BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044I16

Length=698
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    184   6e-52   
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    184   5e-51   Nicotiana sylvestris
ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    183   9e-51   Nicotiana tomentosiformis
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    177   6e-49   Solanum lycopersicum
gb|KDP47121.1|  hypothetical protein JCGZ_22117                         177   2e-48   Jatropha curcas
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                171   4e-46   Erythranthe guttata [common monkey flower]
emb|CDP02523.1|  unnamed protein product                                170   5e-46   Coffea canephora [robusta coffee]
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...    169   7e-46   Solanum tuberosum [potatoes]
gb|KDP47120.1|  hypothetical protein JCGZ_22116                         168   2e-45   Jatropha curcas
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             168   3e-45   Eutrema salsugineum [saltwater cress]
gb|KJB77660.1|  hypothetical protein B456_012G149500                    167   3e-45   Gossypium raimondii
gb|KCW54907.1|  hypothetical protein EUGRSUZ_I00886                     162   3e-45   Eucalyptus grandis [rose gum]
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...    167   7e-45   Eucalyptus grandis [rose gum]
dbj|BAH19934.1|  AT1G49750                                              162   8e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   167   9e-45   Citrus sinensis [apfelsine]
emb|CDX92324.1|  BnaA05g20830D                                          166   9e-45   
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       166   1e-44   Brassica rapa
gb|AEI72268.1|  leucine-rich repeat family protein                      166   1e-44   Citrus trifoliata [hardy orange]
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             166   2e-44   Citrus clementina [clementine]
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...    163   3e-44   
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...    165   3e-44   Solanum lycopersicum
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    165   3e-44   Sesamum indicum [beniseed]
emb|CDX99236.1|  BnaC05g33510D                                          164   9e-44   
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...    163   1e-43   
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg             164   2e-43   Eutrema salsugineum [saltwater cress]
ref|NP_188563.1|  leucine-rich repeat-containing protein                163   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KGN43906.1|  hypothetical protein Csa_7G073420                       163   2e-43   Cucumis sativus [cucumbers]
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...    162   3e-43   Tarenaya hassleriana [spider flower]
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...    163   4e-43   Ricinus communis
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein              162   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885307.1|  leucine-rich repeat family protein                 161   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_007157235.1|  hypothetical protein PHAVU_002G054000g             160   1e-42   Phaseolus vulgaris [French bean]
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...    161   1e-42   Vitis vinifera
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    160   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...    160   3e-42   
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...    159   4e-42   Sesamum indicum [beniseed]
emb|CDY43618.1|  BnaC09g17570D                                          153   5e-42   Brassica napus [oilseed rape]
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...    158   6e-42   Populus euphratica
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg             159   9e-42   Capsella rubella
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107             159   9e-42   
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...    157   1e-41   Populus euphratica
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...    158   1e-41   Nelumbo nucifera [Indian lotus]
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                    157   2e-41   Arabis alpina [alpine rockcress]
gb|AIE39583.1|  LRR receptor-like protein kinase                        149   3e-41   Humulus lupulus [common hop]
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...    157   3e-41   Nicotiana sylvestris
ref|XP_011467740.1|  PREDICTED: uncharacterized protein At4g06744       157   3e-41   Fragaria vesca subsp. vesca
gb|KJB12258.1|  hypothetical protein B456_002G008600                    157   3e-41   Gossypium raimondii
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...    156   5e-41   Nicotiana tomentosiformis
ref|XP_010691719.1|  PREDICTED: uncharacterized protein At4g06744...    155   1e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                    156   1e-40   Arabis alpina [alpine rockcress]
emb|CDY20865.1|  BnaC05g26270D                                          155   2e-40   Brassica napus [oilseed rape]
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...    155   2e-40   Brassica rapa
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g             154   3e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...    154   4e-40   
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg             154   6e-40   Prunus persica
emb|CDY29337.1|  BnaA05g16040D                                          154   6e-40   Brassica napus [oilseed rape]
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...    153   7e-40   Glycine max [soybeans]
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...    154   8e-40   Nelumbo nucifera [Indian lotus]
gb|KJB32334.1|  hypothetical protein B456_005G236100                    152   8e-40   Gossypium raimondii
gb|KHN05611.1|  Hypothetical protein glysoja_047056                     152   8e-40   Glycine soja [wild soybean]
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative       153   1e-39   
ref|XP_003607916.1|  Receptor protein kinase                            150   2e-39   
gb|KDP41695.1|  hypothetical protein JCGZ_16102                         151   3e-39   Jatropha curcas
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...    151   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg             150   8e-39   Capsella rubella
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...    150   1e-38   Camelina sativa [gold-of-pleasure]
gb|AES90113.2|  Serine/Threonine kinase, plant-type protein, puta...    150   1e-38   Medicago truncatula
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...    150   1e-38   Camelina sativa [gold-of-pleasure]
emb|CDP01296.1|  unnamed protein product                                149   2e-38   Coffea canephora [robusta coffee]
gb|KDP24991.1|  hypothetical protein JCGZ_23974                         148   2e-38   Jatropha curcas
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...    148   2e-38   Fragaria vesca subsp. vesca
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...    148   3e-38   Prunus mume [ume]
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...    149   3e-38   Nelumbo nucifera [Indian lotus]
gb|KDP24986.1|  hypothetical protein JCGZ_23969                         148   4e-38   Jatropha curcas
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg             148   4e-38   Citrus clementina [clementine]
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg             148   5e-38   
ref|XP_007017157.1|  Leucine-rich repeat family protein                 147   6e-38   
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...    147   6e-38   
emb|CDO97205.1|  unnamed protein product                                147   6e-38   Coffea canephora [robusta coffee]
gb|KHN30415.1|  Hypothetical protein glysoja_033153                     146   7e-38   Glycine soja [wild soybean]
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...    147   8e-38   
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...    147   9e-38   Cucumis melo [Oriental melon]
ref|XP_003516778.2|  PREDICTED: uncharacterized protein At4g06744...    147   1e-37   Glycine max [soybeans]
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...    147   1e-37   Populus euphratica
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...    147   1e-37   
gb|KGN43905.1|  hypothetical protein Csa_7G073410                       147   1e-37   Cucumis sativus [cucumbers]
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...    146   2e-37   Ricinus communis
ref|XP_010107857.1|  Uncharacterized protein L484_027444                146   2e-37   Morus notabilis
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg             146   2e-37   
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...    146   2e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004505256.1|  PREDICTED: uncharacterized protein At4g06744...    146   3e-37   Cicer arietinum [garbanzo]
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...    145   3e-37   Cucumis sativus [cucumbers]
emb|CDY32853.1|  BnaC08g02750D                                          146   3e-37   Brassica napus [oilseed rape]
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...    145   4e-37   Prunus mume [ume]
gb|KJB14612.1|  hypothetical protein B456_002G134000                    145   6e-37   Gossypium raimondii
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                   144   7e-37   Citrus sinensis [apfelsine]
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744       145   7e-37   Brassica rapa
gb|KJB14611.1|  hypothetical protein B456_002G133900                    144   1e-36   Gossypium raimondii
emb|CDY16514.1|  BnaA08g02530D                                          144   1e-36   Brassica napus [oilseed rape]
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...    143   2e-36   Glycine max [soybeans]
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...    143   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...    142   4e-36   Nicotiana tomentosiformis
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...    142   5e-36   
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...    142   7e-36   Populus euphratica
ref|XP_010094651.1|  Uncharacterized protein L484_008883                142   7e-36   Morus notabilis
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...    142   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g             142   8e-36   
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...    141   1e-35   Sesamum indicum [beniseed]
gb|ADN33724.1|  LRR-family protein                                      141   1e-35   Cucumis melo subsp. melo
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744       141   1e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...    142   1e-35   
gb|KHN12808.1|  Hypothetical protein glysoja_008771                     136   2e-35   Glycine soja [wild soybean]
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g             140   3e-35   Phaseolus vulgaris [French bean]
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...    140   3e-35   Prunus mume [ume]
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...    139   5e-35   Solanum tuberosum [potatoes]
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...    139   5e-35   Populus euphratica
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g             139   6e-35   Phaseolus vulgaris [French bean]
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...    139   7e-35   
gb|KDP41694.1|  hypothetical protein JCGZ_16101                         139   7e-35   Jatropha curcas
gb|KHN22492.1|  Hypothetical protein glysoja_041167                     138   1e-34   Glycine soja [wild soybean]
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...    138   1e-34   Solanum tuberosum [potatoes]
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Vitis vinifera
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Vitis vinifera
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg             137   1e-34   
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...    138   1e-34   Glycine max [soybeans]
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g             138   1e-34   
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...    138   1e-34   Medicago truncatula
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...    139   1e-34   Glycine max [soybeans]
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...    138   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN43047.1|  Hypothetical protein glysoja_007577                     139   1e-34   Glycine soja [wild soybean]
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                   137   2e-34   Citrus sinensis [apfelsine]
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...    137   2e-34   
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...    138   3e-34   
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...    137   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010094650.1|  Uncharacterized protein L484_008882                137   3e-34   Morus notabilis
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744       137   3e-34   Solanum lycopersicum
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...    137   3e-34   Nicotiana sylvestris
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...    137   4e-34   Citrus sinensis [apfelsine]
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...    137   4e-34   
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...    137   6e-34   Glycine max [soybeans]
ref|XP_004238131.2|  PREDICTED: probable inactive receptor kinase...    140   6e-34   
gb|EPS58531.1|  hypothetical protein M569_16282                         135   6e-34   Genlisea aurea
ref|XP_007017156.1|  LRR-family protein                                 136   7e-34   
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...    136   9e-34   Pyrus x bretschneideri [bai li]
ref|XP_007157715.1|  hypothetical protein PHAVU_002G092200g             136   1e-33   Phaseolus vulgaris [French bean]
ref|XP_008456159.1|  PREDICTED: uncharacterized protein At4g06744...    134   1e-33   Cucumis melo [Oriental melon]
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...    136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...    135   1e-33   Cicer arietinum [garbanzo]
gb|KJB32335.1|  hypothetical protein B456_005G236200                    135   1e-33   Gossypium raimondii
gb|KCW68710.1|  hypothetical protein EUGRSUZ_F02313                     134   2e-33   Eucalyptus grandis [rose gum]
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...    135   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...    135   3e-33   
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...    135   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...    134   3e-33   Nicotiana sylvestris
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...    134   4e-33   Glycine max [soybeans]
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...    134   5e-33   Nicotiana tomentosiformis
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...    134   5e-33   Eucalyptus grandis [rose gum]
ref|XP_010554992.1|  PREDICTED: uncharacterized protein At4g06744       134   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...    134   8e-33   
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...    133   9e-33   Cicer arietinum [garbanzo]
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...    133   1e-32   Elaeis guineensis
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...    132   1e-32   
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...    133   1e-32   Elaeis guineensis
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...    132   2e-32   Fragaria vesca subsp. vesca
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...    132   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative       131   4e-32   
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...    130   1e-31   Cucumis sativus [cucumbers]
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...    130   1e-31   
ref|XP_003575360.1|  PREDICTED: uncharacterized protein At4g06744...    130   1e-31   
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg               130   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                  129   2e-31   Medicago truncatula
ref|XP_004953109.1|  PREDICTED: uncharacterized protein At4g06744...    129   2e-31   Setaria italica
ref|XP_002452450.1|  hypothetical protein SORBIDRAFT_04g026020          129   3e-31   Sorghum bicolor [broomcorn]
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...    129   4e-31   Phoenix dactylifera
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg             128   4e-31   
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...    128   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...    127   9e-31   Cucumis sativus [cucumbers]
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...    127   1e-30   Cucumis melo [Oriental melon]
ref|XP_003575361.1|  PREDICTED: uncharacterized protein At4g06744...    127   1e-30   Brachypodium distachyon [annual false brome]
dbj|BAJ86461.1|  predicted protein                                      126   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                     126   3e-30   Eucalyptus grandis [rose gum]
ref|NP_849339.1|  Leucine-rich repeat-containing protein                125   4e-30   Arabidopsis thaliana [mouse-ear cress]
gb|EMT03089.1|  hypothetical protein F775_11041                         125   5e-30   
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...    125   5e-30   Oryza brachyantha
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...    125   5e-30   Setaria italica
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...    125   5e-30   Eucalyptus grandis [rose gum]
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...    125   6e-30   Eucalyptus grandis [rose gum]
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg                125   8e-30   Erythranthe guttata [common monkey flower]
ref|NP_001148637.1|  LOC100282253                                       125   9e-30   
gb|AFW62989.1|  leucine-rich repeat (LRR) family protein                124   1e-29   
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor             125   1e-29   Oryza officinalis
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor             125   1e-29   Oryza minuta
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...    124   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    124   1e-29   Vitis vinifera
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744       124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744       124   2e-29   Camelina sativa [gold-of-pleasure]
gb|ACF84038.1|  unknown                                                 124   2e-29   Zea mays [maize]
ref|NP_001241706.1|  uncharacterized protein LOC100856884               124   2e-29   
gb|ACF79045.1|  unknown                                                 124   2e-29   Zea mays [maize]
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                    124   2e-29   Arabis alpina [alpine rockcress]
ref|XP_006647518.1|  PREDICTED: uncharacterized protein At4g06744...    124   2e-29   Oryza brachyantha
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870          124   2e-29   Sorghum bicolor [broomcorn]
ref|XP_008677766.1|  PREDICTED: uncharacterized protein LOC100856...    124   3e-29   
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...    123   4e-29   Brassica rapa
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...    123   4e-29   Oryza brachyantha
ref|XP_002874478.1|  leucine-rich repeat family protein                 122   5e-29   
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...    123   5e-29   
emb|CAE02949.1|  OSJNBa0014K14.21                                       122   7e-29   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD21636.1|  leucine-rich repeat-like protein                       122   8e-29   Oryza sativa Japonica Group [Japonica rice]
gb|ACG34018.1|  protein binding protein                                 122   9e-29   Zea mays [maize]
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor             122   1e-28   Oryza punctata
ref|XP_004953107.1|  PREDICTED: uncharacterized protein At4g06744...    121   1e-28   
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744       121   1e-28   Brachypodium distachyon [annual false brome]
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor             121   1e-28   Oryza minuta
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg             121   2e-28   Eutrema salsugineum [saltwater cress]
gb|EEC73254.1|  hypothetical protein OsI_07372                          120   2e-28   Oryza sativa Indica Group [Indian rice]
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                       120   3e-28   Triticum urartu
emb|CAN61023.1|  hypothetical protein VITISV_001143                     120   3e-28   Vitis vinifera
gb|EAY86685.1|  hypothetical protein OsI_08067                          120   3e-28   Oryza sativa Indica Group [Indian rice]
gb|EAY86686.1|  hypothetical protein OsI_08068                          120   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...    120   5e-28   
gb|AFW72330.1|  leucine-rich repeat (LRR) family protein                117   7e-28   
gb|EMT08852.1|  hypothetical protein F775_11606                         119   2e-27   
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...    119   2e-27   
ref|NP_001150111.1|  protein binding protein precursor                  118   2e-27   
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310          117   3e-27   Sorghum bicolor [broomcorn]
gb|ABS78922.1|  At4g06744-like protein                                  113   4e-27   Arabidopsis lyrata subsp. petraea
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...    117   5e-27   Zea mays [maize]
gb|ACG42798.1|  leucine-rich repeat, plant specific                     117   5e-27   Zea mays [maize]
gb|ABS78920.1|  At4g06744-like protein                                  112   5e-27   Arabidopsis lyrata subsp. petraea
gb|ABS78905.1|  At4g06744-like protein                                  112   5e-27   Arabidopsis lyrata subsp. petraea
gb|ABS78915.1|  At4g06744-like protein                                  112   5e-27   Arabidopsis lyrata subsp. lyrata
gb|ABS78901.1|  At4g06744-like protein                                  112   5e-27   Arabidopsis lyrata subsp. petraea
gb|ABS78911.1|  At4g06744-like protein                                  112   5e-27   Arabidopsis lyrata subsp. lyrata
gb|ABS78900.1|  At4g06744-like protein                                  112   6e-27   Arabidopsis lyrata subsp. petraea
gb|ABS78910.1|  At4g06744-like protein                                  112   6e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...    117   6e-27   Cucumis melo [Oriental melon]
gb|EMT04546.1|  hypothetical protein F775_44003                         116   7e-27   
dbj|BAJ91151.1|  predicted protein                                      117   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001141180.1|  uncharacterized protein LOC100273267 precursor     116   9e-27   Zea mays [maize]
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg             116   1e-26   Capsella rubella
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557    119   1e-26   
dbj|BAJ86489.1|  predicted protein                                      116   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABS78902.1|  At4g06744-like protein                                  112   1e-26   Arabidopsis lyrata subsp. petraea
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                       115   1e-26   Triticum urartu
ref|XP_006648837.1|  PREDICTED: uncharacterized protein At4g06744...    115   2e-26   Oryza brachyantha
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744       115   2e-26   Vitis vinifera
gb|ABS78906.1|  At4g06744-like protein                                  111   2e-26   Arabidopsis lyrata subsp. petraea
gb|ABS78899.1|  At4g06744-like protein                                  110   3e-26   Arabidopsis halleri subsp. halleri
gb|EEC78222.1|  hypothetical protein OsI_17861                          113   9e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...    117   1e-25   
ref|NP_001054210.2|  Os04g0670100                                       113   1e-25   
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                    113   2e-25   Oryza glaberrima
gb|EAZ32358.1|  hypothetical protein OsJ_16568                          113   2e-25   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                            113   2e-25   Oryza sativa [red rice]
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580          112   2e-25   Amborella trichopoda
gb|AFW62990.1|  leucine-rich repeat (LRR) family protein                104   1e-22   
ref|XP_007152809.1|  hypothetical protein PHAVU_004G161500g             102   5e-21   Phaseolus vulgaris [French bean]
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...  99.8    5e-21   Brassica rapa
emb|CDY72552.1|  BnaCnng78240D                                        99.4    8e-21   Brassica napus [oilseed rape]
emb|CDY18974.1|  BnaC01g20940D                                        99.0    8e-21   Brassica napus [oilseed rape]
ref|XP_006851044.1|  hypothetical protein AMTR_s00025p00231860          100   9e-21   
ref|XP_006451101.1|  hypothetical protein CICLE_v100107082mg          96.3    3e-20   
emb|CDY49661.1|  BnaC09g41390D                                        97.4    4e-20   Brassica napus [oilseed rape]
ref|XP_009627507.1|  PREDICTED: leucine-rich repeat extensin-like...  99.0    4e-20   Nicotiana tomentosiformis
ref|XP_009627506.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    7e-20   Nicotiana tomentosiformis
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...  98.6    9e-20   
gb|KDO74484.1|  hypothetical protein CISIN_1g045950mg                 96.3    1e-19   Citrus sinensis [apfelsine]
ref|XP_009760538.1|  PREDICTED: leucine-rich repeat extensin-like...  98.2    1e-19   Nicotiana sylvestris
ref|XP_004512961.1|  PREDICTED: leucine-rich repeat extensin-like...  97.8    2e-19   Cicer arietinum [garbanzo]
ref|XP_002515589.1|  LRX1, putative                                   97.1    2e-19   
ref|XP_006420010.1|  hypothetical protein CICLE_v10005037mg           95.5    2e-19   Citrus clementina [clementine]
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...  96.7    3e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006489595.1|  PREDICTED: leucine-rich repeat extensin-like...  94.7    3e-19   Citrus sinensis [apfelsine]
ref|XP_007034837.1|  Leucine-rich repeat (LRR) family protein, pu...  94.0    5e-19   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4      96.3    5e-19   Morus notabilis
gb|ACU18125.1|  unknown                                               93.2    9e-19   Glycine max [soybeans]
ref|XP_010259122.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    1e-18   
ref|XP_010256147.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    1e-18   
ref|XP_008776836.1|  PREDICTED: leucine-rich repeat extensin-like...  95.1    1e-18   
ref|XP_006384469.1|  hypothetical protein POPTR_0004s153601g          94.4    1e-18   
ref|XP_002279192.1|  PREDICTED: leucine-rich repeat extensin-like...  92.8    1e-18   
gb|KEH27082.1|  LRR extensin-like protein                             95.1    2e-18   
ref|XP_003620502.1|  Extensin-like protein                            95.1    2e-18   
emb|CBI26296.3|  unnamed protein product                              92.8    2e-18   
ref|XP_006353562.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    2e-18   
ref|XP_006366874.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    2e-18   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g           94.0    2e-18   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g           93.2    3e-18   
emb|CDX94809.1|  BnaC03g43790D                                        93.2    3e-18   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...  94.0    3e-18   
ref|XP_008786172.1|  PREDICTED: leucine-rich repeat extensin-like...  93.2    5e-18   
ref|XP_011001177.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    6e-18   
ref|XP_011005677.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    6e-18   
gb|KFK40601.1|  hypothetical protein AALP_AA2G016700                  93.2    6e-18   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg          92.0    7e-18   
ref|XP_010501433.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    7e-18   
ref|XP_010925532.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    8e-18   
emb|CDX93014.1|  BnaA03g37360D                                        91.7    8e-18   
ref|XP_002440709.1|  hypothetical protein SORBIDRAFT_09g005520        90.9    8e-18   
ref|XP_001759047.1|  predicted protein                                91.3    9e-18   
ref|XP_008798454.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    9e-18   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099           92.4    1e-17   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                       92.4    1e-17   
ref|XP_006379216.1|  hypothetical protein POPTR_0009s11130g           92.8    1e-17   
ref|XP_002314669.2|  hypothetical protein POPTR_0010s09310g           90.1    1e-17   
ref|XP_009403414.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    1e-17   
ref|XP_010533784.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    1e-17   
ref|NP_001150408.1|  receptor-like protein kinase precursor           90.1    1e-17   
gb|ACL53978.1|  unknown                                               90.1    1e-17   
ref|XP_010533785.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    1e-17   
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg          90.9    2e-17   
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
ref|XP_003556064.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    2e-17   
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
emb|CDY12948.1|  BnaA09g13260D                                        91.7    2e-17   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...  91.7    2e-17   
emb|CBI32375.3|  unnamed protein product                              89.4    2e-17   
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2         91.7    2e-17   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...  91.7    2e-17   
emb|CDX88190.1|  BnaA06g27810D                                        89.7    2e-17   
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg          89.7    2e-17   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_008438627.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    2e-17   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  91.3    2e-17   
ref|XP_008796915.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051           90.9    2e-17   
ref|NP_001131493.1|  leucine-rich repeat (LRR) family protein pre...  89.7    2e-17   
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4         90.5    2e-17   
gb|KJB54162.1|  hypothetical protein B456_009G023700                  90.5    3e-17   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...  91.3    3e-17   
ref|XP_009151086.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    3e-17   
ref|XP_004960846.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    3e-17   
ref|XP_007013226.1|  Leucine-rich repeat family protein               90.9    3e-17   
gb|KJB54163.1|  hypothetical protein B456_009G023700                  90.9    3e-17   
gb|KGN56949.1|  hypothetical protein Csa_3G146350                     89.0    3e-17   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g           90.1    3e-17   
ref|XP_009381253.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    4e-17   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    4e-17   
ref|XP_004134434.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    4e-17   
ref|XP_009390486.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    4e-17   
dbj|BAF48663.1|  leucine-rich repeat/extensin                         90.5    4e-17   
ref|XP_011030644.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    4e-17   
ref|XP_002885650.1|  predicted protein                                89.7    5e-17   
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    5e-17   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...  90.5    5e-17   
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    5e-17   
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3         90.5    5e-17   
ref|XP_006394807.1|  hypothetical protein EUTSA_v10004209mg           89.0    5e-17   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    6e-17   
ref|XP_010252148.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    6e-17   
ref|XP_007042323.1|  Leucine-rich repeat family protein               90.1    6e-17   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    6e-17   
ref|XP_008793507.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    6e-17   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    6e-17   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    7e-17   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    7e-17   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    7e-17   
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    7e-17   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    8e-17   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    8e-17   
ref|XP_010999749.1|  PREDICTED: pollen-specific leucine-rich repe...  90.1    8e-17   
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                       89.7    8e-17   
emb|CDP14269.1|  unnamed protein product                              89.7    8e-17   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.0    8e-17   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g           89.0    9e-17   
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    9e-17   
ref|XP_010938335.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  87.4    1e-16   
ref|XP_009758506.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   
ref|XP_010254179.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   
emb|CDY19550.1|  BnaC09g13530D                                        89.4    1e-16   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.4    1e-16   
ref|XP_010049719.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    1e-16   
ref|XP_008463374.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                       87.0    1e-16   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                     89.0    1e-16   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    2e-16   
emb|CDX80525.1|  BnaC07g29190D                                        87.4    2e-16   
ref|XP_009413897.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    2e-16   
ref|XP_009352479.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    2e-16   
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg              86.7    2e-16   
gb|KJB79256.1|  hypothetical protein B456_013G040400                  87.8    2e-16   
ref|XP_006300825.1|  hypothetical protein CARUB_v10019913mg           88.6    2e-16   
emb|CDY02276.1|  BnaA03g38910D                                        88.2    2e-16   
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    2e-16   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg              87.0    2e-16   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    3e-16   
gb|EEE62542.1|  hypothetical protein OsJ_17340                        86.3    3e-16   
gb|KFK27830.1|  hypothetical protein AALP_AA8G435400                  87.0    3e-16   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    3e-16   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    3e-16   
ref|XP_010501434.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    3e-16   
ref|XP_009402787.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    3e-16   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg              86.7    3e-16   
emb|CDO99097.1|  unnamed protein product                              86.7    4e-16   
gb|EYU41449.1|  hypothetical protein MIMGU_mgv1a007525mg              86.3    4e-16   
gb|KDP27758.1|  hypothetical protein JCGZ_19787                       87.8    4e-16   
emb|CDX89681.1|  BnaC03g45950D                                        87.4    4e-16   
ref|XP_007143301.1|  hypothetical protein PHAVU_007G060800g           85.9    4e-16   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                 86.7    5e-16   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg           86.7    5e-16   
gb|KJB47441.1|  hypothetical protein B456_008G026700                  87.0    5e-16   
gb|EAY96763.1|  hypothetical protein OsI_18683                        85.9    5e-16   
ref|XP_002517082.1|  serine-threonine protein kinase, plant-type,...  85.1    5e-16   
gb|KJB06895.1|  hypothetical protein B456_001G004000                  86.7    5e-16   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    5e-16   
ref|NP_001054807.1|  Os05g0180300                                     85.9    6e-16   
gb|KJB06894.1|  hypothetical protein B456_001G004000                  86.7    6e-16   
ref|XP_007013716.1|  Leucine-rich repeat family protein               86.7    7e-16   
ref|XP_009385615.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    7e-16   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    7e-16   
gb|KJB06897.1|  hypothetical protein B456_001G004000                  86.7    7e-16   
ref|XP_009415697.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    7e-16   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...  86.7    7e-16   
ref|XP_010520859.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    8e-16   
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    8e-16   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    8e-16   
gb|KJB06896.1|  hypothetical protein B456_001G004000                  86.7    8e-16   
gb|KDO40432.1|  hypothetical protein CISIN_1g045837mg                 86.3    8e-16   
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg           86.7    8e-16   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    8e-16   
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                  86.7    9e-16   
gb|KCW60691.1|  hypothetical protein EUGRSUZ_H03422                   84.0    9e-16   
ref|XP_002519151.1|  protein binding protein, putative                86.7    9e-16   
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g         85.1    9e-16   
emb|CDY34233.1|  BnaA01g24500D                                        84.7    9e-16   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    9e-16   
ref|XP_009136284.1|  PREDICTED: pollen-specific leucine-rich repe...  86.7    9e-16   
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610        85.9    9e-16   
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg           86.7    1e-15   
emb|CDY46593.1|  BnaCnng14150D                                        84.7    1e-15   
gb|EPS61338.1|  hypothetical protein M569_13456                       84.7    1e-15   
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  86.3    1e-15   
ref|XP_009385321.1|  PREDICTED: pollen-specific leucine-rich repe...  85.9    1e-15   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_006381178.1|  hypothetical protein POPTR_0006s08110g           84.7    1e-15   
gb|KJB72347.1|  hypothetical protein B456_011G172700                  84.3    1e-15   
ref|XP_004148723.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_006289956.1|  hypothetical protein CARUB_v10003584mg           85.1    1e-15   
ref|XP_002314670.2|  hypothetical protein POPTR_0010s09320g           84.0    1e-15   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    1e-15   
ref|XP_009110797.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    1e-15   
gb|KGN65364.1|  hypothetical protein Csa_1G383520                     86.3    1e-15   
ref|XP_004170319.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_003532491.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    1e-15   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...  85.9    2e-15   
ref|NP_001050725.1|  Os03g0637600                                     84.3    2e-15   
gb|EAY91133.1|  hypothetical protein OsI_12740                        84.3    2e-15   
ref|XP_006489442.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
ref|XP_006654107.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    2e-15   
ref|NP_179188.1|  pollen-specific leucine-rich repeat extensin-li...  85.9    2e-15   
ref|XP_010466571.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    2e-15   
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg           85.9    2e-15   
ref|XP_010024229.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    2e-15   
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    2e-15   
ref|XP_002455064.1|  hypothetical protein SORBIDRAFT_03g003730        85.1    2e-15   
ref|XP_010488313.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
dbj|BAJ85515.1|  predicted protein                                    84.0    2e-15   
ref|XP_006420005.1|  hypothetical protein CICLE_v10004988mg           84.0    3e-15   
ref|XP_008224262.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    3e-15   
ref|XP_010559035.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  83.6    3e-15   
ref|XP_010695983.1|  PREDICTED: leucine-rich repeat extensin-like...  83.2    3e-15   
ref|XP_006409498.1|  hypothetical protein EUTSA_v10023190mg           84.7    3e-15   
ref|XP_002885986.1|  predicted protein                                85.1    3e-15   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg           85.1    3e-15   
ref|XP_009613983.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    3e-15   
ref|XP_009119384.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    3e-15   
ref|XP_006494306.1|  PREDICTED: pollen-specific leucine-rich repe...  85.5    3e-15   
gb|KJB77687.1|  hypothetical protein B456_012G150700                  84.7    3e-15   
ref|XP_002885524.1|  hypothetical protein ARALYDRAFT_898761           84.0    3e-15   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                  85.1    3e-15   
ref|XP_004292960.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    3e-15   
ref|XP_002872172.1|  leucine-rich repeat family protein               84.0    3e-15   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...  84.3    3e-15   
ref|XP_007226551.1|  hypothetical protein PRUPE_ppa024854mg           84.7    3e-15   
gb|AIE39576.1|  leucine-rich repeat extensin-like protein             81.3    3e-15   
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    3e-15   
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    4e-15   
ref|XP_002464196.1|  hypothetical protein SORBIDRAFT_01g013940        83.2    4e-15   
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    4e-15   
ref|XP_010927122.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    4e-15   
ref|NP_188919.1|  leucine-rich repeat extensin-like protein 6         84.0    4e-15   
ref|XP_002514492.1|  LRX2, putative                                   84.7    4e-15   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg           83.2    4e-15   
ref|XP_002867451.1|  leucine-rich repeat family protein               82.8    4e-15   
ref|XP_010664614.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    4e-15   
gb|EMT25064.1|  hypothetical protein F775_07652                       82.4    5e-15   
ref|XP_010511710.1|  PREDICTED: leucine-rich repeat extensin-like...  83.2    5e-15   
gb|KJB79255.1|  hypothetical protein B456_013G040300                  83.6    5e-15   
ref|XP_002984203.1|  hypothetical protein SELMODRAFT_423462           82.8    6e-15   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1         84.3    6e-15   
ref|XP_008665106.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    6e-15   
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    6e-15   



