++F 
Sbjct  390  RENEDRLVERGEIRRCLEAVME--EKSVEQRENGEAWKRLAVEAGRERGSSDKNMEAFV  446



>ref|XP_008458151.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Cucumis melo]
Length=465

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 128/171 (75%), Gaps = 3/171 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEI + LL+    FLWV+R         E++ LSC++ELE +G +V WCSQ+EVL
Sbjct  294  SKAQLEEIGRALLDYGGEFLWVMRK---MAHGNEKDMLSCLDELEAKGKVVAWCSQLEVL  350

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +P++GCF+THCGWNS++ES+  G PVVAFP WTDQGTNAK+I+D+ K+GV++   E+G+
Sbjct  351  SNPAIGCFLTHCGWNSSMESLVCGVPVVAFPQWTDQGTNAKIIEDLSKSGVKLRVNENGI  410

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V   EIK+C+E VM  GDKGE  RRNAKKW++LA +A  +GGSS  N+++F
Sbjct  411  VERGEIKKCLEMVMGEGDKGEGFRRNAKKWKELANKATTKGGSSYVNIRNF  461



>dbj|BAE98677.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=456

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
              E +  G+L   RPFLW++R+K  N EE+++ +   +     +GL+V WCSQ  VL H 
Sbjct  286  HMEALTHGVLATNRPFLWIVREK--NPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHC  343

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            ++GCF+THCGWNSTLES+ SG PVVAFP + DQ T AKL++D W+ GV+V  GE+G V  
Sbjct  344  AVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDG  403

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            EEI+RC+E VM GG++ EE+R NA+KW+ +A++A  EGG SD NLK F
Sbjct  404  EEIRRCLEKVMSGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGF  451



>ref|NP_193146.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 sp|Q0WW21.2|U75C1_ARATH RecName: Full=UDP-glycosyltransferase 75C1; AltName: Full=Anthocyanin 
5-O-glucosyltransferase; AltName: Full=UDP glucose:anthocyanin 
5-O-glucosyltransferase [Arabidopsis thaliana]
 emb|CAB10189.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78452.1| glucosyltransferase like protein [Arabidopsis thaliana]
 gb|AAL32667.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM47973.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM91686.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEE83370.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38699.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
              E +  G+L   RPFLW++R+K  N EE+++ +   +     +GL+V WCSQ  VL H 
Sbjct  286  HMEALTHGVLATNRPFLWIVREK--NPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHC  343

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            ++GCF+THCGWNSTLES+ SG PVVAFP + DQ T AKL++D W+ GV+V  GE+G V  
Sbjct  344  AVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDG  403

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            EEI+RC+E VM GG++ EE+R NA+KW+ +A++A  EGG SD NLK F
Sbjct  404  EEIRRCLEKVMSGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGF  451



>gb|AAL69494.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=466

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
              E +  G+L   RPFLW++R+K  N EE+++ +   +     +GL+V WCSQ  VL H 
Sbjct  296  HMEALTHGVLATNRPFLWIVREK--NPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHC  353

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            ++GCF+THCGWNSTLES+ SG PVVAFP + DQ T AKL++D W+ GV+V  GE+G V  
Sbjct  354  AVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDG  413

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            EEI+RC+E VM GG++ EE+R NA+KW+ +A++A  EGG SD NLK F
Sbjct  414  EEIRRCLEKVMSGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGF  461



>gb|ABQ02256.1| O-glucosyltransferase 1 [Vitis labrusca]
 gb|ADA72017.1| O-glucosyltransferase [Vitis amurensis]
Length=448

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = -2

Query  707  KTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLK  528
            K Q EEI  GL+E  RPFLWV R       E E E+++     E+QGLIV WCSQ+EVL 
Sbjct  275  KKQMEEIFHGLMESHRPFLWVTRST-----ESEVEEMTNNSLSEEQGLIVQWCSQVEVLC  329