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG+LK ++VFDAS N+LTGPIPQSFGCLE++E+++L+ NQLYG VPE+LCK+  LEE
Sbjct  228  PYEIGMLKLASVFDASKNKLTGPIPQSFGCLEQMEVMDLSYNQLYGEVPETLCKISSLEE  287

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  NYFTQIGPECR L+E+ VLDI  NCI+DL NQR  + C+ FFL  + C D KSL 
Sbjct  288  LTLKYNYFTQIGPECRKLVEENVLDIGMNCIIDLKNQRKPEECETFFLQKRNCRDMKSLS  347

Query  337  YVPCDI-DESPRKAGphphphrpykkhkRGSSTTYAALK  224
            YVPC I D S R +           +     STTYAALK
Sbjct  348  YVPCKIHDFSSRNSSSGRAHTTGDART---RSTTYAALK  383



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 116/159 (73%), Gaps = 10/159 (6%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK +TVFDAS+N+LTGPIP SFGCL  +E+LN++ NQLYG VPESLCKL  LE+
Sbjct  356  PYEIGLLKLATVFDASVNKLTGPIPHSFGCLRDMELLNVSYNQLYGPVPESLCKLGHLEK  415

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  NYFTQ+GPECR L+++KVLDI  NCILDL NQR  + C+ FFL  +KCPD +SL 
Sbjct  416  LTLKFNYFTQVGPECRKLIKEKVLDISMNCILDLENQRKPEECESFFLQPRKCPDMESLS  475

Query  337  YVPCDIDE--SPRKAGphphphrpykkhkRGSSTTYAAL  227
             VPC+IDE  S R+               R  STTYAA+
Sbjct  476  KVPCNIDEFSSGRRP--------HRHLRARARSTTYAAI  506



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   183 bits (465),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 117/158 (74%), Gaps = 5/158 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK +TVFDAS+N+LTGPIP SFGCL  +++LN++ NQLYG VPESLCKL  L++
Sbjct  357  PYEIGLLKLATVFDASVNKLTGPIPHSFGCLRDMQLLNISYNQLYGPVPESLCKLSHLQK  416

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  NYFTQ+GPECR L+++K+LDI  NC+LDL NQR  + C+ FFL  +KCPD +SL 
Sbjct  417  LTLKFNYFTQVGPECRKLIKEKILDISMNCVLDLENQRKPEECEAFFLQPRKCPDMESLS  476

Query  337  YVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAAL  227
             VPC+IDE S R++              R  STTYAA+
Sbjct  477  KVPCNIDEFSSRQSS----GRAYRHHRARAHSTTYAAI  510



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 116/159 (73%), Gaps = 5/159 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG+LK ++VFDAS N+LTGPIPQSFGCL ++E+++L+ NQLYG VPE+LCK+  LEE
Sbjct  306  PYEIGMLKLASVFDASKNKLTGPIPQSFGCLVQMEVMDLSYNQLYGEVPETLCKISSLEE  365

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  NYFTQIGPECR L+E+ VL+I  NCI+DL NQR  + C+ FFL  + C D KSL 
Sbjct  366  LTLKYNYFTQIGPECRKLVEENVLNIGMNCIIDLENQRKPEECEAFFLQKRNCRDMKSLS  425

Query  337  YVPCDIDE-SPRKAGphphphrpykkhkRGSSTTYAALK  224
            Y+PC + E S R +       R +    +  STTYAA+K
Sbjct  426  YIPCKLHEFSSRNSS----ARRAHTGDAKARSTTYAAVK  460



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK +TVFD S N+LTGPIP SFGCL K+EILNL  N+ YG VPE +C+LK L+ 
Sbjct  336  PYEIGNLKKATVFDVSRNKLTGPIPHSFGCLPKIEILNLATNEFYGPVPELVCELKTLQN  395

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLSGNYFTQ+GPECR L++ K LD+  NCILDLP+QRSA  C+DFF   +KCP+ KSL 
Sbjct  396  LSLSGNYFTQVGPECRKLIKAKRLDVRKNCILDLPDQRSAAQCRDFFSKNRKCPNEKSLT  455

Query  337  YVPC  326
             VPC
Sbjct  456  IVPC  459



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   171 bits (432),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK ST+FDAS N+LTGPIP SFGC+EKL  LN++ N L G VPESLC+L+DL+E
Sbjct  340  PYEIGKLKKSTLFDASANRLTGPIPHSFGCMEKLRYLNVSYNHLSGEVPESLCRLRDLDE  399

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L+ NYFTQ+GP CR L++   LDI  NC+LDLP+QRSA  C+ FFL  Q CP+ +S+ 
Sbjct  400  LTLNHNYFTQVGPACRKLIKSGKLDIRVNCVLDLPSQRSAAECEAFFLKQQYCPNRESMN  459

Query  337  YVPCDIDES  311
             VPC ID S
Sbjct  460  IVPCKIDYS  468



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 108/160 (68%), Gaps = 8/160 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIG L  + + D SINQLTGPIPQSFGCL+ ++ LNL+ NQ YG+VPESLC L DLE 
Sbjct  331  PCEIGFLNKTHIVDVSINQLTGPIPQSFGCLKDIQQLNLSYNQFYGAVPESLCILGDLEV  390

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L L  NYFTQ+GPECR L+EKKVL++  NCILDLP QRS + CK FF  +  CPD KSL 
Sbjct  391  LDLKFNYFTQVGPECRKLIEKKVLNVTMNCILDLPCQRSPEECKAFFSKHWTCPDPKSLN  450

Query  337  YVPCDIDES--PRKAGphphphrpykkhkRGSSTTYAALK  224
            YVPC I+ S  P +A  H              S TYAALK
Sbjct  451  YVPCGINVSKGPPQASDHVPKRARP------PSPTYAALK  484



>ref|XP_006356575.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=444

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLL  +TVFDAS NQLTG IP SFGCL K+EILNL  NQ YG+VPE +CKL +L+ 
Sbjct  291  PYEIGLLSKATVFDASKNQLTGKIPHSFGCLAKMEILNLAQNQFYGAVPELVCKLCNLKN  350

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+LS NYFT++GPEC+ L++KKVLD+  NCI  LP QRSA+ C  FF   + CPD KS+ 
Sbjct  351  LTLSYNYFTEVGPECKKLIQKKVLDVRMNCIPGLPMQRSAEECAAFFCKPRSCPDEKSMG  410

Query  337  YVPCDIDES  311
            +VPC I  S
Sbjct  411  FVPCSIGSS  419



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK +TVFD S N LTGPIP SF CL K++ILNL NN  YG VPE +C+L +L+ 
Sbjct  296  PYEIGNLKKATVFDVSCNMLTGPIPHSFACLAKIQILNLANNGFYGPVPEMVCQLPNLQN  355

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLSGN+FTQ+GPECR L+  K +D+  NCILDLP QRSA  CK+FF   + CP+ KSL 
Sbjct  356  LSLSGNFFTQVGPECRKLIMLKRIDVGQNCILDLPYQRSADECKEFFSKRRTCPNEKSLT  415

Query  337  YVPC  326
            YVPC
Sbjct  416  YVPC  419



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCLEK+E LNL  N  YG++PE +C+L  L+ 
Sbjct  306  PYQIGKLNQATVFDVEFNQLTGPIPYSFGCLEKMEQLNLARNNFYGTIPEMVCELSALKN  365

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLPNQR+   C  FF+  Q CP+ KS  
Sbjct  366  VSLSFNYFTQVGPKCRKLIKKKILDVRMNCILDLPNQRTPWECAKFFMRKQNCPNSKSFF  425

Query  337  YVPCDID  317
            Y+PC  D
Sbjct  426  YIPCGKD  432



>gb|KJB77660.1| hypothetical protein B456_012G149500 [Gossypium raimondii]
Length=449

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  STVFDAS N+LTGPIP SFGCL+K++IL+LTNNQ YG VPE++CKL  L +
Sbjct  291  PYEIGNLTQSTVFDASSNKLTGPIPYSFGCLKKMQILSLTNNQFYGEVPETVCKLPMLNK  350

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L+EKK LD+  NCI  LPNQRS + C +FFL  + CP  ++  
Sbjct  351  LSLSNNYFTHVGPACRGLIEKKKLDVKKNCIYGLPNQRSEKECVEFFLKKKDCPRMETFY  410

Query  337  YVPC  326
            +VPC
Sbjct  411  WVPC  414



>gb|KCW54907.1| hypothetical protein EUGRSUZ_I00886 [Eucalyptus grandis]
Length=240

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK +T FDASINQLTGPIP SFGCL+++  LNL+ + LYG VPE++C L  L  
Sbjct  83   PYEIGLLKKTTTFDASINQLTGPIPHSFGCLQQMNQLNLSYSHLYGPVPETVCMLPKLSA  142

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L+ NYFTQ+GPECR L+ KK L++  NCIL LP+QRS   C  FF    KCP+ +S+ 
Sbjct  143  LTLNNNYFTQVGPECRKLILKKKLNVRMNCILGLPSQRSPAECDAFFSKKVKCPNERSMR  202

Query  337  YVPCDIDE  314
            Y+PC I +
Sbjct  203  YLPCKISQ  210



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK +T FDASINQLTGPIP SFGCL+++  LNL+ N LYG VPE++C L  L  
Sbjct  356  PYEIGLLKKTTTFDASINQLTGPIPHSFGCLQQMNQLNLSCNHLYGPVPETVCVLPKLSA  415

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L+ NYFTQ+GPECR L+ KK LD+  NCIL LP+QRS   C  FF    KCP+ KS+ 
Sbjct  416  LTLNNNYFTQVGPECRKLILKKKLDVRMNCILGLPSQRSPAECDAFFSKKVKCPNEKSMR  475

Query  337  YVPCDIDES  311
            YVPC I +S
Sbjct  476  YVPCKISQS  484



>dbj|BAH19934.1| AT1G49750 [Arabidopsis thaliana]
Length=275

 Score =   162 bits (410),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE +C++  L+ 
Sbjct  114  PYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLQN  173

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CR L+++K++D+  NCILDLPNQ++   C  FF+  Q CP+ KSL 
Sbjct  174  VSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQTCPNSKSLF  233

Query  337  YVPCD  323
             VPCD
Sbjct  234  TVPCD  238



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L NSTVFD   N+LTGPIP SFGCL  ++ LNL  NQ YG VPE +C+L  L  
Sbjct  336  PYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSSMQYLNLAMNQFYGPVPEIVCQLPKLVN  395

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF   +KCP+ +SL 
Sbjct  396  LSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFFSESKKCPNERSLT  455

Query  337  YVPCDIDES  311
             VPC  + S
Sbjct  456  LVPCARNRS  464



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCL+K+E LNL  N+ YG++PE +C+L  L+ 
Sbjct  301  PYQIGKLNQATVFDVEFNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCELSALKN  360

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF+  QKCP  KS  
Sbjct  361  VSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQKCPKSKSFF  420

Query  337  YVPCD  323
            Y+PCD
Sbjct  421  YMPCD  425



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCL+K+E LNL  N+ YG++PE +C+L  L+ 
Sbjct  301  PYQIGKLNQATVFDVEFNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCELSALKN  360

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF+  QKCP  KS  
Sbjct  361  VSLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQKCPKSKSFF  420

Query  337  YVPCD  323
            Y+PCD
Sbjct  421  YMPCD  425



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L NSTVFD   N+LTGPIP SFGCL  ++ LNL  NQ YG VPE +C+L  L  
Sbjct  291  PYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSGMQFLNLAMNQFYGPVPEIVCQLPKLVN  350

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF   +KCP+ +SL 
Sbjct  351  LSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSPEECGKFFSESKKCPNERSLT  410

Query  337  YVPC  326
             VPC
Sbjct  411  LVPC  414



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L NSTVFD   N+LTGPIP SFGCL  ++ LNL  NQ YG VPE +C+L  L  
Sbjct  347  PYEIGFLSNSTVFDVGNNRLTGPIPHSFGCLSSMQYLNLAMNQFYGPVPEIVCQLPKLVN  406

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GPECR L+++KVLD+  NCILDLPNQRS + C  FF   +KCP+ +SL 
Sbjct  407  LSLSYNYFTQVGPECRKLIKRKVLDVRMNCILDLPNQRSREECGKFFSESKKCPNERSLT  466

Query  337  YVPC  326
             VPC
Sbjct  467  LVPC  470



>ref|XP_004170987.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Cucumis 
sativus]
Length=357

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  NN LYG+VPE +CKL D+++
Sbjct  200  PMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKLPDIQQ  259

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF H + CPD KS+ 
Sbjct  260  LTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPDEKSMK  319

Query  337  YVPC  326
            Y+PC
Sbjct  320  YIPC  323



>ref|XP_004248758.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=442

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLL  +TVFD S NQLTG IP SFGCL K+EILNL  NQ YG+VPE +CKL +L+ 
Sbjct  289  PYEIGLLSKATVFDVSKNQLTGKIPHSFGCLAKIEILNLAQNQFYGAVPELVCKLCNLKN  348

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+LS NYF ++GPEC+ L+EK+VLDI  NCI  LP QRSA+ C  FF   + CPD KSL 
Sbjct  349  LTLSYNYFNEVGPECKKLIEKRVLDIKMNCIPGLPMQRSAEECAAFFCKPRSCPDEKSLG  408

Query  337  YVPCDI  320
            +VPC +
Sbjct  409  FVPCSV  414



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+ +TVFDAS N LTGPIP SFGCL+ +   N++ NQLYG+VPE LC L  L E
Sbjct  331  PPEIGLLQKATVFDASANHLTGPIPHSFGCLKNMLFFNMSYNQLYGAVPEPLCNLGSLIE  390

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  NYFTQ+GP+CR L+  K LDI  NCILDLP+QRSA  C+ FFL+ Q CPD +SL+
Sbjct  391  LTLKFNYFTQVGPKCRKLIMSKKLDISMNCILDLPSQRSAAECETFFLNQQSCPDPQSLI  450

Query  337  -YVPCDID--ESPRK  302
             Y+PC ID  ESP +
Sbjct  451  NYMPCKIDNHESPEE  465



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N+ YG++PE +C+L  L+ 
Sbjct  300  PYQIGKLNQATVFDVEFNLLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCELSALKN  359

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CR L++KK+LD+  NCILDLP QR+   C  FF+  QKCP  KS  
Sbjct  360  ISLSFNYFTQVGPKCRELIKKKILDVRMNCILDLPYQRTPWECAKFFMRKQKCPKSKSFF  419

Query  337  YVPCD  323
            Y+PCD
Sbjct  420  YMPCD  424



>ref|XP_004137107.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=459

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  NN LYG+VPE +CKL D+++
Sbjct  302  PMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKLPDIQQ  361

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF H + CPD KS+ 
Sbjct  362  LTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPDEKSMK  421

Query  337  YVPC  326
            Y+PC
Sbjct  422  YIPC  425



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCL+K+E LNL  N+ YG++PE +C++  L+ 
Sbjct  335  PYQIGKLNRATVFDVGFNQLTGPIPYSFGCLDKMEQLNLARNKFYGAIPEIVCEISCLKN  394

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+++ +LD+  NCILDLPNQ+++Q C DFF+  Q CP+ KS+ 
Sbjct  395  LSLSYNYFTQVGPKCRQLIKRNILDVRMNCILDLPNQKTSQECADFFMRKQTCPNSKSMF  454

Query  337  YVPC  326
             +PC
Sbjct  455  RIPC  458



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD  +NQLTGPIP SFGCL+K+E LNL  N  YG++PE +C+L  L+ 
Sbjct  335  PYQIGNLNRATVFDVELNQLTGPIPYSFGCLKKMEQLNLARNNFYGTIPEIVCELSALKN  394

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+++K+LD+  NCILDL NQR+   C  FFL  Q CP+ KS  
Sbjct  395  LSLSYNYFTQVGPKCRTLIKRKILDVGMNCILDLTNQRTPWECAKFFLRKQSCPNFKSFF  454

Query  337  YVPCDID  317
            Y+PC  D
Sbjct  455  YLPCGKD  461



>gb|KGN43906.1| hypothetical protein Csa_7G073420 [Cucumis sativus]
Length=488

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  NN LYG+VPE +CKL D+++
Sbjct  331  PMEIGLLENTILFDASKNSLTGPIPFSFSCLAKMQVLNFANNTLYGAVPEGVCKLPDIQQ  390

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP Q+S + C  FF H + CPD KS+ 
Sbjct  391  LTLRNNFITQVGPICRSLISKKVLDVSGNCILGLPEQKSEEECTHFFTHVELCPDEKSMK  450

Query  337  YVPC  326
            Y+PC
Sbjct  451  YIPC  454



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD   NQLTGPIP SFGCL K+E LNL  N+ YG+VPE +C L  ++ 
Sbjct  321  PYEIGKLNQATVFDVGFNQLTGPIPYSFGCLGKMEQLNLARNKFYGAVPEIVCDLPRIQN  380

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L++K+VLD+  NCILDLPNQRS   C  FF+  + CP+ +S+ 
Sbjct  381  LSLSYNYFTQVGPKCRELIKKRVLDVRMNCILDLPNQRSPDDCAKFFMRKESCPNPESVF  440

Query  337  YVPC  326
            ++PC
Sbjct  441  WMPC  444



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  + VFD S N+LTGPIP SFGCL  +EILNL  NQ YG VPE +CKL +L+ 
Sbjct  346  PYEIGFLTKTRVFDVSCNKLTGPIPHSFGCLSMIEILNLAKNQFYGPVPEIVCKLPNLQN  405

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLSGNYFTQ+GPECR L+  + LD+ NNCIL LPNQR  + C +FF   ++C + +S+ 
Sbjct  406  LSLSGNYFTQVGPECRKLISLRRLDVRNNCILGLPNQRPPKACTEFFSKPKQCANERSMN  465

Query  337  YVPC  326
            Y+PC
Sbjct  466  YIPC  469



>ref|NP_175397.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
 gb|AAG13059.1|AC011807_18 Unknown protein [Arabidopsis thaliana]
 gb|AAS47632.1| At1g49750 [Arabidopsis thaliana]
 gb|AAS76756.1| At1g49750 [Arabidopsis thaliana]
 dbj|BAH19559.1| AT1G49750 [Arabidopsis thaliana]
 gb|AEE32471.1| leucine-rich repeat (LRR) family protein [Arabidopsis thaliana]
Length=494

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE +C++  L+ 
Sbjct  333  PYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLQN  392

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CR L+++K++D+  NCILDLPNQ++   C  FF+  Q CP+ KSL 
Sbjct  393  VSLSNNYFTQVGPKCRKLIKRKIMDVSMNCILDLPNQKTPSECAKFFMRKQTCPNSKSLF  452

Query  337  YVPCD  323
             VPCD
Sbjct  453  TVPCD  457



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N  YG++PE +C+L  L+ 
Sbjct  336  PYQIGNLNRATVFDVESNQLTGLIPYSFGCLNKMEQLNLARNNFYGTIPEIVCELSALKN  395

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+++K+LD+  NCILDL NQR+   C  FFL  Q CP++KS  
Sbjct  396  LSLSSNYFTQVGPKCRTLIKRKILDVGMNCILDLANQRAPWECAKFFLRKQSCPNYKSFF  455

Query  337  YVPCDID  317
            YVPC  D
Sbjct  456  YVPCGKD  462



>ref|XP_007157235.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
 gb|ESW29229.1| hypothetical protein PHAVU_002G054000g [Phaseolus vulgaris]
Length=433

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IGLL  +TVFD S N LTGPIP+SFGCLE +  LNL  NQ+YG VPE++C+L  L  
Sbjct  276  PYQIGLLNKATVFDVSKNWLTGPIPRSFGCLESIRYLNLEQNQMYGEVPETVCELPGLRN  335

Query  517  ---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSLS NYFTQ+GP CR L+E  VLD+ NNCIL LPNQR+ + C  FF + + CP+ K
Sbjct  336  RGNLSLSDNYFTQVGPACRRLIEANVLDVRNNCILGLPNQRTHEQCSQFFSNLKPCPNPK  395

Query  346  SLLYVPC  326
            SL YVPC
Sbjct  396  SLNYVPC  402



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK++TVFD   NQLTGPIP SFGCL+ ++ILNL  NQ YG VPE+LC+L +L  
Sbjct  357  PYEIGYLKDATVFDVGFNQLTGPIPHSFGCLDSIQILNLAANQFYGPVPETLCELPNLYN  416

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+ +K LD+  NCIL LP Q+    C  FF   ++CPD KS +
Sbjct  417  LSLSHNYFTQVGPKCRKLITEKKLDVRMNCILGLPQQKPEHACSHFFSQVRQCPDPKSFI  476

Query  337  YVPC  326
             VPC
Sbjct  477  KVPC  480



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N  YG++PE++C L  ++ 
Sbjct  293  PYEIGKLNLATVFDVGSNLLTGPIPYSFGCLDKMEQLNLARNTFYGTIPETVCNLPRIQN  352

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP+CR L++KKVLD+  NCIL LPNQRSA  C  FF+  Q CP+ KS  
Sbjct  353  LSLSYNYFTHVGPKCRELIKKKVLDVRMNCILGLPNQRSATECSKFFMRKQPCPNPKSFF  412

Query  337  YVPC  326
            ++PC
Sbjct  413  WIPC  416



>ref|XP_008454973.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=520

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +FDAS N LTGPIP SF CL K+++LN  +N LYG+VPE +CKL +++ 
Sbjct  363  PMEIGLLENTILFDASNNSLTGPIPYSFACLAKIQLLNFADNTLYGAVPEGVCKLPNIQN  422

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+L  N+ TQ+GP CR+L+ KKVLD+  NCIL LP QRS + C  FF H + CPD KS+ 
Sbjct  423  LTLRNNFITQVGPVCRSLISKKVLDVSGNCILGLPEQRSEEECTHFFTHVELCPDEKSMK  482

Query  337  YVPC  326
            Y+PC
Sbjct  483  YIPC  486



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 102/161 (63%), Gaps = 2/161 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+ +TVFDAS N LTGPIPQSF CL +++ILNL NNQLYG VPE +CKL +L  
Sbjct  301  PCEIGLLEKATVFDASRNLLTGPIPQSFACLAQMQILNLANNQLYGPVPELVCKLANLGN  360

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GPECR L+ K VLD+  NCI  LP QRS   C  FF   + CPD  S  
Sbjct  361  LSLSYNYFTKVGPECRKLINKNVLDLTMNCIPGLPGQRSPAQCHAFFSKARSCPDEGSFS  420

Query  337  YVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  215
            ++PC+ +   R+               +  S +YAAL   R
Sbjct  421  WMPCNANS--RRNSLELSDSVSTSTGSKEPSRSYAALHPHR  459



>emb|CDY43618.1| BnaC09g17570D [Brassica napus]
Length=210

 Score =   153 bits (386),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N LTGPIP SFGCL+K+E  NL  N+ +G++PE +C++  L+ 
Sbjct  49   PYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQFNLARNKFFGTIPEIVCEISSLKN  108

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF+    CP+ KS+ 
Sbjct  109  LSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKLTCPNSKSMF  168

Query  337  YVPC  326
             +PC
Sbjct  169  RIPC  172



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L  + VFD   N+LTGPIP SF CL+K+E LNL  N+ YG+VPE +C L  L  
Sbjct  247  PFEIGKLDKTVVFDVGSNKLTGPIPHSFACLKKMENLNLAKNKFYGTVPEMVCDLPRLAN  306

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GPECR L+ K++LD+  NCILDLP QRSA  C  FF   + CP+ +SL 
Sbjct  307  LSLSYNYFTQVGPECRKLISKRILDVRMNCILDLPGQRSAADCAKFFSKQRTCPNERSLS  366

Query  337  YVPCDIDESPRKAG  296
            Y+PC      RK G
Sbjct  367  YIPC------RKGG  374



>ref|XP_006307323.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
 gb|EOA40221.1| hypothetical protein CARUB_v10008944mg [Capsella rubella]
Length=496

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG LK +TVFD   NQLTGPIP SFGCL+ +E LNL  N+ YG++PE +C++  L+ 
Sbjct  335  PYQIGNLKQATVFDVGGNQLTGPIPYSFGCLDSMEQLNLARNKFYGTIPEIVCEIACLKN  394

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+E KVLD+  NCILDLPNQ + Q C DFF   Q C D KSL 
Sbjct  395  LSLSYNYFTQAGPKCRKLIESKVLDVRMNCILDLPNQNTPQQCADFFKRRQTCADPKSLF  454

Query  337  YVPC  326
             VPC
Sbjct  455  IVPC  458



>ref|XP_002894215.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70474.1| hypothetical protein ARALYDRAFT_474107 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTGPIP SFGCLE +E LNL  N+ YG++PE +C++  L+ 
Sbjct  317  PYQIGNLTRATVFDVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLKN  376

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            +SLS NYFTQ+GP+CRNL+++K++D+  NCILDLPNQ++   C +FF+  Q C + KSL 
Sbjct  377  VSLSYNYFTQVGPKCRNLIKRKIMDVSMNCILDLPNQKTPSECANFFMRKQTCLNSKSLF  436

Query  337  YVPC  326
             VPC
Sbjct  437  TVPC  440



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  + VFD   N+LTGPIP SF CLEK+EILNL  N+ YG VPE +C L  L  
Sbjct  235  PYEIGKLDKTVVFDVGSNKLTGPIPLSFACLEKMEILNLAMNKFYGPVPEMVCDLPRLAN  294

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+G ECR L+ K++LD+  NCILDLP QRSA  C  FF   + CP+ +SL 
Sbjct  295  LSLSYNYFTQVGHECRKLISKRILDVRMNCILDLPGQRSAADCAKFFSKQRTCPNERSLN  354

Query  337  YVPCDIDESPRKAG  296
            Y+PC      RK G
Sbjct  355  YIPC------RKGG  362



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLL+++TVFDA  N LTGPIP SFGCLEK+E+LNL  NQLYG +PE++C L++L  
Sbjct  303  PYEIGLLRSATVFDAGNNLLTGPIPCSFGCLEKMELLNLAGNQLYGQIPEAVCALRNLVN  362

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKC--PDHKS  344
            LSLS NYFT +GP CRNL++  VL+++NNCI  LPNQRS   C  F  H   C  P   S
Sbjct  363  LSLSDNYFTSVGPTCRNLIKNGVLNVNNNCIHGLPNQRSVGECSAF--HPGSCPYPPSYS  420

Query  343  LLYVPCDIDESP  308
              ++PC++ +SP
Sbjct  421  FSFIPCELPQSP  432



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCLE +E LNL  N+ YG++PE +C+L  L+ 
Sbjct  322  PYQIGKLNRATVFDVESNELTGPIPYSFGCLENMEQLNLARNKFYGTIPEIVCELSALKN  381

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L++ K+LD+  NCILDL NQRS   C  FFL  Q C + KS  
Sbjct  382  LSLSFNYFTQVGPKCRKLIKTKILDVRMNCILDLANQRSPWECAKFFLRKQNCHNFKSFF  441

Query  337  YVPC  326
            Y+PC
Sbjct  442  YIPC  445



>gb|AIE39583.1| LRR receptor-like protein kinase, partial [Humulus lupulus]
Length=141

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY IG LKN T+FDAS N +TGPIP SFGCL K+E+LNL NNQLYG VPES+CKL +L  
Sbjct  23   PYGIGKLKNLTLFDASTNLITGPIPHSFGCLSKIELLNLANNQLYGEVPESVCKLPNLSN  82

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
             +LSGNY TQ+GP CR L+  K L++D NCI DLP QRS + C  FF    +CP+  S
Sbjct  83   FTLSGNYITQVGPMCRKLINSKRLNVDWNCIRDLPKQRSFEDCGHFFSKDHQCPECSS  140



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLL  + +FD S N+LTG IP SFGCL  ++ILNL  NQ YG VPE +CKL +L+ 
Sbjct  301  PYEIGLLTKARIFDVSKNKLTGKIPHSFGCLANMQILNLAQNQFYGPVPELVCKLSNLKN  360

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GPEC+ L+++KVLD+  NCI  LP QRSA  C  FF   + CPD KSL 
Sbjct  361  LSLSYNYFTEVGPECKKLIQRKVLDVRMNCIPGLPMQRSAAECAAFFCKPRSCPDEKSLG  420

Query  337  YVPCDI  320
             VPC I
Sbjct  421  IVPCTI  426



>ref|XP_011467740.1| PREDICTED: uncharacterized protein At4g06744 [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIG L  +T+FD S NQLTGPIPQSF CL K+EIL L NNQ YG+VPE +CKL  L  
Sbjct  349  PMEIGKLNQATLFDVSYNQLTGPIPQSFACLTKMEILVLDNNQFYGAVPELVCKLPSLMN  408

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSL+ NYFTQ+GP CR L++K  L +DNNCILDL  QR    C  FF   + CP+ +SLL
Sbjct  409  LSLANNYFTQVGPACRKLIKKGFLHVDNNCILDLKYQRPKSECASFFSKPRYCPNERSLL  468

Query  337  YVPC  326
            Y+PC
Sbjct  469  YIPC  472



>gb|KJB12258.1| hypothetical protein B456_002G008600 [Gossypium raimondii]
Length=497

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+N+TVFD  +N+LTGPIP SFGCL+K+E LNL  N+ YG VPE +C+L +L+ 
Sbjct  333  PYEIGYLQNATVFDVGMNKLTGPIPHSFGCLKKMEQLNLAGNEFYGEVPEIVCRLSNLQN  392

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP CR+L+ KK L++ NNCILDLP QRS   C  FF     C   +S  
Sbjct  393  LSLSSNYFTQVGPACRDLVMKKKLNVKNNCILDLPEQRSKADCAMFFSRKLICDRTESFK  452

Query  337  YVPC  326
            ++PC
Sbjct  453  WIPC  456



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLL  + +FD S N+LTG IP SFGCL K++ILNL  NQ YG VPE +CKL +L+ 
Sbjct  304  PYEIGLLTKARIFDVSKNKLTGKIPHSFGCLAKMQILNLAQNQFYGPVPELVCKLSNLKN  363

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++G EC+ L+E+KVLD+  NCI  LP QRSA  C  FF   + CPD KSL 
Sbjct  364  LSLSYNYFTEVGSECKKLIERKVLDVRMNCIPGLPMQRSAAECAAFFCKPRSCPDEKSLE  423

Query  337  YVPCDI  320
             VPC I
Sbjct  424  IVPCRI  429



>ref|XP_010691719.1| PREDICTED: uncharacterized protein At4g06744-like [Beta vulgaris 
subsp. vulgaris]
Length=463

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK + VFD S N LTGPIP+SFGCLEK++ L + NN+ +G+VPE +C L  L++
Sbjct  308  PYEIGYLKKARVFDVSTNYLTGPIPRSFGCLEKMQNLVMANNEFFGAVPEEVCMLPHLKQ  367

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSL  NYFTQ+GPEC  L+ K VLD+ NNCIL LPNQ+S ++C  FF   + C + KSL 
Sbjct  368  LSLCNNYFTQVGPECMKLVHKGVLDVTNNCILGLPNQKSKEMCASFFKRPKTCGEEKSLT  427

Query  337  YVPC  326
             VPC
Sbjct  428  IVPC  431



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD  +NQLTGPIP SFGCL+K+E LNL  N+ YG++PE +C+L  L  
Sbjct  331  PYQIGNLNQATVFDVEVNQLTGPIPYSFGCLDKMEQLNLARNKFYGTIPEIVCELSCLMN  390

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L++  +LD+  NCILDLPNQ++   C  FF+  Q CP+  S+ 
Sbjct  391  LSLSYNYFTQVGPKCRTLIKSNILDVRMNCILDLPNQKTPMECAKFFMKKQTCPNSHSMF  450

Query  337  YVPC  326
             VPC
Sbjct  451  LVPC  454



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N+ +G++PE +C++  L+ 
Sbjct  356  PYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQLNLARNKFFGTIPEIVCEISSLKN  415

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS N+FTQ+GP+CRNL++K +LD+  NCILDLPNQ++   C +FF+    CP+ KS+ 
Sbjct  416  LSLSYNFFTQVGPKCRNLIKKNILDVRMNCILDLPNQKTPLECANFFMQKHICPNSKSMF  475

Query  337  YVPC  326
             +PC
Sbjct  476  RIPC  479



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N LTGPIP SFGCL+K+E LNL  N+ +G++PE +C++  L+ 
Sbjct  394  PYQIGKLNRATVFDVEYNNLTGPIPYSFGCLDKMEQLNLARNKFFGTIPEIVCEISSLKN  453

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF+    CP+ KS+ 
Sbjct  454  LSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKHTCPNSKSMF  513

Query  337  YVPC  326
             +PC
Sbjct  514  RIPC  517



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + VFDAS N+LTGP+P +  CLEK+E+LN T NQL+G VPE +C+L+ L  
Sbjct  290  PYEVGLLKEAIVFDASNNKLTGPLPVALSCLEKVELLNFTGNQLFGMVPEVVCELEKLRN  349

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT +GP CR+L  K VLDI NNCI  LP QRS   C DF  H + CP   S  
Sbjct  350  FSLSANYFTTLGPMCRDLFYKGVLDITNNCIPGLPFQRSVVECLDFIAHPKSCPRMWSYT  409

Query  337  YVPCDIDESPRKAG  296
            ++PC+   SP  +G
Sbjct  410  FIPCN---SPFSSG  420



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD S N LTGPIP SF CL K++ LNL NN  YG VPE +C L +L  
Sbjct  327  PYEIGYLNQATVFDVSSNFLTGPIPHSFSCLAKIDYLNLANNSFYGPVPEQVCTLSNLRN  386

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
              L+ NYFT++GPECR L++KKVLD+  NCIL  PNQ++   C  FF   +KCP+ K + 
Sbjct  387  FYLANNYFTEVGPECRKLIKKKVLDVRQNCILGQPNQKTKAQCTAFFSKPRKCPNEKEMT  446

Query  337  YVPC  326
            YVPC
Sbjct  447  YVPC  450



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD S N LTGPIP SF CL K+E LNL +N+ YG VPE +C L +L  
Sbjct  375  PYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGN  434

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SL+ NYFT++GPECR L++KK+LD+  NCIL  PNQ++   C  FF   +KCP+ K + 
Sbjct  435  FSLANNYFTEVGPECRKLMKKKLLDVRQNCILGEPNQKTKAQCNAFFSKPRKCPNEKEMT  494

Query  337  YVPC  326
            YVPC
Sbjct  495  YVPC  498



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N LTGPIP SFGCL+K+E  NL  N+ +G++PE +C++  L+ 
Sbjct  314  PYQIGKLNRATVFDVGYNNLTGPIPYSFGCLDKMEQFNLARNKFFGTIPEIVCEISSLKN  373

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS N+FTQ+GP+CRNL+++ +LD+  NCILDLPNQ++   C +FF+    CP+ KS+ 
Sbjct  374  LSLSYNFFTQVGPKCRNLIKRNILDVRMNCILDLPNQKTPLECANFFMRKLTCPNSKSMF  433

Query  337  YVPC  326
             +PC
Sbjct  434  RIPC  437



>ref|XP_003538630.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=437

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            P++IG L  +TVFD S N LTGPIP SF CL  ++ LNL +NQ YG VPE LC+L  L  
Sbjct  283  PFQIGYLVKATVFDVSKNSLTGPIPHSFACLASIQFLNLEHNQFYGEVPEMLCQLPGLRN  342

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSLS NYFTQ+GP CRNL++ KVLD+ NNCIL LPNQR    C +FF   + CP+ K
Sbjct  343  NGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCTEFFSKIKPCPNPK  402

Query  346  SLLYVPC  326
            +L YVPC
Sbjct  403  NLHYVPC  409



>ref|XP_010270780.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=495

 Score =   154 bits (388),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK +TVFDA  N LTGPIP SFGCLE++++LN T N+LYG VPE +C L  L  
Sbjct  339  PYEIGFLKKATVFDAGNNHLTGPIPYSFGCLERMQLLNFTGNKLYGPVPEVVCGLPSLAN  398