Query  527  HPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVV  348
            H ++GCF+THCGWNS +ES+ +G PVVA P ++DQ TNA L+ +VW TGV+    E+GVV
Sbjct  330  HQAVGCFLTHCGWNSIMESLVAGVPVVACPQFSDQTTNAMLV-EVWGTGVKARTNEEGVV  388

Query  347  GSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSS-DTNLKSFAGN--VRNH  177
              EEIK+C+E  M+GG KGEE+RRNA+KW+ LA+E  RE GSS + NLK F  +  VR H
Sbjct  389  EREEIKKCLEMAMEGGGKGEEMRRNAEKWKGLAVECMRECGSSANINLKHFVESLEVRTH  448



>gb|KCW57191.1| hypothetical protein EUGRSUZ_H00007 [Eucalyptus grandis]
Length=426

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  575  KQGLIVPWCSQIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQD  396
            KQG+IVPWCSQ+EVL HPS+GCF+THCGWNSTLES+  G P+VAFP W DQ TNA LIQD
Sbjct  294  KQGMIVPWCSQVEVLSHPSVGCFVTHCGWNSTLESVVCGVPMVAFPLWADQLTNAMLIQD  353

Query  395  VWKTGVRVTQGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSD  216
            VWK GVRV+  E GVV  EE+ RC+E V+ GG++ E +R NAK+ +D A EA++EGG +D
Sbjct  354  VWKVGVRVSGNERGVVEGEELTRCLEMVLGGGERSEGMRGNAKRLKDAAREASKEGGCAD  413

Query  215  TNLKSF  198
             NLK+ 
Sbjct  414  KNLKAL  419



>ref|XP_010101353.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB88300.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 122/173 (71%), Gaps = 6/173 (3%)
 Frame = -2

Query  716  NPSKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIE  537
            N S  Q EE+A GL      FLWV+R       EE +   +  +E  + GLIV WC+Q+E
Sbjct  284  NLSVKQMEELALGLKATNLFFLWVVR-----ASEEPKLPHNFAQETREFGLIVKWCAQME  338

Query  536  VLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGED  357
            VL HPS+GCF THCGWNST+E++  G P+V  P WTDQ T+AKLI+ +WK GVRV  GED
Sbjct  339  VLSHPSVGCFFTHCGWNSTVEALSLGVPMVGMPQWTDQPTDAKLIEHLWKVGVRVKVGED  398

Query  356  GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            G+VG +EI+ CI  V++ GD+G E+R+NAKKWR+LA++A  +GGSSD N++ F
Sbjct  399  GIVGRKEIEHCIWQVLE-GDRGTEIRKNAKKWRNLALQAISDGGSSDKNIREF  450



>ref|XP_006858830.1| hypothetical protein AMTR_s00066p00177790 [Amborella trichopoda]
 gb|ERN20297.1| hypothetical protein AMTR_s00066p00177790 [Amborella trichopoda]
Length=467

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 118/177 (67%), Gaps = 1/177 (1%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S  Q EE++  L   K PFLWV+R    NE+         +E   +QGL+VPWC Q++VL
Sbjct  286  SAEQMEEVSGALRWCKWPFLWVVRPPSANEKGGNSLPEGFIEATSEQGLVVPWCPQLDVL  345

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H ++GCF+THCGWNSTLE +  G P+VA P W+DQ TN+KL+ DVWK GVRV   E  V
Sbjct  346  AHRAVGCFVTHCGWNSTLEGLTQGVPMVAIPQWSDQPTNSKLVSDVWKMGVRVEVDEKEV  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNVRN  180
            V   E++RCI  VM+ G++G ELRRNA++WRD A EA  EGGSSD N+K F   + +
Sbjct  406  VRRGEVERCIREVME-GERGAELRRNARRWRDFAWEAVAEGGSSDKNIKQFVAKLSS  461



>ref|XP_009108098.1| PREDICTED: UDP-glycosyltransferase 75C1 [Brassica rapa]
Length=454

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
              E +  G+L   RPFLWV+++    + EE++     +   + +GL+V WCSQ  VL HP
Sbjct  287  HMEALTSGVLATGRPFLWVVKE---TKAEEKKSCFVDLIRGDDKGLVVGWCSQTAVLAHP  343