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSL  341
             SLS NYFTQ+GP+CR L++K  LDI NNCILDLP+QR A  C+ FF    K C D K+ 
Sbjct  399  FSLSDNYFTQVGPKCRELIKKGKLDIRNNCILDLPSQRPADHCEKFFSSNPKYCSDLKTN  458

Query  340  LYVPCDI  320
              +PC +
Sbjct  459  TMIPCRL  465



>gb|KJB32334.1| hypothetical protein B456_005G236100 [Gossypium raimondii]
Length=433

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD   N+LTGPIP SFGCL+K+E+LNL  N+ YG VPE +C+LK+L+ 
Sbjct  275  PYEIGNLSQATVFDVGSNKLTGPIPYSFGCLKKIELLNLACNEFYGEVPEIVCQLKNLQN  334

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP CR+L+ KK LD+ NNCILDLP QRS   C  FF     C    S  
Sbjct  335  LSLSYNYFTQVGPACRDLIMKKKLDVKNNCILDLPFQRSEAECTAFFSRNLYCDRKDSFK  394

Query  337  YVPC  326
            +VPC
Sbjct  395  WVPC  398



>gb|KHN05611.1| Hypothetical protein glysoja_047056 [Glycine soja]
Length=418

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            P++IG L  +TVFD S N LTGPIP SF CL  ++ LNL  NQ YG VPE LC+L  L  
Sbjct  264  PFQIGYLVKATVFDVSKNSLTGPIPHSFACLASIQFLNLERNQFYGEVPEMLCQLPGLRN  323

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSLS NYFTQ+GP CRNL++ KVLD+ NNCIL LPNQR    C +FF   + CP+ K
Sbjct  324  NGSLSLSDNYFTQVGPACRNLIKNKVLDVSNNCILGLPNQRPHGQCTEFFSKIKPCPNPK  383

Query  346  SLLYVPC  326
            +L YVPC
Sbjct  384  NLHYVPC  390



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD   N+LTGPIP SFGCL K+E+LNL NN+ YG+VPE +C+L  +E 
Sbjct  337  PYEIGYLSKATVFDVGSNKLTGPIPNSFGCLRKIELLNLANNEFYGAVPEIVCQLPKIEN  396

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPDHKSL  341
            LSL+ NYFTQ+GP CR L+ KK LD+ NNCILDLPNQ+S   C  FF      C   +S 
Sbjct  397  LSLANNYFTQVGPACRKLIWKKKLDVRNNCILDLPNQKSKDECAKFFSRPPLGCERKESF  456

Query  340  LYVPC  326
             +VPC
Sbjct  457  KWVPC  461



>ref|XP_003607916.1| Receptor protein kinase [Medicago truncatula]
Length=366

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            PYEIG LK +TVFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES+C L  ++ 
Sbjct  206  PYEIGYLKKATVFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPESVCVLSGIKN  265

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSL+GNYFT++ P C +LL+ K+LD+ NNCI  LPNQRS Q C +F    + C + +
Sbjct  266  NGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQCKIKPCSNPQ  325

Query  346  SLLYVPC  326
            SL YVPC
Sbjct  326  SLSYVPC  332



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK +TVFDA  NQLTGP+P S  CLE +E LN   N L+G VPE +C+L+ L  
Sbjct  284  PYEIGLLKEATVFDAGNNQLTGPLPLSLACLENVEQLNFAGNMLFGMVPELVCELQSLVN  343

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYF  +GP CR L+EK V+DI NNCI DLP QRS + C DFF H + CP   S  
Sbjct  344  LSLSDNYFITVGPLCRILIEKGVVDIRNNCIPDLPFQRSVEECADFFAHPKFCPRMWSYT  403

Query  337  YVPC  326
            Y PC
Sbjct  404  YSPC  407



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCL+K+E L+L  N  YG++PE +C++  L+ 
Sbjct  341  PYQIGNLNRATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEIVCEIACLKN  400

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF   Q C D KSL 
Sbjct  401  LSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQTCSDPKSLF  460

Query  337  YVPCDIDESPRKAG  296
             VPC  + +  K G
Sbjct  461  IVPCGKNPNRLKPG  474



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score =   150 bits (379),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCL K+E LNL  N+ YG++PE LC+L  L+ 
Sbjct  300  PYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLNLARNKFYGTIPEILCELSSLKN  359

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L++KK+LD+  NCILDL NQR+   C  FFL  QKCP+ K+  
Sbjct  360  LSLSSNYFTQVGPKCRTLIKKKILDVGMNCILDLANQRTPWECTKFFLRKQKCPNFKTFF  419

Query  337  YVPCDID  317
            Y+PC  D
Sbjct  420  YIPCGKD  426



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCL+K+E L+L  N  YG++PE +C++  L+ 
Sbjct  329  PYQIGNLNQATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEIVCEIACLKN  388

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF   Q C D KSL 
Sbjct  389  LSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQTCSDPKSLF  448

Query  337  YVPC  326
             VPC
Sbjct  449  IVPC  452



>gb|AES90113.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=460

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            PYEIG LK +TVFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES+C L  ++ 
Sbjct  300  PYEIGYLKKATVFDVSQNSLTGPIPASFGCLEKIQFLNLAHNKFYGTVPESVCVLSGIKN  359

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSL+GNYFT++ P C +LL+ K+LD+ NNCI  LPNQRS Q C +F    + C + +
Sbjct  360  NGNLSLAGNYFTKLEPACWSLLKSKILDVSNNCIPGLPNQRSKQECYEFQCKIKPCSNPQ  419

Query  346  SLLYVPC  326
            SL YVPC
Sbjct  420  SLSYVPC  426



>ref|XP_010500525.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=504

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCL+K+E L+L  N  YG++PE +C++  L+ 
Sbjct  343  PYQIGNLNRATVFDVESNRLTGPIPYSFGCLDKMEQLSLARNNFYGTIPEIVCEIACLKN  402

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+E+K+LD+  NCILDLPNQ+  + C  FF   Q C D KSL 
Sbjct  403  LSLSYNYFTQAGPKCRKLIERKILDVRMNCILDLPNQKRPEECAVFFKRKQTCSDPKSLF  462

Query  337  YVPC  326
             VPC
Sbjct  463  IVPC  466



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 83/124 (67%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK + VFDA  NQLTGPIP S GCL+K+E+LN   N LYG VPE +C L +L  
Sbjct  275  PYELGFLKEAVVFDAGNNQLTGPIPFSLGCLKKVEVLNFAGNYLYGMVPEVVCALGNLAN  334

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP C NL++K VLD+  NCI  LP QRS   C  FF   + CP   +  
Sbjct  335  LSLSDNYFTTVGPICWNLIKKGVLDVRKNCIAGLPFQRSVWECAHFFARPRYCPYWAAFT  394

Query  337  YVPC  326
            Y+PC
Sbjct  395  YIPC  398



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK   +FDAS N LTGP+P S GCL K+E LNLT N LYG VPE +C L++L  
Sbjct  262  PYELGFLKELVLFDASNNLLTGPLPCSLGCLTKIEQLNLTGNLLYGQVPEVVCALENLAN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP C  L++  VLDI  NCIL LPNQRS   C  FFLH + CP H +LL
Sbjct  322  LSLSNNYFTKLGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFFLHPRYCPYHPTLL  381

Query  337  -YVPCDIDE  314
             ++PC + +
Sbjct  382  NFIPCKVHQ  390



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=411

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+++TVFDA  NQLTGP+P S GCL+K+E LN  +N LYG VPE LC+L +L  
Sbjct  267  PYELGFLRDATVFDAGNNQLTGPLPCSLGCLDKIEQLNFADNFLYGRVPEVLCELGNLAN  326

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +G  CR L+EK VLDI NNCI DL +QRSA+ C  FFLH + C   ++  
Sbjct  327  LSLSNNYFTGVGTACRKLIEKGVLDIRNNCIQDLADQRSAEECALFFLHPKSCLHPETYS  386

Query  337  YVPC  326
             +PC
Sbjct  387  LIPC  390



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK +TVFD S N LTGPIP SF CL KLE L+L +NQ YG VP+++CK ++LE 
Sbjct  249  PYEIGYLKKATVFDVSSNILTGPIPNSFACLGKLEYLSLASNQFYGRVPDAVCKFRNLER  308

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             S + NYFT+IGP C  L+ K++LD+  NCI  LPNQ++A  C  FF   + CP  ++L 
Sbjct  309  FSAANNYFTRIGPACLALIRKRILDVRGNCIPGLPNQKTAAQCAAFFSIPRTCPRPRTLS  368

Query  337  YVPC  326
             +PC
Sbjct  369  IIPC  372



>ref|XP_010263446.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=474

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK +TVFDA  N LTGPIP SFGCL+++++L+   N+LYG VPE +C L  L  
Sbjct  317  PYEIGLLKKATVFDAGNNHLTGPIPYSFGCLKRMQLLSFAGNKLYGQVPEVVCALPKLAN  376

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF-LHYQKCPDHKSL  341
            LSLS NYFTQ+GP+CR+L++K  L ++NNCILDL +QRS   C+ FF    + C   K+ 
Sbjct  377  LSLSDNYFTQVGPKCRHLIKKGRLHLENNCILDLKSQRSPAECEKFFSSSMEYCSYEKTF  436

Query  340  LYVPCDIDESPRKA  299
              +PC +    +KA
Sbjct  437  NVIPCKLRHHSKKA  450



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK   +FDAS N LTGP+P S GCL K+E LNLT N LYG VPE +C L++L  
Sbjct  262  PYELGFLKELVLFDASNNLLTGPLPCSLGCLTKIEQLNLTGNLLYGQVPEVVCALENLAN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP C  L++  VLDI  NCIL LPNQRS   C  FFLH + CP H +L 
Sbjct  322  LSLSNNYFTKVGPLCWKLVKSGVLDIRQNCILGLPNQRSFHECFIFFLHPRYCPYHPTLF  381

Query  337  -YVPCDIDE  314
             ++PC + +
Sbjct  382  NFIPCKVHQ  390



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 85/133 (64%), Gaps = 0/133 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK + VFD   NQLTG +P S  CLEK+E LN  NN L+G VPE++C L +L  
Sbjct  294  PYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLH  353

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF H + CP   S  
Sbjct  354  FSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYT  413

Query  337  YVPCDIDESPRKA  299
            Y+PC     P  A
Sbjct  414  YIPCKPYYIPEMA  426



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK + VFDA  NQLTGP+P S  CLE  E LN   N LYG VPE +C L++L +
Sbjct  287  PYEIGLLKEAIVFDAGNNQLTGPLPFSLACLENAEQLNFAGNLLYGMVPEVVCGLQNLVD  346

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L+ + VLD+ NNCI DLP Q+S + C DFF H + CP   S  
Sbjct  347  LSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFFAHPRFCPYMGSYT  406

Query  337  YVPC  326
            Y+PC
Sbjct  407  YIPC  410



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK + VFDA  NQLTGP+P S  CLE LE LNL  N L+G+VPE LC+L  L  
Sbjct  302  PYEIGLLKEAVVFDAGNNQLTGPLPFSLACLENLEQLNLAGNLLFGTVPEVLCELGKLVN  361

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYF  +GP CR L+E++VLD+ NNCI  LP QRS   C +FF H   CP   S  
Sbjct  362  LSLSDNYFIHVGPLCRILIERRVLDVRNNCIPGLPFQRSIVECANFFAHPMFCPRMWSYT  421

Query  337  YVPC  326
            ++PC
Sbjct  422  FIPC  425



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 85/133 (64%), Gaps = 0/133 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK + VFD   NQLTG +P S  CLEK+E LN  NN L+G VPE++C L +L  
Sbjct  294  PYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLH  353

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF H + CP   S  
Sbjct  354  FSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVSECADFFAHPRFCPHMWSYT  413

Query  337  YVPCDIDESPRKA  299
            Y+PC     P  A
Sbjct  414  YIPCKPYFIPEMA  426



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL  +TVFD S N LTGPIP SF CL K+EILNL  NQ +G VP+ +C+L +LE 
Sbjct  294  PCEIGLLNKATVFDVSRNLLTGPIPWSFACLAKMEILNLAKNQFFGVVPDPICQLPNLES  353

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
              LS NYFT +GPEC  L+++KVLD+  NCI  LPNQRS   C  FF   + C +  SL 
Sbjct  354  FDLSSNYFTGVGPECWKLIQRKVLDVTMNCIPGLPNQRSKAECDAFFCKPRSCSNQGSLT  413

Query  337  YVPC  326
            +VPC
Sbjct  414  WVPC  417



>gb|KHN30415.1| Hypothetical protein glysoja_033153 [Glycine soja]
Length=384

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD S N LTGPIP SF CL+ ++ LNL  NQ YG VPE LC L  L  
Sbjct  229  PYQIGYLDKATVFDVSKNSLTGPIPHSFACLQSIQYLNLDRNQFYGEVPEMLCLLPGLRN  288

Query  517  ---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSLS NYFTQ+GP CRNL++  VLD+  NCIL LPNQR    C +FF   + CP+ K
Sbjct  289  NGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCTEFFSKIKPCPNPK  348

Query  346  SLLYVPC  326
             L YVPC
Sbjct  349  YLHYVPC  355



>ref|XP_004137106.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=398

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +F+AS N LTGPIP SF CL K+EILN   N LYG++PE +CKL +L++
Sbjct  247  PMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKLPNLQK  306

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF     CPD KS+ 
Sbjct  307  FNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHSCPDEKSMK  366

Query  337  YVPC  326
             +PC
Sbjct  367  IIPC  370



>ref|XP_008454972.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=428

 Score =   147 bits (371),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +F+AS N LTGPIP SF CL K++ILN ++N LYG+VPE +CKL +L+ 
Sbjct  278  PMEIGLLENTVLFNASKNSLTGPIPYSFCCLTKMQILNFSDNNLYGAVPEDVCKLPNLQR  337

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +L  N+FTQ+GP CR+L+ K VLD+  NCIL LP QR  + C  FF     CPD KS+ 
Sbjct  338  FNLRNNFFTQVGPICRSLIWKDVLDVSGNCILGLPKQRPEKECTYFFSKPHSCPDDKSMK  397

Query  337  YVPC  326
             +PC
Sbjct  398  IIPC  401



>ref|XP_003516778.2| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=463

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD S N LTGPIP SF CL+ ++ LNL  NQ YG VPE LC L  L  
Sbjct  308  PYQIGYLDKATVFDVSKNSLTGPIPHSFACLQSIQYLNLDRNQFYGEVPEMLCLLPGLRN  367

Query  517  ---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSLS NYFTQ+GP CRNL++  VLD+  NCIL LPNQR    C +FF   + CP+ K
Sbjct  368  NGNLSLSDNYFTQVGPACRNLIKTNVLDVSYNCILGLPNQRPHGQCTEFFSKIKPCPNPK  427

Query  346  SLLYVPC  326
             L YVPC
Sbjct  428  YLHYVPC  434



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + VFDAS N+LTGP+P +  CLEK+E+L+ T NQL+G VPE +C+LK L  
Sbjct  290  PYEVGLLKEAIVFDASNNELTGPLPVALSCLEKVELLSFTCNQLFGMVPEVICELKKLRN  349

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT +GP CR L  + VLD+ NNCI  LP QRS   C DF  H + CP   S  
Sbjct  350  FSLSDNYFTALGPVCRELFYEGVLDVTNNCIPGLPFQRSVVECLDFIAHPKSCPWMWSYT  409

Query  337  YVPCDI  320
            ++PC +
Sbjct  410  FIPCKL  415



>ref|XP_004171357.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=466

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +F+AS N LTGPIP SF CL K+EILN   N LYG++PE +CKL +L++
Sbjct  315  PMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKLPNLQK  374

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF     CPD KS+ 
Sbjct  375  FNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHSCPDEKSMK  434

Query  337  YVPC  326
             +PC
Sbjct  435  IIPC  438



>gb|KGN43905.1| hypothetical protein Csa_7G073410 [Cucumis sativus]
Length=468

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+N+ +F+AS N LTGPIP SF CL K+EILN   N LYG++PE +CKL +L++
Sbjct  317  PMEIGLLENTVLFNASKNCLTGPIPYSFCCLTKMEILNFFGNNLYGAIPEDVCKLPNLQK  376

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS N+ TQ+GP CR+L+ K +LD+  NCIL LP QR  + C +FF     CPD KS+ 
Sbjct  377  FNLSNNFITQVGPVCRSLIWKNILDVSGNCILGLPKQRPEKECTNFFSKAHSCPDEKSMK  436

Query  337  YVPC  326
             +PC
Sbjct  437  IIPC  440



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK + VFDA  N+LTG +P S  CL+K+E LN   N L+G VPE +CK+++L  
Sbjct  299  PYEIGLLKEAVVFDAGNNRLTGSLPLSLACLQKVEQLNFAGNLLFGMVPELVCKMENLVN  358

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L+ K VLD+ NNCI DLP QRS   C +FF H + CP   S  
Sbjct  359  LSLSDNYFTTVGPWCRILIAKGVLDVRNNCIPDLPFQRSIMECANFFAHPRFCPHMWSYT  418

Query  337  YVPC  326
            Y+PC
Sbjct  419  YIPC  422



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + VFDA  N LTGP+P S GCL K+E+LN   N LYG +PE +C +  L  
Sbjct  262  PYELGLLKEAVVFDAGNNLLTGPLPCSLGCLRKIEVLNFAGNLLYGKIPEQICAVGSLVN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SL  NYFT +GPECR +++ +VLD+  NCI  LP QRSA+ C  FFL  + C    S  
Sbjct  322  FSLFDNYFTSVGPECRKMIKSRVLDVRKNCIRGLPEQRSAEECASFFLKPRSCSHPSSFT  381

Query  337  YVPCDIDESPRKAG  296
            ++PC++  S    G
Sbjct  382  FMPCEVQPSSESDG  395



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK +TVFD S N LTGPIP SF CL KLE L+L +NQ YG VPE++C L+ LE 
Sbjct  260  PYEIGYLKQATVFDVSSNILTGPIPNSFACLGKLEYLSLASNQFYGRVPEAVCGLRHLER  319

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             + + NYFT+IGP C  L+ KK+LD+  NC+  LPNQ++A  C  FF   + CP    L 
Sbjct  320  FNAANNYFTRIGPACMTLIRKKILDVRGNCLPGLPNQKTAAQCAAFFSIPRTCPRRTRLS  379

Query  337  YVPC  326
             +PC
Sbjct  380  IIPC  383



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLL ++TVFD   N LTGPIP SF CLEK+E+L L  NQ YG +PE +C L +L  
Sbjct  311  PYEIGLLTSATVFDVGNNFLTGPIPCSFACLEKMEVLKLAGNQFYGKIPEEVCGLGNLAN  370

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF-FLHYQKCPD---H  350
            LSLS NYF  +GP CR+L+++ VLD+ NNCI  LPNQR A  C DF + H + CP     
Sbjct  371  LSLSDNYFRYLGPTCRSLIKRGVLDVSNNCIHGLPNQRPAAECWDFYYFHLKHCPSSLPR  430

Query  349  KSLLYVPCDIDES  311
             +   VPC+I+ S
Sbjct  431  YNANVVPCNINHS  443



>ref|XP_004505256.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=470

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 94/136 (69%), Gaps = 3/136 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            P+EIG LK +TVFD S N LTGPIP SFGCLEK++ LNL +N+ YG+VPES+C L  +  
Sbjct  309  PFEIGYLKKATVFDVSQNLLTGPIPASFGCLEKIQFLNLASNKFYGTVPESVCVLPGIRN  368

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSLS NYFT IGP C +L++ ++LD+  NCI  +PNQRS + C +F    + C +H+
Sbjct  369  NGNLSLSDNYFTSIGPACWSLIKYRILDVSKNCIPGIPNQRSPRECYEFQCKKKACSNHE  428

Query  346  SLLYVPCDIDESPRKA  299
            SL YVPC      +++
Sbjct  429  SLSYVPCKTHWGNKQS  444



>ref|XP_004142874.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004156371.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN62484.1| hypothetical protein Csa_2G356090 [Cucumis sativus]
Length=438

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 95/161 (59%), Gaps = 0/161 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+ILNL NNQ YG++PES+C+L D+  
Sbjct  275  PFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLANNQFYGTIPESICRLPDIYN  334

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF   + CP   +  
Sbjct  335  ITLSNNYFTRIGPVCRKLVIAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPRTCPRANTFS  394

Query  337  YVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  215
            YVPC +  +                    S  +YAAL++ R
Sbjct  395  YVPCVLPTAAEAVQLDKAKVTSVDDMVPPSPRSYAALEMPR  435



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N+ YG++PE +C+L  L+ 
Sbjct  320  PYQIGKLNRATVFDVGFNQLTGLIPYSFGCLAKIEQLNLARNKFYGTIPEIVCELSSLKN  379

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+++ +LD   NCI+ LPNQ++AQ C  FF+H Q CPD KS+ 
Sbjct  380  LSLSYNYFTQAGPKCRELIKRSILDARMNCIIGLPNQKTAQECATFFMHRQTCPDPKSMY  439

Query  337  YVPC  326
             VPC
Sbjct  440  LVPC  443



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK + VFDA  NQLTGP+P S  CLE +E LN   N  YG VPE +C L++L  
Sbjct  322  PYEIGLLKEAIVFDAGNNQLTGPLPFSLACLESVEQLNFAGNLFYGMVPEVVCGLQNLVN  381

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L+ + VLD+ NNCI DLP Q+S + C DFF   + CP   S +
Sbjct  382  LSLSDNYFTNVGPLCRMLIGRGVLDVRNNCIPDLPFQKSIEECADFFARPRLCPYMGSYI  441

Query  337  YVPC  326
            Y+PC
Sbjct  442  YIPC  445



>gb|KJB14612.1| hypothetical protein B456_002G134000 [Gossypium raimondii]
Length=422

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIGLLK + VFDA  NQLTG +P S  C+E LE LN   N L+G+VPE +C+L  L  
Sbjct  283  PYEIGLLKEAVVFDAGNNQLTGHLPFSLACMENLEQLNFAGNLLFGAVPEVVCELGKLMN  342

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYF  +GP CR L+E+ VLD+ NNCI DLP QRS + C +FF H + CP   S  
Sbjct  343  LSLSENYFIHVGPMCRILIERGVLDVRNNCIPDLPFQRSVEECANFFAHPRFCPRMWSYN  402

Query  337  YVPC  326
            Y+PC
Sbjct  403  YIPC  406



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 82/123 (67%), Gaps = 0/123 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK + VFD   NQLTG +P S  CLEK+E LN  NN L+G VPE++C L +L  
Sbjct  273  PYEIGYLKEAVVFDVGDNQLTGQLPFSLACLEKVEQLNFANNLLFGMVPEAVCGLPNLLH  332

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT  GP CR L+EK VLD+ NNCI DLP QRS   C DFF H + CP   S  
Sbjct  333  FSLSDNYFTHAGPLCRFLIEKGVLDVRNNCIPDLPFQRSVAECADFFAHPRFCPHMWSYT  392

Query  337  YVP  329
            Y+P
Sbjct  393  YIP  395



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N+ YG++PE +C+L  L+ 
Sbjct  314  PYQIGKLNQATVFDVGFNQLTGLIPYSFGCLAKMEQLNLARNKFYGTIPEIVCELSSLKN  373

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+++ +LD+  NCILDLPNQ++A  C  FF+  Q CPD KS+ 
Sbjct  374  LSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKTASECSTFFMQRQTCPDPKSMY  433

Query  337  YVPC  326
             +PC
Sbjct  434  LIPC  437



>gb|KJB14611.1| hypothetical protein B456_002G133900 [Gossypium raimondii]
Length=441

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L  +TVFD   N+LTGPIP+SFGC+ KL++LN+ +N+ YG+VPE LC+L +   
Sbjct  285  PFEIGYLNRTTVFDVGSNRLTGPIPESFGCMAKLQLLNMAHNRFYGAVPEVLCRLPNAFN  344

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYFTQ+GP+CR L++ + L+++ NCI+ LP QRSA  C +FF   + C    +  
Sbjct  345  FTLSNNYFTQVGPQCRRLIKLRRLNVNRNCIMGLPFQRSATDCANFFSKPRSCARESTFS  404

Query  337  YVPCDIDES  311
             +PC +  +
Sbjct  405  IIPCRLPAA  413



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   NQLTG IP SFGCL K+E LNL  N+ YG++PE +C+L  L+ 
Sbjct  314  PYQIGKLNRATVFDVGFNQLTGLIPYSFGCLAKMEQLNLARNKFYGTIPEIVCELSSLKN  373

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ GP+CR L+++ +LD+  NCILDLPNQ+ A  C  FF+  Q CPD KS+ 
Sbjct  374  LSLSYNYFTQAGPKCRELIKRNILDVRMNCILDLPNQKMASECSTFFMQRQTCPDPKSMY  433

Query  337  YVPC  326
             +PC
Sbjct  434  LIPC  437



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 86/132 (65%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LKN T+FD   N LTGPIP SFGCL+K+E LNL  N LYG VPE +C L +L  
Sbjct  262  PYEIGFLKNLTLFDVGGNLLTGPIPWSFGCLKKVEQLNLARNFLYGQVPEVVCALGNLAN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT++GP C+ L+++ VLD+  NCI  LP+QRS + C  FFL  + C       
Sbjct  322  FSLSYNYFTKVGPLCKMLIQRGVLDVRKNCIFGLPDQRSVRECMAFFLIPKSCSHPALFN  381

Query  337  YVPCDIDESPRK  302
            +VPC I     K
Sbjct  382  FVPCQIQHHWTK  393



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCL K+E L L  N+ YG++PE LC+L  L+ 
Sbjct  300  PYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLILARNKFYGTIPEILCELSSLKN  359

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+++K+LD+  NCI DL NQR+   C  FF+  Q CP+ KS  
Sbjct  360  LSLSSNYFTQVGPKCRTLIKRKILDVGRNCIQDLANQRTWWECARFFMRRQNCPNSKSFF  419

Query  337  YVPCDID  317
            Y+PC  D
Sbjct  420  YIPCGKD  426



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK + VFDA  N+LTGP+P S GCLEK+E+LN   N+LYG VP+ +C L +L  
Sbjct  242  PYELGFLKQAVVFDAGNNRLTGPLPFSLGCLEKVEVLNFAGNKLYGIVPDVICALGNLAN  301

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP C +L+   VLD+ NNCI  LP QRS   C +FF + + CP   +  
Sbjct  302  LSLSDNYFTGVGPICLSLIRNGVLDLKNNCIPGLPFQRSFAECVEFFAYPRYCPHMATYS  361

Query  337  YVPC  326
            Y+PC
Sbjct  362  YIPC  365



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 84/126 (67%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK   +FDAS N LTGP+P S GCL K+E LNL  N LYG VPE +C L +L  
Sbjct  264  PYEIGFLKELALFDASNNLLTGPLPCSLGCLAKIEQLNLAGNFLYGQVPEVVCALGNLAN  323

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT+IGP C  L++  VLDI NNCI  LP+QRS   C  FFLH + CP      
Sbjct  324  LSLSNNYFTKIGPLCWKLVKTGVLDIRNNCIHGLPDQRSWHECFFFFLHPKYCPYPSFFH  383

Query  337  YVPCDI  320
            ++PC I
Sbjct  384  FIPCKI  389



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+   +FDA  N LTGP+P S GCL KLE  NLT N LYG VPE +C L  L  
Sbjct  266  PYELGFLRELVLFDAGNNLLTGPLPCSLGCLAKLEQFNLTGNLLYGQVPEVVCALGKLVN  325

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP CR L++  VLDI  NCI DLP+QRS   C+ F L  + CP+ +S  
Sbjct  326  LSLSSNYFTELGPTCRKLVDSGVLDIKKNCIHDLPDQRSVLECEAFSLQRRYCPNPESFN  385

Query  337  YVPCDIDESP  308
             +PC +  SP
Sbjct  386  LIPCKVPSSP  395



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  +TVFD   N LTGPIPQSFGCL  L+ LNL +NQLYG +PESLC+L +   
Sbjct  280  PYEIGFLGQATVFDVGGNLLTGPIPQSFGCLRNLQYLNLAHNQLYGLIPESLCRLPNAYN  339

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS N+FTQ+G +CR L+    L++  NCIL LP+Q+S   C  FF   + CP   +  
Sbjct  340  FTLSYNFFTQVGVQCRRLIRAGTLNVRRNCILGLPDQKSTAECGRFFSRARTCPRENTFS  399

Query  337  YVPCDIDES  311
             V C+I  +
Sbjct  400  IVTCNISAT  408



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGPIP SFGCL K+E LNL  N+ YG++PE LC+L  L+ 
Sbjct  300  PYQIGNLNRATVFDVESNELTGPIPYSFGCLNKMEQLNLARNKFYGTIPEILCELSSLKN  359

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+++K+LD+  NCI  L NQR+   C  FF+  + CP+ KS  
Sbjct  360  LSLSSNYFTQVGPKCRTLIKRKILDVGMNCIRGLANQRTWWECARFFMRRKNCPNSKSFF  419

Query  337  YVPCDID  317
            Y+PC  D
Sbjct  420  YIPCGKD  426



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L    +FDA  N LTGP+P S GCL KLE  NLT N LYG VPE +C L  L  
Sbjct  266  PYELGFLSELVLFDAGNNLLTGPLPCSLGCLAKLEQFNLTGNLLYGQVPEVVCALGKLVN  325

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP CR L+   VLDI  NCI DLP+QRS   C  F LH + CP+  S  
Sbjct  326  LSLSSNYFTELGPTCRKLVNSGVLDIKKNCIHDLPDQRSVLECDAFSLHPRYCPNPASFN  385

Query  337  YVPCDIDESP  308
             +PC +  SP
Sbjct  386  LIPCKVPSSP  395



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 81/124 (65%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + VFDA  N LTGP+P S  CLEKLE+LN   N LYG +PE LC L +L  
Sbjct  281  PYELGLLKQAVVFDAGNNYLTGPLPFSLACLEKLEVLNFAGNLLYGHIPEVLCGLGNLAN  340

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP C  L++  VLD+  NCI  LP QRS   C  FF H + CP   +  
Sbjct  341  LSLSDNYFTGVGPVCWRLIKNGVLDVKKNCIPGLPFQRSVAECAAFFAHPRYCPYMPTYA  400

Query  337  YVPC  326
            ++PC
Sbjct  401  HIPC  404



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+ILNL +NQ YG++PES+C+L D+  
Sbjct  275  PFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLADNQFYGTIPESICRLPDIYN  334

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF   + CP   +  
Sbjct  335  ITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPRTCPRANTFS  394

Query  337  YVPC  326
            YVPC
Sbjct  395  YVPC  398



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK  TVFD S NQLTGP+P S  CLE++ +L+++ N LYG VP+ LC+L +L +
Sbjct  333  PYELGFLKQVTVFDISRNQLTGPLPFSLACLERVALLDVSENLLYGMVPDMLCQLPNLGK  392

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L LS NYFTQ+GP CRNL+ + +LD+ NNC+ DLP QRS   C  FF   + CP   +  
Sbjct  393  LDLSDNYFTQVGPACRNLISRGILDVKNNCVPDLPYQRSVFECASFFAVPKNCPYMDTFK  452

Query  337  YVPC  326
             +PC
Sbjct  453  IIPC  456



>ref|XP_008444596.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=507

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 96/162 (59%), Gaps = 5/162 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L  +TVFDA+ N LTGPIPQSFGCL  L+ILNL +NQ YG++PES+C+L D+  
Sbjct  347  PFEIGYLVKATVFDANTNILTGPIPQSFGCLFSLQILNLADNQFYGTIPESICRLPDIYN  406

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            ++LS NYFT+IGP CR L+  + L I  NCI     Q++   C  FF   + CP   +  
Sbjct  407  ITLSNNYFTRIGPVCRKLVTAQRLHIQGNCIPGFRLQKTQSQCAAFFAKPRTCPRANTFS  466

Query  337  YVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDRP  212
            YVPC +   P  A                S  +YAAL  +RP
Sbjct  467  YVPCVL---PTAAQLDKATVTSVDDMVPPSPRSYAAL--ERP  503



>gb|KHN12808.1| Hypothetical protein glysoja_008771 [Glycine soja]
Length=224

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LN   N LYG VPE +C  L +L 
Sbjct  90   PYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNFGGNLLYGMVPEVVCVGLVNLV  149

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   + CP     
Sbjct  150  NFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCPFMWFH  209

Query  340  LYVPCDI  320
              +PC +
Sbjct  210  GLIPCKL  216



>ref|XP_007157716.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
 gb|ESW29710.1| hypothetical protein PHAVU_002G092300g [Phaseolus vulgaris]
Length=413

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L N  + D   N LTGPIP SFGCL+K+E LNL  N LYG VPE +C L +L  
Sbjct  262  PYDIGFLGNVRLLDVGGNLLTGPIPWSFGCLKKVEQLNLARNFLYGQVPEVVCALGNLAN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP C++L+++ VLD+ NNCI+ LP+QRSA+ C  FF   + C    S  
Sbjct  322  LSLSYNYFTKVGPSCKSLIQRGVLDVRNNCIVGLPDQRSAKECMAFFSIPRSCLHPASFN  381

Query  337  YVPCDIDES-PRK  302
             +PC I  + PR+
Sbjct  382  IIPCQIHWTKPRE  394



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK++T+FDA  NQLTGP+P S GCLEK+E LN   N LYG VPE +C+L +L  
Sbjct  278  PYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNLLYGKVPEVVCELGNLAN  337

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L++  VLD+  NCI DL +QRS + C  F  H + C   +S  
Sbjct  338  LSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEECASFSSHPRSCLHPESFS  397

Query  337  YVPCDIDESPRKAG  296
             +PC +   P+  G
Sbjct  398  VMPCKV--PPKSKG  409



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + V D   N LTGP+P+S GCLE +E LN   N LYG VPE +C LK+L  
Sbjct  244  PYELGLLKKAIVIDVGFNTLTGPLPRSLGCLESVEQLNFAGNLLYGQVPEVICSLKNLVN  303

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYFT++GP CR L++  VL+++ NCI  LPNQRS   C  F +  + CP  KSL 
Sbjct  304  FTLSYNYFTKVGPLCRELIDNGVLNVEKNCINGLPNQRSILECVLFRMQIKLCPLQKSLR  363

Query  337  YVPCDIDE-SPRK  302
             +PC+I   SP +
Sbjct  364  IIPCNISNFSPHR  376



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+N  +FDAS N LTG +P S GCL KLE  NL +N LYG VPE LC L  L  
Sbjct  266  PYELGFLRNLVLFDASNNFLTGHLPCSLGCLAKLEQFNLASNLLYGQVPEVLCALGKLVN  325

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP+C  L ++ VLDI  NCI DLP QRSA+ C  F LH + C +  S  
Sbjct  326  LSLSSNYFTKLGPKCGELEKRGVLDIRKNCIPDLPGQRSARECAAFSLHPRYCSNPASFN  385

Query  337  YVPCDIDES  311
            Y+PC +  S
Sbjct  386  YIPCKVPSS  394



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKDLE  521
            PYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LNL  N LYG VPE +C  L +L 
Sbjct  294  PYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNLLYGMVPEVVCAGLVNLV  353

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   + CP     
Sbjct  354  NFSLSDNYFTHVGPLCRILIQRGVLDVRNNCIPDLPFQRSVIECAEFFATPRMCPFMWFY  413

Query  340  LYVPCDI  320
             ++PC +
Sbjct  414  SFIPCKL  420



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIGLLK + V D   NQLTGP+P S  CLE +E LN   N L+G VPE +C +L+ LE
Sbjct  323  PYEIGLLKQALVLDVGNNQLTGPLPFSLACLENVEQLNFAGNLLHGMVPEVVCHELQSLE  382

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR+L+ K VLD+ NNC+ DLP QR  + C DFF H + CP   + 
Sbjct  383  NFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLPFQRPVEECADFFAHPRFCPFMWTY  442

Query  340  LYVPC  326
             Y+PC
Sbjct  443  TYIPC  447



>gb|KDP41694.1| hypothetical protein JCGZ_16101 [Jatropha curcas]
Length=438

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 83/132 (63%), Gaps = 0/132 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L+ +TV D   N LTGPIPQSFGCL KL+ILNL +N  YG +PE LC+L +   
Sbjct  283  PFEIGYLQKATVLDFGTNLLTGPIPQSFGCLAKLQILNLAHNMFYGPIPEVLCRLPNAFN  342

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +L+ NYFTQ+GP+CR L+  + L+++ NCI  L  QR A  C  FF   + C    S  
Sbjct  343  FTLTYNYFTQVGPQCRRLIRARRLNVNRNCIFGLTGQRPAAECARFFARPRTCARESSFS  402

Query  337  YVPCDIDESPRK  302
             +PC +  S  K
Sbjct  403  LIPCSLPASSMK  414



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LNL  N LYG VPE +C  L +L 
Sbjct  276  PYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNMLYGMVPEVVCVGLVNLV  335

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   + CP     
Sbjct  336  NFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCPFMWFH  395

Query  340  LYVPCDI  320
              +PC +
Sbjct  396  GLIPCKL  402



>ref|XP_006354850.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=384

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 80/124 (65%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  + VFDA  N+LTGP+P S GCLE +E+LN   NQ+YG VP+ +C L +L  
Sbjct  244  PYEIGFLNEAIVFDAGNNRLTGPLPFSLGCLENVEMLNFARNQMYGIVPDVICALGNLAN  303

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT  GP C  L+E  VLD+ NNCI   P QRS   C  FF + + CP   +  
Sbjct  304  LSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFFAYPRYCPHMATYT  363

Query  337  YVPC  326
            Y+PC
Sbjct  364  YIPC  367



>ref|XP_010664550.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Vitis 
vinifera]
Length=425

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 92/161 (57%), Gaps = 3/161 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+ +TVFDA  N LTGPIPQSF CL+KL++L+L +NQ YG +P+SLC+L +   
Sbjct  268  PYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQLLSLAHNQFYGRIPDSLCRLPNAYN  327

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYF  IGP C+ L+    LD+  NCI  LPNQRSA  C  F+   + CP   S  
Sbjct  328  FTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFYSVSRTCPRPGSFN  387

Query  337  YVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  215
             + C    +P  +                S  TY AL+  R
Sbjct  388  VITC---SNPAASLSSAQVASLQAMAPAPSPVTYKALEPPR  425



>ref|XP_002284965.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Vitis 
vinifera]
 emb|CAN61024.1| hypothetical protein VITISV_001144 [Vitis vinifera]
 emb|CBI19481.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 92/161 (57%), Gaps = 3/161 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+ +TVFDA  N LTGPIPQSF CL+KL++L+L +NQ YG +P+SLC+L +   
Sbjct  280  PYEIGFLQMATVFDAGFNTLTGPIPQSFACLKKLQLLSLAHNQFYGRIPDSLCRLPNAYN  339

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYF  IGP C+ L+    LD+  NCI  LPNQRSA  C  F+   + CP   S  
Sbjct  340  FTLSYNYFNSIGPYCKRLVNIGRLDVRRNCITGLPNQRSAAECTAFYSVSRTCPRPGSFN  399

Query  337  YVPCDIDESPRKAGphphphrpykkhkRGSSTTYAALKVDR  215
             + C    +P  +                S  TY AL+  R
Sbjct  400  VITC---SNPAASLSSAQVASLQAMAPAPSPVTYKALEPPR  437



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+ + VFDAS N+LTGP+P S GCLEK+E LNL+ N LYG VPE LC L +L  
Sbjct  206  PYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEVLCALDNLVN  265

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FFL  + C       
Sbjct  266  LSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPRFCFYPSWYN  325

Query  337  YVPCD  323
            ++PC 
Sbjct  326  FIPCS  330



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LNL  N LYG VPE +C  L +L 
Sbjct  301  PYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNLGGNMLYGMVPEVVCVGLVNLV  360

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   + CP     
Sbjct  361  NFSLSDNYFTHVGPLCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCPFMWFH  420

Query  340  LYVPCDI  320
              +PC +
Sbjct  421  GLIPCKL  427



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+   +FDAS N LTGP+P S GCL KLE  NL +N LYG VPE +C L  L  
Sbjct  266  PYELGFLRKLVLFDASYNFLTGPLPCSLGCLAKLEQFNLASNLLYGQVPEVVCALGKLVN  325

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT++GP+C  L    VLDI  NCI DLP QRSA+ C  F LH + C +  S  
Sbjct  326  LSLSSNYFTKLGPKCTKLERSGVLDIRKNCIPDLPGQRSARECAAFSLHRRYCSNPASFN  385

Query  337  YVPCDI  320
            ++PC +
Sbjct  386  FIPCKV  391



>gb|KEH30896.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=413

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 0/131 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LKN  +FDA  N LTGP+P S GCL+K+E LN   N LYG VPE +C L +LE 
Sbjct  263  PYEIGFLKNLQLFDAGNNLLTGPLPFSLGCLKKVEQLNFARNMLYGQVPEVVCSLGNLEN  322

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+LS NYF ++GP CR L++  VLD+  NCI DLP+QR  + C  F+   + C    S  
Sbjct  323  LTLSYNYFNRVGPLCRKLIKSGVLDVKKNCIFDLPDQRPMEDCVKFYAVPRTCLGSGSFT  382

Query  337  YVPCDIDESPR  305
             +PC +   PR
Sbjct  383  VIPCQLPMKPR  393



>ref|XP_003529407.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=449

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            P+EIG LK + VFD S N LTGPIP SFGCL+K++ LNL +N+LYG VP++LC++  +  
Sbjct  293  PFEIGYLKKAVVFDISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDNLCQIPSIRN  352

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSL+ NYF +IGP C +L++ KVLD+  NCI  LPNQ+S + C  F+   + CP+  
Sbjct  353  NGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYKTKKTCPNPN  412

Query  346  SLLYVPC  326
            S  YVPC
Sbjct  413  SFYYVPC  419



>ref|XP_009396708.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 88/136 (65%), Gaps = 8/136 (6%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIG L  +TVFDA  NQ+TGPIP SFGCL KLE LNL  N LYG VP+ +C+L    +
Sbjct  287  PYEIGFLSIATVFDAGFNQMTGPIPWSFGCLLKLEQLNLAGNLLYGEVPDVVCRLAKDGN  346

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKC-PDH  350
            L  LSLSGNYFT +G  C +L++ KVLD+  NCI  LP QRS   C  F+   ++C P H
Sbjct  347  LANLSLSGNYFTWLGHSCWDLVKTKVLDVRQNCIPGLPEQRSPAECSTFWWGPKQCLPSH  406

Query  349  KSLLYVPCDIDESPRK  302
                 +PC + + P K
Sbjct  407  D----IPCSLPKGPTK  418



>gb|KHN43047.1| Hypothetical protein glysoja_007577 [Glycine soja]
Length=456

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 89/127 (70%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            P+EIG LK + VFD S N LTGPIP SFGCL+K++ LNL +N+LYG VP++LC++  +  
Sbjct  300  PFEIGYLKKAVVFDISENLLTGPIPLSFGCLKKIQFLNLAHNKLYGCVPDNLCQIPSIRN  359

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSL+ NYF +IGP C +L++ KVLD+  NCI  LPNQ+S + C  F+   + CP+  
Sbjct  360  NGNLSLANNYFNEIGPSCWSLIKSKVLDVSGNCIPGLPNQKSPKECYQFYKTKKTCPNPN  419

Query  346  SLLYVPC  326
            S  YVPC
Sbjct  420  SFYYVPC  426



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+ + VFDAS N+LTGP+P S GCLEK+E LNL+ N LYG VPE LC L +L  
Sbjct  228  PYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEVLCALDNLVN  287

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FFL  + C       
Sbjct  288  LSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPRFCFYPSWYN  347

Query  337  YVPCD  323
            ++PC 
Sbjct  348  FIPCS  352



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 80/124 (65%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + VFDA  N LTGP+P S GCLEKLE+LN   N LYGSVP+ LC L++L  
Sbjct  271  PYELGLLKEAVVFDAGNNNLTGPLPFSLGCLEKLEVLNFAGNLLYGSVPDVLCGLRNLMN  330

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NY TQ GP C  L++  VLD+  NCI   P QRS   C  FF   + CP   +  
Sbjct  331  LSLSDNYLTQAGPSCMRLIKNGVLDVRKNCIPGQPFQRSVAECAAFFARPRNCPYMDTYS  390

Query  337  YVPC  326
             VPC
Sbjct  391  QVPC  394



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 88/137 (64%), Gaps = 9/137 (7%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            PYE+GLLK +TVFDA  N +TGPIP SFGCL+K+E LNL  N LYG VP+ LC+L D   
Sbjct  297  PYEVGLLKKATVFDAGTNYITGPIPLSFGCLKKVEQLNLAQNLLYGEVPDVLCRLADVGH  356