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GCF+THCGWNSTLES+ +G PVVAFP + DQ T AKL++DVW  GVRV +GE+G V  
Sbjct  344  SVGCFVTHCGWNSTLESLENGVPVVAFPQFADQCTTAKLVEDVWGIGVRVKEGEEGHVDG  403

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +E++RC+E VM  G+  EE+RRNA +W+ LA++A  EGG SD NLK F
Sbjct  404  DELRRCLEKVMGDGEDAEEMRRNAARWKTLAVDAAAEGGPSDLNLKGF  451



>gb|ADG45874.1| UDP-glucosyltransferase [Isatis tinctoria]
Length=476

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 120/180 (67%), Gaps = 10/180 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            S  Q  E+   L++ +RPFLWVI DK    +E+ EE         ++     G++V WC 
Sbjct  295  STRQLVELCMALIQSRRPFLWVITDKTYRIKEDGEETEEESIRSFREELDEIGMVVSWCD  354

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVT-  369
            Q  VLKH S+GC++THCGWNS+LES+ +G PVVAFP WTDQ TNAKL++D W+TGVRV  
Sbjct  355  QFSVLKHRSIGCYMTHCGWNSSLESLVAGVPVVAFPQWTDQTTNAKLLEDCWRTGVRVME  414

Query  368  --QGEDGVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFA  195
              + E+ VV S EI+RCIE VMD   K EE R NA +WRDLA E  REGGSS  +LK+F 
Sbjct  415  KKEDEEVVVESGEIRRCIEEVMD--KKLEEFRENAARWRDLAAETVREGGSSFNHLKAFV  472



>emb|CDY27124.1| BnaA08g07620D [Brassica napus]
Length=454

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
              E +  G+L   RPFLWV+++    + EE++     +   + +GL+V WCSQ  VL HP
Sbjct  287  HMEALTSGVLATGRPFLWVVKE---TKAEEKKSCFVDLIRGDDKGLVVGWCSQTAVLAHP  343

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            S+GCF+THCGWNSTLES+ +G PVVAFP + DQ T AKL++DVW  GVRV +GE+G V  
Sbjct  344  SVGCFVTHCGWNSTLESLENGVPVVAFPQFADQCTTAKLVEDVWGIGVRVKEGEEGHVDG  403

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +E++RC+E VM  G+  EE+RRNA +W+ LA++A  EGG SD NLK F
Sbjct  404  DELRRCLEKVMGDGEDAEEMRRNAARWKTLAVDAAAEGGPSDLNLKGF  451



>dbj|BAP90370.1| UDP-glycose: glycosyltransferase UGT75R1 [Fagopyrum esculentum]
Length=471

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 128/175 (73%), Gaps = 7/175 (4%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            S+ QKEEIA  LLE +RPFLWV+R K  +E +++E   S   ELEK G+IV WCSQ+EVL
Sbjct  289  SREQKEEIAAALLECRRPFLWVMR-KDSDENKDDETVTSRWVELEKLGMIVSWCSQLEVL  347

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             H + GCF+THCGWNSTLES+ +G PVVA P WTDQ TNAK+++ +W TGVRV   +  V
Sbjct  348  SHRATGCFVTHCGWNSTLESLSTGVPVVAVPQWTDQPTNAKMLESMWGTGVRV--ADKKV  405

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V   E+ RC+ETVM+     E++R +A +WR+LA+EA ++GGSSD+N++ F   V
Sbjct  406  VSRNELTRCVETVME----SEKVRADAMRWRELAIEAIKDGGSSDSNIRVFVDEV  456



>sp|B2NID7.1|5GT_GENTR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=Anthocyanin 5-O-glucosyltransferase; Short=Gt5GT7 
[Gentiana triflora]
 dbj|BAG32255.1| anthocyanin 5-O-glucosyltransferase [Gentiana triflora]
Length=504