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLS NYFT +G  C  L+++ +LD+  NCI  LP QRS   C  F    + CP   
Sbjct  357  LANLSLSSNYFTWVGTSCWQLIKRGILDVRKNCIRGLPEQRSPAECAQFLKQPKYCP---  413

Query  346  SLLYVPCDIDESPRKAG  296
             L ++PC I   PRK G
Sbjct  414  YLPHIPCRI---PRKDG  427



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 92/138 (67%), Gaps = 9/138 (7%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYE GLLK +TVFDA  NQ+TGPIP SFGCL+K+E LNL  N LYG VP+ +C+L     
Sbjct  288  PYETGLLKRATVFDAGSNQITGPIPLSFGCLQKVEQLNLAGNLLYGEVPDVVCQLAKYGH  347

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPD  353
            L  LSLS NYFT + P C  L+++KVLD+  NCI  LPNQR  + C  +FL+  K  CP+
Sbjct  348  LANLSLSDNYFTSVAPSCAGLIQQKVLDVRKNCIPGLPNQRPPEACA-WFLNRPKITCPN  406

Query  352  HKSLLYVPCDIDESPRKA  299
             +   Y+PC +  + R A
Sbjct  407  AQ---YIPCHLPWAGRDA  421



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIG LK + VFD   N+LTGP+P S  CLEK+E LN   N LYG VPE +C +LK+L 
Sbjct  269  PYEIGFLKEAVVFDVGNNRLTGPLPFSLACLEKVEQLNFAGNLLYGMVPEVVCDELKNLA  328

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKS  344
              SLS NYFT +GP CR L+E+ VLD+  NCI DLP QRS + C  FF + ++ CP   S
Sbjct  329  NFSLSDNYFTYVGPLCRRLIERGVLDVRRNCIPDLPYQRSMEECGAFFSYPRRFCPYMWS  388

Query  343  LLYVPCDIDESPR  305
              ++PC     PR
Sbjct  389  YNHIPCQPPHYPR  401



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 87/133 (65%), Gaps = 1/133 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + V D   N LTGP+P S GCLE +E LN   N LYG VPE +C LK+L  
Sbjct  244  PYELGLLKKAIVIDVGFNTLTGPLPCSLGCLENVEQLNFAGNLLYGQVPEVICSLKNLVN  303

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYFT++GP CR L+E  VL+++ NCI  LPNQR    C  F +  + CP  KSL 
Sbjct  304  FTLSYNYFTKVGPLCRELIENGVLNVEKNCINGLPNQRPILECVLFRMRIKLCPLQKSLR  363

Query  337  YVPCDIDE-SPRK  302
             +PC+I + SP +
Sbjct  364  IIPCNISKFSPHR  376



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLL  + VFDA  N+LTGP+P S GCLE +E+LN   NQLYG VPE +C L +L  
Sbjct  271  PYELGLLNEAVVFDAGNNRLTGPLPFSLGCLENMEVLNFAGNQLYGMVPEVICSLGNLAN  330

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS N+F  +GP C +L+++ V+D+  NCI  LP+QRS   C  FF   + CP  ++  
Sbjct  331  LSLSHNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAFFAQPRYCPYMETYS  390

Query  337  YVPC  326
            Y+PC
Sbjct  391  YIPC  394



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 0/125 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+ + VFDAS N+LTGP+P S GCLEK+E LNL+ N LYG VPE LC L +L  
Sbjct  264  PYELGFLREARVFDASNNRLTGPLPCSLGCLEKIERLNLSGNLLYGQVPEVLCALDNLVN  323

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L++  VLD++ NCI  LP+QRS   C  FFL  + C       
Sbjct  324  LSLSNNYFTGVGPLCRKLIKNGVLDVNRNCIHYLPDQRSTHECALFFLQPRFCFYPSWYN  383

Query  337  YVPCD  323
            ++PC 
Sbjct  384  FIPCS  388



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLL  + VFDA  N+LTGP+P S GCLE +E+LN   NQLYG VPE +C L++L  
Sbjct  273  PYELGLLNEAVVFDAGNNRLTGPLPFSLGCLENMEVLNFAGNQLYGMVPEVVCSLRNLAN  332

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS N+F  +GP C +L+++ V+D+  NCI  LP+QRS   C  +F   + CP  ++  
Sbjct  333  LSLSNNFFIGVGPICLSLIKEGVVDVRKNCIPGLPSQRSTAECVAYFAQPRYCPYMETYS  392

Query  337  YVPC  326
            Y+PC
Sbjct  393  YIPC  396



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIG L+ +TVFDA  NQLTGP+P S  CLEK+E+LN   N LYG VPE +C  L +L 
Sbjct  309  PYEIGFLEEATVFDAGNNQLTGPLPLSLSCLEKVEVLNFGGNLLYGMVPEVVCVGLVNLV  368

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR L+++ VLD+ NNCI DLP QRS   C +FF   + CP     
Sbjct  369  NFSLSDNYFTHVGPFCRMLIQRGVLDVRNNCIPDLPFQRSVMECAEFFATPRMCPFMWFH  428

Query  340  LYVPCDI  320
              +PC +
Sbjct  429  GLIPCKL  435



>ref|XP_004238131.2| PREDICTED: probable inactive receptor kinase At5g67200 [Solanum 
lycopersicum]
Length=1206

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 81/124 (65%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L  + VFDA  N+LTGP+P S GCLE +E+LN   NQ+YG VP+ +C L++L  
Sbjct  244  PYEIGFLNEAVVFDAGNNRLTGPLPFSLGCLENIEMLNFAGNQMYGMVPDVICALENLAN  303

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT  GP C  L+E  VLD+ NNCI   P QRS   C  FF + + CP   S  
Sbjct  304  LSLSDNYFTGFGPICLRLIENGVLDLRNNCIPGFPFQRSIAECVAFFAYPRYCPHMASYT  363

Query  337  YVPC  326
            Y+PC
Sbjct  364  YIPC  367



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 79/126 (63%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY++GLLK   V DA+ NQLTGP+P S  CLEK+EILNL  N+LYGSVP+ LC+L  L  
Sbjct  217  PYQLGLLKEVVVIDAAENQLTGPLPTSIACLEKVEILNLAGNRLYGSVPDLLCRLSKLTN  276

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT  G  C  L+   VLD+ NNCI  LP QR    C  FF     CP+     
Sbjct  277  LSLSDNYFTVAGDSCMGLIRSGVLDLTNNCIPGLPFQRPPMECAAFFAGQPSCPNQYIFS  336

Query  337  YVPCDI  320
             +PC I
Sbjct  337  KIPCRI  342



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L  +TVFD   N+LTGPIPQSFGC+ +L++LN+ +N+ YG +PE LC+L     
Sbjct  285  PFEIGYLNRTTVFDVGSNRLTGPIPQSFGCMARLQLLNMAHNKFYGPIPEVLCRLPRAFN  344

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYFTQ+GP+CR L+  + L+++ NCI+ LPNQRSA  C  FF   + C    +  
Sbjct  345  FTLSNNYFTQVGPQCRRLIRLRRLNVNRNCIMGLPNQRSAADCGRFFARPRTCARESTFS  404

Query  337  YVPCDIDES  311
             +PC +  +
Sbjct  405  IIPCRLPAA  413



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+++T+FDA  N LTGP+P S GCL+K+E LN   N LYG +PE LC+L +L  
Sbjct  281  PYELGFLRDATLFDAGNNLLTGPLPCSLGCLDKMEELNFAGNLLYGKLPEVLCELGNLVN  340

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L+E  VLD+  NCI  L +QRSA+ C  FF + + CP   +  
Sbjct  341  LSLSNNYFTSVGPMCRKLIENGVLDLRKNCIQHLADQRSAEECALFFGNPRSCPHPATFS  400

Query  337  YVPCDIDESPRKAG  296
             +PC +   P+  G
Sbjct  401  LLPCKV--PPKSKG  412



>ref|XP_007157715.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
 gb|ESW29709.1| hypothetical protein PHAVU_002G092200g [Phaseolus vulgaris]
Length=449

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIG LK + VFD S N LTGPIP SFGCL+ ++ LNL  N+ YG VP+++C++  L  
Sbjct  295  PVEIGNLKRAVVFDVSKNLLTGPIPHSFGCLKSIQYLNLAQNKFYGCVPDNVCQISSLRN  354

Query  517  ---LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSL+ NYF  +GP C +L++ KVLD+  NCI  LPNQRS   C  F+     CP+  
Sbjct  355  NGNLSLADNYFNDVGPSCWSLIKSKVLDVSKNCIRGLPNQRSPYECSQFYKRKTTCPNPS  414

Query  346  SLLYVPCDIDESPRKAG  296
            S  YVPC  + S    G
Sbjct  415  SFYYVPCRGNPSSETTG  431



>ref|XP_008456159.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=315

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+N+ +FDA  N+LTGPIP SF CL K E+L L +NQLYG VPE +CKL +L  
Sbjct  159  PYEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEEICKLPNLGN  218

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +L  N+FTQ+GPEC+ L++KK+LD+ NNCI  LP QRS   C +F    + C + KS  
Sbjct  219  FTLRNNFFTQVGPECKKLIKKKILDVSNNCIPGLPKQRSKTECLEFAYRPKYCGNDKSFT  278

Query  337  YVPC  326
            Y+PC
Sbjct  279  YIPC  282



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PY+IG L  +TVFD   N+LTGP+P SFGCL K+E L L  N+ YG++PE LC+L  L+ 
Sbjct  311  PYQIGNLNQATVFDVESNELTGPVPYSFGCLNKMEQLILARNKFYGAIPEILCELSSLKN  370

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFTQ+GP+CR L+++++LD+  NCI  L NQR+   C  FF+  Q CP+ KS  
Sbjct  371  LSLSSNYFTQVGPKCRTLIKRRILDVGRNCIRGLANQRTWWECARFFMRRQNCPNSKSFF  430

Query  337  YVPCDID  317
             +PC  D
Sbjct  431  NIPCGKD  437



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 84/127 (66%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKDLE  521
            PYEIG L+ + VFD   NQLTGP+P S  CLEK+E++NL  N  YG VP+ LC+ L++L 
Sbjct  245  PYEIGYLEEAIVFDVGNNQLTGPLPLSLSCLEKVEVVNLAGNMFYGMVPDVLCEGLENLV  304

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SL  NYFT +GP CR L+E+ +LD+  NCILDLP QRS   C DFF   + CP     
Sbjct  305  NFSLYDNYFTHVGPFCRMLIERGILDVGKNCILDLPFQRSVIECADFFSRPKMCPFMWFH  364

Query  340  LYVPCDI  320
             + PC++
Sbjct  365  SFFPCNV  371



>gb|KJB32335.1| hypothetical protein B456_005G236200 [Gossypium raimondii]
Length=413

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK   +FD   N LTGP+P S  CL+K+E+LNL NN  Y  VPE LC L +LE 
Sbjct  259  PYEVGFLKELKLFDVEDNLLTGPLPCSLSCLDKIELLNLANNLFYWEVPEELCALVNLEN  318

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSL  341
            L+LSGNYFT++GP CR L++  +LD+  NC+ DLP+QRS   C +F+L Y + CP  ++ 
Sbjct  319  LTLSGNYFTKVGPACRKLIKNGILDMTQNCVPDLPHQRSLLECTEFYLKYIRFCPYPETY  378

Query  340  LYVPC  326
              +PC
Sbjct  379  KIIPC  383



>gb|KCW68710.1| hypothetical protein EUGRSUZ_F02313 [Eucalyptus grandis]
Length=362

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 81/127 (64%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL---KD  527
            PYEIGLL  + V DA  NQLTGP+P S  CLEK+E LNL  N  YG VPE +C L   ++
Sbjct  220  PYEIGLLDETVVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEPICWLGLNRN  279

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLS NYF  +GP CR L+EK +L++ NNCI DLP QR    C  FF   + CP   
Sbjct  280  LVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFAQPRPCPRMW  339

Query  346  SLLYVPC  326
            S  YVPC
Sbjct  340  SYSYVPC  346



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 85/130 (65%), Gaps = 6/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGLL  +TVFDA  NQ+TGPIP SFGCL K+E LNL  N LYG VP+ +C+L    +
Sbjct  294  PYEIGLLSIATVFDAGFNQVTGPIPWSFGCLLKVEQLNLAGNLLYGEVPDVVCRLAKDGN  353

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLSGNYFT +G  C +L++ KVLD+ +NCI+ LP QR    C  F    + CP   
Sbjct  354  LANLSLSGNYFTSLGLSCWDLVKSKVLDVRHNCIVGLPEQRPPSECSKFLWRPKHCPVSH  413

Query  346  SLLYVPCDID  317
               Y+PC + 
Sbjct  414  ---YIPCSLS  420



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L+++T+FDA  N LTGP+P S GCL+K+E LN   N LYG  PE +C+L +L  
Sbjct  281  PYELGFLRDATLFDAGNNXLTGPLPCSLGCLDKMEELNFAGNLLYGKXPEVVCELGNLVN  340

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT +GP CR L++  VLD+  NCI  L +QRS + C  FF+  + CPD  +  
Sbjct  341  LSLSNNYFTSVGPICRQLIKNGVLDLRKNCIQHLADQRSVEECALFFVKPRSCPDPSTFS  400

Query  337  YVPCDIDESPRKAG  296
             +PC +   P+  G
Sbjct  401  LLPCKV--PPKSKG  412



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 83/127 (65%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC-KLKDLE  521
            PYEIGLLK + V D   NQLTGP+P S  CLE +E LN   N L+G VPE LC +L+ L 
Sbjct  328  PYEIGLLKQAVVLDFGNNQLTGPLPFSLACLENVEQLNFAGNLLHGMVPEVLCHELQSLA  387

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR+L+ K VLD+ NNC+ DL  QR  + C DFF H + CP   + 
Sbjct  388  NFSLSDNYFTNVGPICRSLIGKGVLDVTNNCVPDLLFQRPVEECADFFAHPRFCPFMWTY  447

Query  340  LYVPCDI  320
             Y+PC +
Sbjct  448  TYIPCKL  454



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK + V D   N LTGP+P SFGCLE +E LN   N LYG VPE +C L +L  
Sbjct  273  PYELGLLKKAIVIDVGYNMLTGPLPCSFGCLESVEQLNFAGNLLYGQVPEVVCSLTNLVN  332

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYFT++GP CR L++K +L+++ NCIL LPNQRS   C  F    + CP  K+  
Sbjct  333  FTLSYNYFTKVGPLCRELIKKGILNVEKNCILGLPNQRSIVECLIFRGQIKLCPLQKTYN  392

Query  337  YVPCDI  320
             +PC I
Sbjct  393  VIPCKI  398



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLE-  521
            P+EIG LK   VFD S N LTGPIP SFGCL+ ++ LNL  N+LYG VP++LC++  +  
Sbjct  297  PFEIGYLKKVVVFDVSKNLLTGPIPLSFGCLKSIQFLNLAQNKLYGCVPDNLCQIPSIRN  356

Query  520  --ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
               LSL+ NYF +IGP C +L++ KVLD+  NCI  LP+Q+S + C  F+   + CP+  
Sbjct  357  NGNLSLADNYFKEIGPSCWSLIKSKVLDVSRNCIPGLPDQKSPKECYQFYKTKKTCPNQN  416

Query  346  SLLYVPC  326
            S  YVPC
Sbjct  417  SFYYVPC  423



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 82/126 (65%), Gaps = 0/126 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+GLLK +TV D   N LTGP+P S GCLE +E LN   N LYG VPE +C L +L  
Sbjct  272  PYELGLLKKATVIDVGYNMLTGPLPCSLGCLESVEQLNFAGNLLYGQVPEVVCSLTNLVN  331

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +LS NYFT++GP CR L++K +L+++ NCI  LPNQRS   C  F    + CP  K+  
Sbjct  332  FTLSNNYFTKVGPLCRELIKKGILNVEKNCIFGLPNQRSIVECLIFRGQIKLCPLQKTYS  391

Query  337  YVPCDI  320
             +PC I
Sbjct  392  VIPCKI  397



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 81/127 (64%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL---KD  527
            PYEIGLL  + V DA  NQLTGP+P S  CLEK+E LNL  N  YG VPE +C L   ++
Sbjct  313  PYEIGLLDETVVLDAGNNQLTGPLPLSLFCLEKVEQLNLGGNLFYGMVPEPICWLGLNRN  372

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLS NYF  +GP CR L+EK +L++ NNCI DLP QR    C  FF   + CP   
Sbjct  373  LVNLSLSDNYFQHVGPWCRALIEKGILNVRNNCIPDLPFQRPVADCARFFAQPRPCPRMW  432

Query  346  SLLYVPC  326
            S  YVPC
Sbjct  433  SYSYVPC  439



>ref|XP_010554992.1| PREDICTED: uncharacterized protein At4g06744 [Tarenaya hassleriana]
Length=392

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 85/132 (64%), Gaps = 7/132 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG LK + VFD   N+LTGP+P S  CLEK E LN   N L+G+VPE+ C L++L  
Sbjct  249  PYEIGFLKEARVFDVGQNRLTGPLPTSLTCLEKAEQLNFAGNSLFGTVPETACVLRNLAN  308

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT++GP CR L+ K VLD+ NNCI  LPNQRS + C DF    + C    S +
Sbjct  309  FSLSDNYFTRVGPFCRILIRKGVLDVRNNCIPLLPNQRSVKECVDFLAKPKYC----SHM  364

Query  337  YVPCDIDESPRK  302
            + P  +   PRK
Sbjct  365  WFPSSV---PRK  373



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 95/172 (55%), Gaps = 17/172 (10%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            PYE+GLLK +TVFDA  N +TGPIP SFGCL+K+E LNL  N LYG VP+ +C+L D   
Sbjct  302  PYEVGLLKKATVFDAGTNHITGPIPLSFGCLKKVEQLNLAQNFLYGEVPDVVCRLADVGH  361

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLS NYFT +G  C  LLE+ +LD+  NCI  LP+QRS   C  F    + CP   
Sbjct  362  LANLSLSSNYFTWLGTSCWRLLERGILDVRKNCIRGLPDQRSPAECFWFLKQPKYCP---  418

Query  346  SLLYVPCDIDESPRKAGphphphrpykkhkRGSS--------TTYAALKVDR  215
               ++PC +   P K G   H          G          TTY AL   R
Sbjct  419  YFPHIPCRL---PWKDGGAVHSAAAMLPAVGGGRDKAPASRYTTYTALHNRR  467



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+N  +FDA  N+LTGP+P SFGCL+ +E LN  +N LYG VPE +C L +L  
Sbjct  258  PYEIGFLENVKLFDAGSNRLTGPLPFSFGCLKNVEQLNFASNMLYGQVPEVVCALGNLAN  317

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYF ++GP C+ L+   V+D+ NNCILD+P+QR  + C  F+   + C   ++  
Sbjct  318  LSLSYNYFNRVGPICKKLIRSGVVDVRNNCILDVPDQRPLKECVAFYSVPRTCLRSRTFS  377

Query  337  YVPC  326
             +PC
Sbjct  378  IIPC  381



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 85/135 (63%), Gaps = 8/135 (6%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGLL  +TVFDA  NQ+TGPIP SFGCL+K+E LNL  N LYG+VP+ +C+L     
Sbjct  295  PYEIGLLSEATVFDAGFNQITGPIPLSFGCLQKVEQLNLAGNLLYGNVPDVVCRLAKTGQ  354

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH--YQKCPD  353
            L  LSLSGNYFT IG  C  L++  VLD+  NCI   P+QR    C  FF H  +  CP 
Sbjct  355  LANLSLSGNYFTSIGYSCWELIKSGVLDVRQNCIPGFPDQRRPDECWWFFTHPRHYFCPF  414

Query  352  HKSLLYVPCDIDESP  308
                 Y+PC    +P
Sbjct  415  FH---YIPCKCPVAP  426



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 87/129 (67%), Gaps = 6/129 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            PY++GLLK +TVFDA  NQ+TGPIP SFGCL K+E LNL  N LYG VP+ +C+L D   
Sbjct  235  PYQVGLLKKATVFDAGTNQITGPIPLSFGCLLKVEQLNLARNLLYGKVPDVVCRLADYGH  294

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLS NYFT +G  C  L+++ +LD+ +NCI  LP+QRS + C  F    + CP   
Sbjct  295  LANLSLSSNYFTLLGFSCWELIDRGILDVRHNCIPGLPDQRSPEECAWFLKQPKYCP---  351

Query  346  SLLYVPCDI  320
             L Y+PC I
Sbjct  352  VLPYIPCYI  360



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 83/129 (64%), Gaps = 6/129 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+EIGLL  +TVFDA  NQ+TGPIP SFGCL K+E LNL  N LYG VP+ +C L D   
Sbjct  298  PHEIGLLSKATVFDAGTNQITGPIPLSFGCLMKVEQLNLAQNLLYGEVPDVVCLLADFGK  357

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLS NYFT +G  C  L+E+ +LD+  NCI  LPNQRS + C  F    + CP   
Sbjct  358  LANLSLSSNYFTSLGKSCWKLIERGILDVRRNCIPWLPNQRSPEECGWFLKQRKYCPVSP  417

Query  346  SLLYVPCDI  320
               Y+PC I
Sbjct  418  ---YIPCHI  423



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL-KDLE  521
            PYE+GLLK + V DAS NQLTGP+P S  CL+K+E L+   N L+G VP+ +C+L  +L 
Sbjct  290  PYELGLLKEAIVLDASNNQLTGPLPFSLACLDKVEQLSFAGNLLFGLVPDVICELLVNLA  349

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYF  +GP C+ L+++ +LD+ NNCI  LP QRS + C  FF H + CP+  S 
Sbjct  350  NFSLSDNYFIHVGPICQRLIQRGLLDVTNNCIPGLPFQRSVEECAGFFAHPRFCPNMWSY  409

Query  340  LYVPCD  323
             Y+PC 
Sbjct  410  TYIPCS  415



>ref|XP_009394537.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 81/129 (63%), Gaps = 6/129 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIG L  +TVFD   NQ TGPIP SFGCL K+E LNL  N LYG VP+ +C+L    +
Sbjct  286  PYEIGSLTTATVFDVGFNQFTGPIPWSFGCLLKVEQLNLAGNLLYGEVPDVVCRLAKDGN  345

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L  LSLSGNYFT +G  C +L+++KVLD+  NCI   P QR    C  F  H + CP   
Sbjct  346  LANLSLSGNYFTSLGHSCWDLIKRKVLDVRQNCIPWFPEQRRPVECWRFLWHRKFCPFFH  405

Query  346  SLLYVPCDI  320
               Y+PC +
Sbjct  406  ---YIPCGL  411



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK   VFD   N LTGP+P S  CLEK+++LN  +N LY  VPE LC L +LE 
Sbjct  262  PYELGFLKELEVFDVENNLLTGPLPWSLACLEKIKLLNFASNLLYWEVPELLCALGNLEN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHKSL  341
            LSLS NYFT++GP CR L++  VL++  NCI DLP+Q+S   C +F+L Y + CP   + 
Sbjct  322  LSLSDNYFTKVGPICRKLIKNGVLNVRQNCIHDLPDQKSLHECAEFYLKYIRLCPYPATY  381

Query  340  LYVPC  326
              +PC
Sbjct  382  KIIPC  386



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L+N+ +FDA  N+LTGPIP SF CL K E+L L +NQLYG VPE +CKL +L  
Sbjct  294  PFEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEEICKLPNLGN  353

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +L  N+FTQ+G EC+ L++KK+LD+ NNCI  LP QRS + C  F    + C + KS  
Sbjct  354  FTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFAYRPKYCGNDKSFT  413

Query  337  YVPC  326
            Y+PC
Sbjct  414  YIPC  417



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+EIG L+N+ +FDA  N+LTGPIP SF CL K E+L L +NQLYG VPE +CKL +L  
Sbjct  294  PFEIGSLENAVLFDAGKNRLTGPIPLSFACLAKAELLYLADNQLYGPVPEEICKLPNLGN  353

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             +L  N+FTQ+G EC+ L++KK+LD+ NNCI  LP QRS + C  F    + C + KS  
Sbjct  354  FTLRNNFFTQVGAECKKLIKKKILDVSNNCIPGLPKQRSKEECLQFAYRPKYCGNDKSFT  413

Query  337  YVPC  326
            Y+PC
Sbjct  414  YIPC  417



>ref|XP_003575360.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=423

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 82/133 (62%), Gaps = 1/133 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+E+G+L  +TV DA  NQLTGPIPQSF CL  +E LNL  N+LYG VP++LCKL  L  
Sbjct  268  PHELGMLTKTTVIDAGKNQLTGPIPQSFSCLSSVEQLNLGENRLYGQVPDALCKLGRLAN  327

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH-YQKCPDHKSL  341
            L+L+GNYF+ +GP C  L++  VLD+  NCI  L NQR+   C  F       CP   + 
Sbjct  328  LTLAGNYFSSVGPACSALVKDGVLDVKRNCIPGLANQRAPAECASFMSQPKASCPAASAP  387

Query  340  LYVPCDIDESPRK  302
            +  P +     +K
Sbjct  388  VSCPAEAAADAKK  400



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 3/132 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIGLL+ +TVFDAS N LTG IP SF CL  +EIL+L +NQLYG VPE +C+L +L  
Sbjct  281  PCEIGLLEKATVFDASRNYLTGRIPLSFTCLGMIEILDLADNQLYGHVPELVCELPNLVT  340

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT IGP+C  L+EK VL +  NCI  LP+QR+   C+ FF   + CP      
Sbjct  341  LSLSYNYFTGIGPKCLELVEKNVLHLRMNCIPGLPDQRTRAQCRAFFSTAKGCPRSN---  397

Query  337  YVPCDIDESPRK  302
            ++PC      R+
Sbjct  398  WIPCSSGGVIRR  409



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-LKDLE  521
            P+EIG  + + VFD   NQLTGP+P S  CLEK+E++NL  N  YG VP+ +C  L++L 
Sbjct  241  PHEIGYFQEAVVFDVGNNQLTGPLPMSLSCLEKVEVVNLAGNMFYGMVPDFVCAGLENLV  300

Query  520  ELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSL  341
              SLS NYFT +GP CR L+++ VLD+  NCI DLP QRS   C DFF   + CP     
Sbjct  301  NFSLSDNYFTHVGPFCRMLIQRGVLDVGKNCIHDLPFQRSLIECADFFTRPKICPFTWFH  360

Query  340  LYVPCDI  320
             + PC+ 
Sbjct  361  GFYPCNF  367



>ref|XP_004953109.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=433

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P E+G+L  +TV DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  277  PNELGMLHKATVIDAGMNQLTGPIPASFSCLSSVEQLNLGGNRLYGQVPDALCKLAGPAG  336

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT +GP C  L++  VLD+ NNCI  L NQR    C  F  H + CP  
Sbjct  337  RLANLTLSGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRRPVECAVFHSHPKTCPAA  396

Query  349  KSLLYVP  329
             + +  P
Sbjct  397  SAQVACP  403



>ref|XP_002452450.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
 gb|EES05426.1| hypothetical protein SORBIDRAFT_04g026020 [Sorghum bicolor]
Length=433

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  277  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDALCKLAGPAG  336

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  356
             L  L+LSGNYFT +GP C  L++  VLD+ NNCI  L NQR A  C  F    + CP
Sbjct  337  RLANLTLSGNYFTSVGPACATLIKDGVLDVKNNCIPGLANQRRAAECAAFQSQPKTCP  394



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 84/136 (62%), Gaps = 11/136 (8%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGLL  +TVFDA  NQ+TGPIP SFGCL+K+E LNL  N LYG+VP+ +C+L     
Sbjct  286  PYEIGLLSEATVFDAGFNQITGPIPLSFGCLQKVEQLNLAGNFLYGNVPDVVCRLAKTGQ  345

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL---HYQKCP  356
            L  LSLSGNYFT IG  C  L++  VLD+  NCI   P QR    C  FF    HY  CP
Sbjct  346  LANLSLSGNYFTWIGHSCWELVKSGVLDVRQNCIPGFPEQRHPDECWWFFAQPKHY--CP  403

Query  355  DHKSLLYVPCDIDESP  308
                L ++PC     P
Sbjct  404  ---FLHFIPCKCPVPP  416



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK++T+FDA  NQLTGP+P S GCLEK+E LN   N LYG VPE +C+L +L  
Sbjct  244  PYELGFLKDATLFDAGNNQLTGPLPCSLGCLEKIEQLNFAGNFLYGKVPEVVCELGNLAN  303

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVC  389
            LSLS NYFT +GP CR L++  VLD+  NCI DL +QRS + C
Sbjct  304  LSLSNNYFTMVGPICRKLIKSGVLDLRKNCIRDLADQRSVEEC  346



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 100/173 (58%), Gaps = 15/173 (9%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            P+E+GLLK +TVFDA  NQLTGPIP SFGCLEK+E LNL  NQL G VP+ +C+L     
Sbjct  296  PFEVGLLKKATVFDAGSNQLTGPIPLSFGCLEKVEQLNLAGNQLCGEVPDVVCRLAKYGK  355

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPD  353
            L  LSLS NYFT + P C +L+   VLD+  NCI  LP+QRS + C  +FL   K  CP+
Sbjct  356  LVNLSLSDNYFTSLAPSCISLIHSNVLDVRKNCIPWLPHQRSPEECA-WFLKLPKVFCPN  414

Query  352  HKSLLYVPCDI-----DESPRKAGphphphrpykkhkRGSSTTYAAL-KVDRP  212
                 Y+PC +     DE    A   P       K      TTY AL   D+P
Sbjct  415  AH---YIPCHLPWEGRDELDSSASSSPAVDGGRDKSPASGYTTYQALHHHDKP  464



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L  + VFDA  NQLTGP+P S GCL+ +E LN   N LYG VPE +C L+ L  
Sbjct  290  PYELGSLDEAIVFDAGHNQLTGPLPLSLGCLKSVEQLNFAGNLLYGMVPEMVCALRHLVN  349

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+LS NYFT +GP CR L+ + VL+I NNCI DLP QR    C  F    + CP   S  
Sbjct  350  LTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFLAFPRICPRMWSYT  409

Query  337  YVPC  326
             +PC
Sbjct  410  LMPC  413



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 78/124 (63%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G L  + VFDA  NQLTGP+P S GCL+ +E LN   N LYG VPE +C L+ L  
Sbjct  290  PYELGSLDEAIVFDAGNNQLTGPLPLSLGCLKSVEQLNFAGNLLYGMVPEVVCALRHLVN  349

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            L+LS NYFT +GP CR L+ + VL+I NNCI DLP QR    C  F    + CP   S  
Sbjct  350  LTLSDNYFTVVGPLCRILIGRGVLNIRNNCIPDLPFQRPIIECAKFLAFPRICPRMWSYT  409

Query  337  YVPC  326
             +PC
Sbjct  410  LMPC  413



>ref|XP_003575361.1| PREDICTED: uncharacterized protein At4g06744-like [Brachypodium 
distachyon]
Length=436

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 83/133 (62%), Gaps = 1/133 (1%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+E+G+L  +TV DA  NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL  L  
Sbjct  281  PHELGMLTKTTVIDAGKNQLTGPIPPSFSCLSSVEQLNLGENRLYGQVPDALCKLGRLAN  340

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPDHKSL  341
            L+L+GNYF+ +GP C  L+++ VLD+  NCI  L NQR+   C  F    +  CP   + 
Sbjct  341  LTLAGNYFSSVGPACSALIKEGVLDVKRNCIPGLANQRAPAECTSFMSQPKASCPAASAP  400

Query  340  LYVPCDIDESPRK  302
            +  P +     +K
Sbjct  401  VSCPAEAAADAKK  413



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 82/130 (63%), Gaps = 9/130 (7%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGLL  +TV DA  N LTG IP S+ CL  +E LNL +N LYG V +SLC+L     
Sbjct  288  PYEIGLLARATVIDAGTNHLTGTIPLSYACLRSVEQLNLADNLLYGVVHDSLCRLAYDGR  347

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF---LHYQKCP  356
            L  L+LSGNYFT +GP C +L+ +  L++D NCIL  PNQRS Q C +FF        CP
Sbjct  348  LANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECAEFFHENWARMTCP  407

Query  355  DHKSLLYVPC  326
              K   YVPC
Sbjct  408  VSK---YVPC  414



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 79/117 (68%), Gaps = 5/117 (4%)
 Frame = -2

Query  646  NQLTGPIPQSFG-----CLEKLEILNLTNNQLYGSVPESLCKLKDLEELSLSGNYFTQIG  482
            N+ TGPIP+S G      LE++  LNL+ N LYG VPE++C L  L  L+L+ NYFTQ+G
Sbjct  324  NKFTGPIPRSIGQTSKSLLEQMNQLNLSCNHLYGPVPETVCVLPKLSALTLNNNYFTQVG  383

Query  481  PECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLLYVPCDIDES  311
            PECR L+ KK LD+  NCIL LP+QRS   C  FF    KCP+ KS+ YVPC I +S
Sbjct  384  PECRKLILKKKLDVRMNCILGLPSQRSPAECDAFFSKKVKCPNEKSMRYVPCKISQS  440



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G+VPE++C L   +L
Sbjct  256  PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCMLLRDNL  315

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDH  350
              LSLS NYFT +GP CR LLEK VLD+ NNCI   P QRS Q C +FF+  +K  CP  
Sbjct  316  VNLSLSDNYFTHVGPWCRGLLEKGVLDVGNNCIPFFPGQRSMQECAEFFVKPKKYYCPHM  375

Query  349  KSLLYVPC  326
                +  C
Sbjct  376  WFHSFFSC  383



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 82/130 (63%), Gaps = 9/130 (7%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGLL  +TV DA  N LTG IP S+ CL  +E LNL +N LYG V +SLC+L     
Sbjct  291  PYEIGLLARATVIDAGTNHLTGTIPLSYACLRSVEQLNLADNLLYGVVHDSLCRLAYDGR  350

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFF---LHYQKCP  356
            L  L+LSGNYFT +GP C +L+ +  L++D NCIL  PNQRS Q C +FF        CP
Sbjct  351  LANLTLSGNYFTWLGPCCWDLIREGKLNVDRNCILWAPNQRSFQECAEFFHDNWARMTCP  410

Query  355  DHKSLLYVPC  326
              K   YVPC
Sbjct  411  VSK---YVPC  417



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 82/130 (63%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  N +TGPIP SFGCL K+E LNL  NQLYG +P+ LC   K   
Sbjct  300  PYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGKVEELNLAGNQLYGHIPDVLCILAKTGK  359

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L+ LSLS NYF  +G  C  L   +VLD+  NCIL+ PNQR A  C  F   Y   P H 
Sbjct  360  LQNLSLSDNYFHSVGHHCLELARSRVLDVRLNCILNFPNQRPALECARF---YADPPQHC  416

Query  346  SLL-YVPCDI  320
              + ++PCD+
Sbjct  417  PFVPHIPCDL  426



>ref|XP_004976154.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=458

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK--DL  524
            PYE+GLL+ +TV DA  NQLTG IP SF CL K+E LNL +N LYG VP++LC+L    L
Sbjct  298  PYELGLLEKATVIDAGTNQLTGTIPASFACLRKVEQLNLADNLLYGEVPDALCRLAFGRL  357

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
            + L+LSGNYFT +G  C +L+++  L++D NCI   PNQRS + C  F    + CP +  
Sbjct  358  KNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECAKFQRQTKSCPVNS-  416

Query  343  LLYVPC  326
              Y+PC
Sbjct  417  --YLPC  420



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+ +TVFDA  N LTG +P S GCL+ +E LN   N LY ++PE +C +  L  
Sbjct  226  PYEIGFLRKATVFDAGDNYLTGQLPCSLGCLDMIEQLNFAGNFLYDAIPEVVCSMPKLSN  285

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH----YQKCPDH  350
            LSLS NYF  IGP C  L+++ VLD+  NCI  LPNQR    C  F+ H       CP  
Sbjct  286  LSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFYFHSFWFRWVCPWQ  345

Query  349  KSLLYVPCDIDES  311
              +  +PC I+ S
Sbjct  346  YLMSAIPCKINSS  358



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYEIG L+ +TVFDA  N LTG +P S GCL+ +E LN   N LY ++PE +C +  L  
Sbjct  262  PYEIGFLRKATVFDAGDNYLTGQLPCSLGCLDMIEQLNFAGNFLYDAIPEVVCSMPKLSN  321

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLH----YQKCPDH  350
            LSLS NYF  IGP C  L+++ VLD+  NCI  LPNQR    C  F+ H       CP  
Sbjct  322  LSLSDNYFNHIGPLCWKLVKRGVLDVRMNCIFGLPNQRPHYECVKFYFHSFWFRWVCPWQ  381

Query  349  KSLLYVPCDIDES  311
              +  +PC I+ S
Sbjct  382  YLMSAIPCKINSS  394



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 75/117 (64%), Gaps = 0/117 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P+E+GLL ++ VFD   N+LTG +P S GCL KLE++N   N LYGSVPE LC +  L  
Sbjct  256  PHELGLLTDAVVFDGGGNRLTGLLPVSLGCLRKLEVMNFAGNLLYGSVPEVLCGIGSLAN  315

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            LSLS NYFT++GP C  L++  VLD+  NC+  LP QRS   C  FF   + C  H 
Sbjct  316  LSLSDNYFTRVGPVCLGLIKSGVLDLRKNCVPGLPLQRSWAECGAFFARPRYCVAHA  372



>ref|NP_001148637.1| LOC100282253 [Zea mays]
 gb|ACG32331.1| protein binding protein [Zea mays]
Length=445

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  289  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLSSVEQLNLAGNRLYGQVPDALCKLAGPAG  348

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP  
Sbjct  349  RLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAA  408

Query  349  KSLLYVP  329
             + +  P
Sbjct  409  STQVTCP  415



>gb|AFW62989.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=391

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  235  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAG  294

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP  
Sbjct  295  RLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAA  354

Query  349  KSLLYVP  329
             + +  P
Sbjct  355  STQVTCP  361



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 83/130 (64%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  N +TGPIP SFGCL  +E LNL  NQLYG++P+ LC   K   
Sbjct  304  PYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNLAGNQLYGNIPDVLCMLAKTGK  363

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F   Y   P H 
Sbjct  364  LQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YADPPQHC  420

Query  346  SLL-YVPCDI  320
              + ++PCD+
Sbjct  421  PFVPHIPCDL  430



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 83/130 (64%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  N +TGPIP SFGCL  +E LNL  NQLYG++P+ LC   K   
Sbjct  304  PYEIGLVEGLTVFDAGGNDITGPIPLSFGCLGLVEELNLAGNQLYGNIPDVLCMLAKTGK  363

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F   Y   P H 
Sbjct  364  LQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YADPPQHC  420

Query  346  SLL-YVPCDI  320
              + ++PCD+
Sbjct  421  PFVPHIPCDL  430



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 78/124 (63%), Gaps = 0/124 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK + V D   N+LTG +P S  CLEK E LN   N L+G+VPE++C L++L  
Sbjct  273  PYELGFLKEARVLDVGQNRLTGRLPMSLTCLEKAEQLNFAGNFLFGAVPETVCMLQNLAN  332

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             SLS NYFT +GP CR L+E+ VLD+ NNCI  LPNQR  + C  F    + C       
Sbjct  333  FSLSDNYFTHVGPFCRILIERGVLDVRNNCIPFLPNQRPFKECLGFLARPKYCSHMWFHS  392

Query  337  YVPC  326
            ++PC
Sbjct  393  FIPC  396



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIG LK + VFD   N+LTGPIP S GCLEK+E LN      YG VPE LC+L +L  
Sbjct  310  PLEIGFLKEARVFDVGNNRLTGPIPFSLGCLEKVEELNFAGKLFYGMVPEVLCQLPNLLN  369

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
            LSL  NYF Q+G  CR+L+ K +LDI  NCI DLP QRS   C D F + + CP   S
Sbjct  370  LSLYDNYFMQVGLACRSLIWKGLLDIRKNCIPDLPFQRSVAECADLFQYPRFCPYMNS  427



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYEIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G++PE++C +   +L
Sbjct  259  PYEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMVLRDNL  318

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDH  350
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+  +K  CP  
Sbjct  319  VNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHM  378

Query  349  KSLLYVPC  326
                +  C
Sbjct  379  WYHSFFSC  386



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYEIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G++PE++C +   +L
Sbjct  259  PYEIGFLMGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMVLRDNL  318

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDH  350
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+  +K  CP  
Sbjct  319  VNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHM  378

Query  349  KSLLYVPC  326
                +  C
Sbjct  379  WYHSFFSC  386



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYEIG L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G++PE++C +   +L
Sbjct  259  PYEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMVLRDNL  318

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDH  350
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+  +K  CP  
Sbjct  319  VNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHM  378

Query  349  KSLLYVPC  326
                +  C
Sbjct  379  WYHSFFSC  386



>gb|ACF84038.1| unknown [Zea mays]
 gb|AFW62991.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=435

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  279  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAG  338

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP  
Sbjct  339  RLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAA  398

Query  349  KSLLYVP  329
             + +  P
Sbjct  399  STQVTCP  405



>ref|NP_001241706.1| uncharacterized protein LOC100856884 [Zea mays]
 gb|ACF85236.1| unknown [Zea mays]
Length=458

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  302  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAG  361

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP  
Sbjct  362  RLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAA  421

Query  349  KSLLYVP  329
             + +  P
Sbjct  422  STQVTCP  428



>gb|ACF79045.1| unknown [Zea mays]
 gb|ACF86020.1| unknown [Zea mays]
 gb|AFW62992.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=458

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  302  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAG  361

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP  
Sbjct  362  RLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAA  421

Query  349  KSLLYVP  329
             + +  P
Sbjct  422  STQVTCP  428



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 2/126 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYEIG L+ ++V D   N+LTG +P S  CLEK+E LN   N L+G +PES+C L   +L
Sbjct  257  PYEIGFLRGASVIDIGGNKLTGHLPLSLTCLEKVEQLNFAGNLLFGVIPESVCMLLRVNL  316

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
               SLS NYFT +GP CR+L E  VLD+ NNC+  LP QRS + C +FF   + CP    
Sbjct  317  VNFSLSDNYFTHMGPWCRSLFEIGVLDVRNNCLPFLPGQRSMKECAEFFFKPKYCPYRWF  376

Query  343  LLYVPC  326
              ++PC
Sbjct  377  HSFIPC  382



>ref|XP_006647518.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=427

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 81/132 (61%), Gaps = 6/132 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+EIG+L  + V DAS+NQL GPIP SF CL  +E LNL +N LYG +P++LCKL     
Sbjct  270  PHEIGMLTKAAVIDASMNQLAGPIPSSFSCLTSVEQLNLGSNSLYGEIPDALCKLAAGPA  329

Query  526  --LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPD  353
              L  L+LS NYFT +GP C  L++  VL++ NNCI  L NQR    C  F    + CP 
Sbjct  330  GRLANLTLSSNYFTSVGPSCLPLIKDGVLNVKNNCIPGLANQRQPAECASFLSQPKTCPP  389

Query  352  HKSLLYVPCDID  317
              S  +V C ++
Sbjct  390  -ASAAHVACPVE  400



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYE+GLL+ +TV DA  N+LTG IP SF CL K+E LNL +N LYG VP++LC+L    L
Sbjct  299  PYELGLLEKATVIDAGTNRLTGTIPASFACLRKVEQLNLADNLLYGEVPDALCRLAFSHL  358

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
            + L+LSGNYFT +G  C +L+++  L++D NCI   PNQRS   C  F    + CP +  
Sbjct  359  KNLTLSGNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHDECAKFLRKPKTCPVNN-  417

Query  343  LLYVPC  326
              Y+PC
Sbjct  418  --YLPC  421



>ref|XP_008677766.1| PREDICTED: uncharacterized protein LOC100856884 isoform X1 [Zea 
mays]
Length=467

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 4/127 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  311  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGQVPDALCKLAGPAG  370

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDH  350
             L  L+LSGNYFT  GP C  L++  VLD+ NNCI  L NQR    C  F    + CP  
Sbjct  371  RLANLTLSGNYFTSAGPACAALIKDGVLDVKNNCIPGLTNQRRPAECAAFQSQPKTCPAA  430

Query  349  KSLLYVP  329
             + +  P
Sbjct  431  STQVTCP  437



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 3/127 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYEIGLLK ++V D S N+LTGP+P S  CLEK+E LN   N L+G++P+++C    ++L
Sbjct  244  PYEIGLLKGASVIDISGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAIPDAVCMFLRENL  303

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPDHK  347
               SLS NYFT +GP C+ L+E+ VLD+ NNCI   P QRS + C +FF+     CP   
Sbjct  304  VNFSLSDNYFTHVGPWCKILVERGVLDVRNNCIPFFPGQRSIEECAEFFVKPNYYCPHAW  363

Query  346  SLLYVPC  326
               ++PC
Sbjct  364  FHSFLPC  370



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 83/129 (64%), Gaps = 6/129 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK----  530
            PYE+GLL  +TV DA  NQLTGPIP SF CL K+E LNL +N LYG VP++LCKL     
Sbjct  299  PYELGLLAKATVIDAGTNQLTGPIPASFACLHKVEQLNLADNLLYGEVPDALCKLAFAWT  358