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 112/171 (65%), Gaps = 0/171 (0%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEIAKGLL    PFLWVI    E E +E  E+    E  EK  +IVPWC+Q +VL
Sbjct  322  SKAQTEEIAKGLLASGHPFLWVITSNEEEEGDEIMEQNLVEEIQEKGMMIVPWCAQFQVL  381

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
            KHPS+GCF+THCGWNSTLESI  G P++ FP   DQ T +KLI  VWK GVRV    DG+
Sbjct  382  KHPSVGCFMTHCGWNSTLESIACGVPMIGFPKMFDQPTISKLIAHVWKVGVRVNAAVDGI  441

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            VG E IK CIE+VMD    G EL  N +K+  L  +A  EGGSS  N K+F
Sbjct  442  VGQEVIKNCIESVMDPDGIGRELNENVRKFMSLGKKAAEEGGSSHNNFKAF  492



>ref|XP_002868314.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44573.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
              E + +G+L   RPFLW++R+K  N EE+++ +   +     +GL+V WCSQ  VL H 
Sbjct  283  HMEALTQGVLATNRPFLWIVREK--NPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHC  340

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            ++GCF+THCGWNSTLES+ SG PVVAFP + DQ T AKL++D W+ GV+V  GE+G V  
Sbjct  341  AVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGGVDG  400

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            +EI+RC+E VM GG++ EE+R NA KW+ +A++A  EGG SD NLK F
Sbjct  401  DEIRRCLEKVMSGGEEAEEMRENAAKWKAMAVDAAAEGGPSDLNLKGF  448



>ref|XP_010434494.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (70%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            +K Q  E+ K L++ +RPFLWVI DK    + +E+EK        ++     G++V WC 
Sbjct  292  TKKQLVELCKALIQSRRPFLWVITDKSYKSKGDEQEKEEDCISSFREELDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  VL H S+GCF+THCGWNSTLES+ SG PVVAFP  TDQ TNAKL++D WKTGVRV +
Sbjct  352  QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQCTDQMTNAKLLEDCWKTGVRVME  411

Query  365  --GEDG--VVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
               E+G  VV SEEI+RCI+ V++  +K EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  412  KKHEEGAVVVESEEIRRCIKEVIE--EKAEEFRGNAARWKDLAAEAVREGGSSFNHLKAF  469

Query  197  A  195
            A
Sbjct  470  A  470



>ref|XP_010434953.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 125/181 (69%), Gaps = 11/181 (6%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQ-----GLIVPWCS  546
            +K Q  E+ K L++ ++PFLWVI +K    +E+E+EK        ++     G++V WC 
Sbjct  292  TKKQLVELCKALIQCRKPFLWVITNKSYKSKEDEQEKEEDCISSFREELDEIGMVVSWCD  351

Query  545  QIEVLKHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQ  366
            Q  V  H S+GCF+THCGWNSTLES+ SG PVVAFP  TDQ TNAKL++D WKTGVRV +
Sbjct  352  QFRVFNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQCTDQMTNAKLLEDCWKTGVRVIE  411

Query  365  GED----GVVGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             +D     VV SEEI+RCI+ VM+  +K EE R NA +W+DLA EA REGGSS  +LK+F
Sbjct  412  KKDEEGAMVVESEEIRRCIKEVME--EKAEEFRGNAARWKDLAAEAVREGGSSFNHLKAF  469

Query  197  A  195
            A
Sbjct  470  A  470



>ref|XP_004140483.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 ref|XP_004162374.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 gb|KGN46580.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Cucumis sativus]
Length=467

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK QKEEIA+GL   KRPFLWVIR+      EEEE+ LS  E+LE QG IV WC+Q+EVL
Sbjct  296  SKQQKEEIARGLSLTKRPFLWVIRN-----IEEEEDFLSFKEKLETQGKIVSWCAQLEVL  350

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
              P+ GCF+THCGWNS LES+  G P VAFP W+DQ TN+K+I+D+ +TGVR+   E+GV
Sbjct  351  SSPATGCFLTHCGWNSCLESLACGVPNVAFPQWSDQATNSKIIEDLSETGVRLEVEEEGV  410