Query  529  -DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPD  353
              L+ L+LS NYFT +G  C +L+++  L+++ NCI   PNQRS + C  FF H  K   
Sbjct  359  GRLKNLTLSNNYFTSLGSCCWDLIKEGKLNVERNCIPWAPNQRSHEECAAFF-HRTKTSA  417

Query  352  HKSLLYVPC  326
                 YVPC
Sbjct  418  CPVNSYVPC  426



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE++C L   +L
Sbjct  261  PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCMLLRDNL  320

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDH  350
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q C +FF+  +K  CP  
Sbjct  321  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQECAEFFVKPKKYYCPHM  380

Query  349  KSLLYVPC  326
                +  C
Sbjct  381  WFHSFFSC  388



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYE+GLL  +TV DA  N+LTG IP SF CL K+E LNL +N LYG VP++LC+L    L
Sbjct  393  PYELGLLAKATVIDAGTNRLTGTIPASFACLRKVEQLNLADNLLYGEVPDALCRLAFSHL  452

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
            + L+LS NYFT +G  C +L+++  L++D NCI   PNQRS + C  F    + CP +  
Sbjct  453  KNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEECARFLRKPKTCPVNN-  511

Query  343  LLYVPC  326
              YVPC
Sbjct  512  --YVPC  515



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 80/129 (62%), Gaps = 6/129 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK----  530
            PYE+GLL  +TV DA  NQLTGPIP SF CL K+E LNL +N LYG VP +LC+L     
Sbjct  295  PYELGLLAKATVIDAGTNQLTGPIPASFACLRKVEQLNLADNLLYGEVPNALCELAFSWS  354

Query  529  -DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPD  353
              L  L+LS NYFT +G  C +L+++  L++D NCI   PNQRS   C  FF H  K   
Sbjct  355  GRLRNLTLSNNYFTSLGSCCWDLIKEGKLNVDRNCIPYAPNQRSHDECAAFF-HRTKTSA  413

Query  352  HKSLLYVPC  326
                 YVPC
Sbjct  414  CPCNTYVPC  422



>dbj|BAD21636.1| leucine-rich repeat-like protein [Oryza sativa Japonica Group]
 dbj|BAG96332.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89227.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96587.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96588.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96789.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96849.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97586.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + VFDA +NQLTGPIP SF CL  +E LNL  N+LYG +P++LCKL     
Sbjct  281  PHELGMLTKAAVFDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKLAAVPA  340

Query  526  --LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  356
              L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    C  F    + CP
Sbjct  341  GRLANLTLSSNYFTSVGPACLSLIKDGVLNVRNNCIPGFANQRRPAECASFHSQPKACP  399



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+E+GLL+ +TV DA  N+LTG IP SF CL K+E LNL  N LYG VP++LC+L   +L
Sbjct  292  PHELGLLEKATVIDAGANRLTGTIPASFACLRKVEQLNLAGNLLYGEVPDALCRLAFSNL  351

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
            + L+LS NYFT +G  C +L+++  L++D NCI   PNQRS + C  F    + CP +  
Sbjct  352  KNLTLSDNYFTSLGSCCWDLIKEGRLNVDRNCIQWAPNQRSHEDCAKFLRQPKSCPVNN-  410

Query  343  LLYVPC  326
              YVPC
Sbjct  411  --YVPC  414



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ LC   K   
Sbjct  302  PYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDVLCMLAKTGK  361

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F   Y   P H 
Sbjct  362  LQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YADPPQHC  418

Query  346  SLL-YVPCDI  320
              + ++PCD+
Sbjct  419  PFVPHIPCDL  428



>ref|XP_004953107.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=404

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  ++V +  +NQLTGPIP SF CL  +E LNL  N+LYG VP++LCKL     
Sbjct  248  PHELGMLHKASVINVGMNQLTGPIPSSFSCLSSVEQLNLGGNRLYGQVPDALCKLAGPAG  307

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  356
             L  L+L GNYFT +GP C  L++  VLD+ NNCI  L NQR    C  F    + CP
Sbjct  308  RLANLTLPGNYFTSVGPACAALIKDGVLDVKNNCIPGLANQRHPAECAAFHSQPKTCP  365



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGL++  TVFDA  N++ GPIP SFGCL  +E LNL  NQLYG VP+ LC L     
Sbjct  288  PYEIGLVEGLTVFDAGGNEIKGPIPLSFGCLSDVEQLNLAGNQLYGHVPDVLCALAKTGK  347

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR A  C  F+    K CP  
Sbjct  348  LGNLSLSDNYFHSVGRLCMELVRSRVLDVKKNCILGFPRQRPAMECAAFYADPSKHCP--  405

Query  349  KSLLYVPCDI  320
              + ++PCD+
Sbjct  406  -FIPHIPCDL  414



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  N +TGPIP S GCL  +E LNL  NQLYG +P+ LC   K   
Sbjct  317  PYEIGLVEGLTVFDAGGNDITGPIPLSLGCLGLVEELNLAGNQLYGHIPDVLCMLAKTGK  376

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHK  347
            L+ LSLS NYF  +G  C  L+  KVLD+  NCIL+ PNQR A  C  F   Y   P H 
Sbjct  377  LQNLSLSDNYFHSVGHHCLELVRSKVLDVRLNCILNFPNQRPALECARF---YADPPQHC  433

Query  346  SLL-YVPCDI  320
              + ++PCD+
Sbjct  434  PFVPHIPCDL  443



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 85/136 (63%), Gaps = 6/136 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            PYEIG LK ++V D S N+LTG +P S  CLEK+E LN   N L+G++PE++C L   ++
Sbjct  244  PYEIGFLKGASVIDISGNKLTGLLPLSLMCLEKVEQLNFAGNLLFGAIPEAVCMLLWDNI  303

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQ-KCPDHK  347
              LSLS NYFT +GP C+ L E+ VLD+ NNCI   P QRS   C +FF+  +  CP   
Sbjct  304  VNLSLSDNYFTHVGPWCKGLFERGVLDVTNNCIPFFPGQRSIDECAEFFVKPKYYCPHPW  363

Query  346  SLLYVPC---DIDESP  308
               ++PC    I  SP
Sbjct  364  FHRFLPCRYSHISSSP  379



>gb|EEC73254.1| hypothetical protein OsI_07372 [Oryza sativa Indica Group]
Length=324

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  +TV DA  NQLTGPIP SF CL  +E LNL  N+LYG +P+ LCKL     
Sbjct  172  PHELGMLTKATVIDAGKNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDVLCKLAAGPA  231

Query  526  --LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  356
              L  L+LS NYFT +GP C +L++  VL++ NNCI  L NQR    C  F    + CP
Sbjct  232  GRLANLTLSSNYFTSVGPSCLSLIKDGVLNVKNNCIPGLANQRRPAECASFHSQPKICP  290



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  NQ+ GPIP SFGCL  +E LNL  NQLYG VP+ LC   K   
Sbjct  278  PYEIGLVEGLTVFDAGGNQIRGPIPLSFGCLADVEELNLARNQLYGHVPDVLCLLAKTGK  337

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C  F+    K CP  
Sbjct  338  LTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECVMFYADPTKHCP--  395

Query  349  KSLLYVPCDI  320
              + ++PCD+
Sbjct  396  -FIPHIPCDL  404



>emb|CAN61023.1| hypothetical protein VITISV_001143 [Vitis vinifera]
Length=479

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 73/116 (63%), Gaps = 0/116 (0%)
 Frame = -2

Query  691  EIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEELS  512
             IG LK + VFD   N+LTGPIP S GCLEK+E LN      YG VPE LC+L +L  LS
Sbjct  332  HIGFLKEARVFDVGNNRLTGPIPFSLGCLEKVEELNFAGKLFYGMVPEVLCQLPNLLNLS  391

Query  511  LSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKS  344
            L  NYF Q+G  CR+L+ K +LDI  NCI DLP QRS   C D F + + CP   S
Sbjct  392  LYDNYFMQVGLACRSLIWKGLLDIRKNCIPDLPFQRSVAECADLFQYPRFCPYMNS  447



>gb|EAY86685.1| hypothetical protein OsI_08067 [Oryza sativa Indica Group]
Length=428

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG +P++LCKL     
Sbjct  271  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKLATGPA  330

Query  526  --LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  356
              L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    C  F    + CP
Sbjct  331  GRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFANQRRPAECASFHSQPKTCP  389



>gb|EAY86686.1| hypothetical protein OsI_08068 [Oryza sativa Indica Group]
Length=426

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK----  530
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG +P++LCKL     
Sbjct  269  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIPDALCKLAVGPA  328

Query  529  -DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCP  356
              L  L+LS NYFT +GP C +L++  VL++ NNCI    NQR    C  F    + CP
Sbjct  329  GRLANLTLSSNYFTSVGPACLSLIKDGVLNVKNNCIPGFTNQRRPAECASFHSQPKTCP  387



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 86/152 (57%), Gaps = 0/152 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK + VFDA  N LTGP+P S  CLEK+E LN   N LYG VPE +C L +L  
Sbjct  275  PYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEKIEQLNFAGNFLYGQVPEVVCDLGNLLN  334

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NYFT+IGP CR L+   VLD+  NCI  LP+QRS   C   +L    CP   +  
Sbjct  335  LSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSYLFQYPCPFPATYG  394

Query  337  YVPCDIDESPRKAGphphphrpykkhkRGSST  242
            +VPC   +S    G              G+ST
Sbjct  395  FVPCQKSKSIHSFGTGQQKRSYVPIANGGNST  426



>gb|AFW72330.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=245

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 5/121 (4%)
 Frame = -2

Query  691  EIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----L  524
            E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LC+L      L
Sbjct  90   ELGMLAKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDALCRLAGPTGRL  149

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDHK  347
              L+LSGNYFT +GP C  L++  VL++ +NCI  L NQR  + C  F     K CP   
Sbjct  150  ANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFIQSRPKTCPAAA  209

Query  346  S  344
            +
Sbjct  210  T  210



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 79/130 (61%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  N++ GPIP SFGCL  +E LNL  NQLYG VP+ LC   K   
Sbjct  357  PYEIGLVEGLTVFDAGGNEIRGPIPLSFGCLADVEELNLAGNQLYGHVPDVLCLLAKTGK  416

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C  F+    K CP  
Sbjct  417  LTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECAMFYADPTKHCP--  474

Query  349  KSLLYVPCDI  320
              + ++PCD+
Sbjct  475  -FIPHIPCDL  483



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++   VFDA  N++ GPIP SFGCL  +E +NL  NQLYG VP+ +C   K   
Sbjct  364  PYEIGLVEGLAVFDAGGNEIAGPIPLSFGCLRDVEEINLAGNQLYGQVPDVVCLLAKTGK  423

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR A  C  F+    K CP  
Sbjct  424  LQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPALECAAFYADPTKHCP--  481

Query  349  KSLLYVPCDI  320
              + ++PCD+
Sbjct  482  -FIPHIPCDL  490



>ref|NP_001150111.1| protein binding protein precursor [Zea mays]
 gb|ACG37876.1| protein binding protein [Zea mays]
Length=424

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 4/110 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD---  527
            P+E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VPE+LC L     
Sbjct  268  PHELGMLTKAAVIDAGMNQLTGPIPSSFSCLTSVEQLNLAGNRLYGQVPEALCMLAGPAG  327

Query  526  -LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDF  380
             L  L+LS NYFT + P C  L++  VLD+ NNCI  L NQR    C  F
Sbjct  328  RLTNLTLSSNYFTSVAPACAALIKDGVLDVKNNCIPGLANQRRPAECAAF  377



>ref|XP_002447298.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
 gb|EES11626.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
Length=449

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYE+GL++   VFDA  N++TGPIP SFGCL  +E LNL +NQLYG VP+ LC L     
Sbjct  293  PYEVGLVEGLAVFDAGGNEITGPIPLSFGCLRDVEELNLASNQLYGQVPDVLCLLARNGK  352

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L  LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR    C  F+    K CP  
Sbjct  353  LGNLSLSENFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYADPTKHCP--  410

Query  349  KSLLYVPCDI  320
              + ++PCD+
Sbjct  411  -FIPHIPCDL  419



>gb|ABS78922.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78923.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+VPE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|NP_001141186.1| leucine-rich repeat (LRR) family protein precursor [Zea mays]
 gb|ACF85658.1| unknown [Zea mays]
 gb|AFW59826.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=431

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGL++   VFDA  N++TGP+P SFGCL  +E LNL  NQLYG VP+ +C L     
Sbjct  288  PYEIGLVEGLAVFDAGGNEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDVVCLLARTGK  347

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR    C  F++   K CP  
Sbjct  348  LQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYVDPSKHCP--  405

Query  349  KSLLYVPCDI  320
              + ++PC++
Sbjct  406  -FIPHIPCEL  414



>gb|ACG42798.1| leucine-rich repeat, plant specific [Zea mays]
Length=431

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK---D  527
            PYEIGL++   VFDA  N++TGP+P SFGCL  +E LNL  NQLYG VP+ +C L     
Sbjct  288  PYEIGLVEGLAVFDAGGNEITGPVPLSFGCLRDVEELNLAGNQLYGQVPDVVCLLARTGK  347

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L+ LSLS N+F  +G  C  L+  +VLD+  NCIL  P+QR    C  F++   K CP  
Sbjct  348  LQNLSLSDNFFHSVGHHCMELVRSRVLDVRRNCILGFPDQRPPLECAAFYVDPSKHCP--  405

Query  349  KSLLYVPCDI  320
              + ++PC++
Sbjct  406  -FIPHIPCEL  414



>gb|ABS78920.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78921.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78924.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+VPE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78905.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78908.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78909.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+VPE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAVPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78915.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78917.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78919.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78901.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78913.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78916.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78925.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78926.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78927.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78928.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78929.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78930.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78931.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78911.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78912.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78914.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78900.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78903.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78904.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPETVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78910.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78918.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=174

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            PYE+G LK + VFDA  N LTGP+P S GCLEK+E LN   N LYG VPE +C+L +L  
Sbjct  270  PYEVGFLKTAIVFDAGENLLTGPLPCSLGCLEKIEQLNFAGNFLYGQVPEVVCELGNLLN  329

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
            LSLS NY T+IGP CR L+   VLD+  NCI  LP+QRS   C    L    CP   +  
Sbjct  330  LSLSDNYLTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSSLFRYPCPFPATYG  389

Query  337  YVPCDIDESPRKAG  296
            +VPC   +     G
Sbjct  390  FVPCQKSKGIHSFG  403



>gb|EMT04546.1| hypothetical protein F775_44003 [Aegilops tauschii]
Length=384

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK----  530
            PYE+GLL  +TV DA  NQLTG IP S+ CL K+E LNL +N LYG VP++LC+L     
Sbjct  228  PYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLADNLLYGEVPDALCRLAYPSS  287

Query  529  --DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--  362
               L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS + C  FF H  K  
Sbjct  288  GGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHEECAGFF-HRTKTY  346

Query  361  CPDHKSLLYVPC  326
            CP      YVPC
Sbjct  347  CPVST---YVPC  355



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 78/130 (60%), Gaps = 7/130 (5%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLC---KLKD  527
            PYEIGL++  TVFDA  NQ+ GPIP S GCL  ++ LNL  NQLYG VP+ LC   K   
Sbjct  374  PYEIGLVEGLTVFDAGGNQIRGPIPLSLGCLADVQELNLARNQLYGHVPDVLCLLAKTGK  433

Query  526  LEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CPDH  350
            L  LSLS NYF  +G  C  L+  +VLD+  NCIL  P QR    C  F+    K CP  
Sbjct  434  LTNLSLSDNYFHSVGYHCMELVRSRVLDVRRNCILGFPGQRPHIECAMFYADPTKHCP--  491

Query  349  KSLLYVPCDI  320
              + ++PCD+
Sbjct  492  -FIPHIPCDL  500



>ref|NP_001141180.1| uncharacterized protein LOC100273267 precursor [Zea mays]
 gb|ACF85643.1| unknown [Zea mays]
Length=437

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 5/117 (4%)
 Frame = -2

Query  691  EIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKD----L  524
            E+G+L  + V DA +NQLTGPIP SF CL  +E LNL  N+LYG VP++LC+L      L
Sbjct  282  ELGMLAKAAVIDAGMNQLTGPIPSSFSCLISVEQLNLAGNRLYGHVPDALCRLAGPTGRL  341

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK-CP  356
              L+LSGNYFT +GP C  L++  VL++ +NCI  L NQR  + C  F     K CP
Sbjct  342  ANLTLSGNYFTSVGPACAALIKDGVLNVKSNCIPGLANQRRPEECAAFIQSRPKTCP  398



>ref|XP_006289202.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
 gb|EOA22100.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
Length=407

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 4/128 (3%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P EIG L  ++V D   N+LTGP+P S  CL+K+E LN   N L+G +PE +C L   +L
Sbjct  259  PNEIGFLTGASVIDIGGNKLTGPLPLSLMCLDKVEQLNFAGNLLFGGIPEPVCMLLRDNL  318

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--CPDH  350
              LSLS NYFT +GP CR LL++ VLD+ NNCI  L  QRS Q C +FF+  +K  CP  
Sbjct  319  LNLSLSDNYFTHVGPWCRGLLDRGVLDVSNNCIPFLQGQRSMQECAEFFVRPKKYYCPHM  378

Query  349  KSLLYVPC  326
                +  C
Sbjct  379  WFHSFFSC  386



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score =   119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = -2

Query  697   PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
             PYE+G LK + VFDA  N LTGP+P S  CLEK+E LN   N LYG VPE +C L +L  
Sbjct  918   PYEVGFLKKAIVFDAGENLLTGPLPCSLSCLEKIEQLNFAGNFLYGQVPEVVCDLGNLLN  977

Query  517   LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPDHKSLL  338
             LSLS NYFT+IGP CR L+   VLD+  NCI  LP+QRS   C   +L    CP   +  
Sbjct  978   LSLSDNYFTKIGPSCRKLVRNGVLDLRKNCIRGLPDQRSPLDCFFSYLFQYPCPFPATYG  1037

Query  337   YVPCDIDESPRKAG  296
             +VPC   +S    G
Sbjct  1038  FVPCQKSKSIHSFG  1051



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 80/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK----  530
            PYE+GLL  +TV DA  NQLTG IP S+ CL K+E LNL  N LYG VP++LC+L     
Sbjct  299  PYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLAGNLLYGEVPDALCRLAYPSS  358

Query  529  --DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--  362
               L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS + C  FF H  K  
Sbjct  359  GGHLANLTLSDNYFTSLGSCCWALIKQGKLNVARNCIPYAPNQRSHEECAGFF-HRTKTT  417

Query  361  CPDHKSLLYVPC  326
            CP      YVPC
Sbjct  418  CPVST---YVPC  426



>gb|ABS78902.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G++PE +C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAIPEXVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|EMS61305.1| hypothetical protein TRIUR3_11917 [Triticum urartu]
Length=414

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLK----  530
            PYE+GLL  +TV DA  NQLTG IP S+ CL K+E LNL +N LYG VP++LC+L     
Sbjct  258  PYELGLLAKATVIDAGTNQLTGTIPASYACLRKVEQLNLADNLLYGEVPDALCRLAYKSS  317

Query  529  --DLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQK--  362
               L  L+LS NYFT +G  C  L+++  L++  NCI   PNQRS + C  FF H  K  
Sbjct  318  GGHLANLTLSDNYFTSLGACCWALIKQGKLNVARNCIPYAPNQRSHEECAGFF-HGTKTY  376

Query  361  CPDHKSLLYVPC  326
            CP      YVPC
Sbjct  377  CPVST---YVPC  385



>ref|XP_006648837.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=437

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 74/123 (60%), Gaps = 5/123 (4%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCK-----L  533
            PYE+G+L  + V DA +NQLTGPIP SF CL  +E LNL +N+LYG +P +LC       
Sbjct  280  PYEVGMLTKANVIDAGMNQLTGPIPSSFSCLTSVEQLNLGSNRLYGEIPAALCNPAAGPA  339

Query  532  KDLEELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFLHYQKCPD  353
              L  L+LS NY T +GP C  L++  V+++ NNCI    NQR +  C  F    + CP+
Sbjct  340  SRLANLTLSSNYLTSVGPSCLPLIKDGVVNVKNNCIPGFANQRRSAECASFLSQPKTCPE  399

Query  352  HKS  344
              +
Sbjct  400  ASA  402



>ref|XP_002282474.2| PREDICTED: uncharacterized protein At4g06744 [Vitis vinifera]
 emb|CBI32376.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKLKDLEE  518
            P EIG LK  TVFD   N LTG +P S GCL   E LN   N  YG VPE LC LK+L+ 
Sbjct  292  PIEIGSLKELTVFDVGHNLLTGLLPCSLGCLHNAEQLNFAGNFFYGRVPEELCALKNLQN  351

Query  517  LSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQVCKDFFL  374
            L+LS NYFT+IGP CR+L+    +D+ NNCI +LP+QR    C  FFL
Sbjct  352  LTLSDNYFTKIGPNCRDLIPTGKIDLRNNCIRNLPDQRPRSDCLAFFL  399



>gb|ABS78906.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
 gb|ABS78907.1| At4g06744-like protein, partial [Arabidopsis lyrata subsp. petraea]
Length=174

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 70/103 (68%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+EIG L  ++V D   N+LTGP+P S  CLEK+E +N   N L+G+ PE++C L   +L
Sbjct  72   PHEIGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQVNFAGNLLFGAXPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL++ VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSBNYFTHVGPWCRGLLDRGVLDVSNNCIPFFPGQRSMQ  174



>gb|ABS78899.1| At4g06744-like protein, partial [Arabidopsis halleri subsp. halleri]
Length=174

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = -2

Query  697  PYEIGLLKNSTVFDASINQLTGPIPQSFGCLEKLEILNLTNNQLYGSVPESLCKL--KDL  524
            P+E G L  ++V D   N+LTGP+P S  CLEK+E LN   N L+G+VPE++C L   +L
Sbjct  72   PHEXGFLTGASVIDIGGNKLTGPLPLSLMCLEKVEQLNFAGNLLFGAVPEAVCMLLRDNL  131

Query  523  EELSLSGNYFTQIGPECRNLLEKKVLDIDNNCILDLPNQRSAQ  395
              LSLS NYFT +GP CR LL+  VLD+ NNCI   P QRS Q
Sbjct  132  VNLSLSNNYFTHVGPWCRGLLDXGVLDVSNNCIPFFPGQRSMQ  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160