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
            V  EEI+RC+E VM    KGEE+RRNA KW+ LA EA  EGGSS  NLK+F  +V
Sbjct  411  VKGEEIERCLELVMGDSKKGEEIRRNALKWKKLAKEAASEGGSSFANLKAFVDHV  465



>gb|KGN45711.1| hypothetical protein Csa_6G007450 [Cucumis sativus]
Length=465

 Score =   180 bits (457),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = -2

Query  710  SKTQKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVL  531
            SK Q EEI +GLL+    FLWV+R         E + LSC++ELE +G +V WCSQ+EVL
Sbjct  294  SKAQLEEIGRGLLDYGGEFLWVMRK---MSHGNERDMLSCLDELEAKGKVVAWCSQLEVL  350

Query  530  KHPSLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGV  351
             +P++GCF+THCGWNS++ES+  G PVVAFP WTDQGTNAK+I+D+ K+GV++   E+G+
Sbjct  351  SNPAIGCFLTHCGWNSSMESLVCGVPVVAFPQWTDQGTNAKIIEDLSKSGVKLRVNENGI  410

Query  350  VGSEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
            V   EIK+C+E VM  GD+GE  RRN KKW++LA +A  +GGSS  N+++F
Sbjct  411  VERGEIKKCLEMVMGKGDEGEGFRRNGKKWKELAKKAITKGGSSHLNIRNF  461



>ref|XP_004239848.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=458

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 121/169 (72%), Gaps = 5/169 (3%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            QKEE+ +GLLE + PFLWVIR      +E++++K   +  L  +G+IVPWCSQ+EVL H 
Sbjct  290  QKEEVLQGLLESEMPFLWVIRSS----KEDDKKKNDEIYGLNGKGMIVPWCSQMEVLFHK  345

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRV-TQGEDGVVG  345
            S+GCF++HCGWNSTLES  +G P++  P   DQ TN K++++VW TGVR   + E G+V 
Sbjct  346  SIGCFVSHCGWNSTLESTIAGVPLIGVPQLADQFTNIKMVEEVWGTGVRARVEEEGGIVK  405

Query  344  SEEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSF  198
             EE+KRC+  +M  G+KG E+RRN KK+RDLAMEA + GGSS  NL  F
Sbjct  406  REELKRCLGVLMGDGEKGNEIRRNVKKYRDLAMEAVKVGGSSHNNLNKF  454



>ref|XP_006858837.1| hypothetical protein AMTR_s00066p00179570 [Amborella trichopoda]
 gb|ERN20304.1| hypothetical protein AMTR_s00066p00179570 [Amborella trichopoda]
Length=463

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 112/172 (65%), Gaps = 1/172 (1%)
 Frame = -2

Query  701  QKEEIAKGLLEIKRPFLWVIRDKPeneeeeeeeklscmeelEKQGLIVPWCSQIEVLKHP  522
            Q EEI   L  IK PFLWV+R     E+         ++   +QGL+VPWC Q+EVL H 
Sbjct  290  QMEEIGGALRSIKWPFLWVVRPPYAYEQGRNSLPDGFLDATSEQGLVVPWCPQLEVLAHR  349

Query  521  SLGCFITHCGWNSTLESICSGTPVVAFPHWTDQGTNAKLIQDVWKTGVRVTQGEDGVVGS  342
            ++GCF++HCGWNSTLE+I  G P+VA P W+DQ TNAK I DVWK G+RV   E  VV S
Sbjct  350  AIGCFVSHCGWNSTLEAISQGVPMVAVPQWSDQPTNAKFISDVWKMGIRVEVDEKEVVRS  409

Query  341  EEIKRCIETVMDGGDKGEELRRNAKKWRDLAMEANREGGSSDTNLKSFAGNV  186
             E++RCI  VMD G+ G ELR N ++W+ LA  A  +GGSSD N+K F   V
Sbjct  410  GELERCIREVMD-GETGAELRENGQRWKKLARAAVADGGSSDNNIKEFVAMV  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425