BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044I15

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06960.1|  unnamed protein product                                340   1e-111   Coffea canephora [robusta coffee]
dbj|BAF37798.1|  hypothetical protein                                   339   2e-110   Ipomoea trifida
ref|XP_009605994.1|  PREDICTED: histone deacetylase 9                   332   1e-108   Nicotiana tomentosiformis
ref|XP_004251031.1|  PREDICTED: histone deacetylase 9                   332   1e-108   Solanum lycopersicum
ref|XP_006349095.1|  PREDICTED: histone deacetylase 9-like              331   3e-108   Solanum tuberosum [potatoes]
ref|XP_010093211.1|  Histone deacetylase 9                              331   3e-108   Morus notabilis
gb|KDO51343.1|  hypothetical protein CISIN_1g0130382mg                  323   4e-108   Citrus sinensis [apfelsine]
ref|XP_010661436.1|  PREDICTED: histone deacetylase 9 isoform X2        324   5e-108   Vitis vinifera
ref|XP_010243527.1|  PREDICTED: histone deacetylase 9                   329   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_009364273.1|  PREDICTED: histone deacetylase 9                   328   4e-107   Pyrus x bretschneideri [bai li]
ref|XP_004160104.1|  PREDICTED: histone deacetylase 9-like              320   2e-106   
ref|XP_010692976.1|  PREDICTED: histone deacetylase 9 isoform X4        318   7e-106   
ref|XP_008349785.1|  PREDICTED: histone deacetylase 9                   325   8e-106   Malus domestica [apple tree]
ref|XP_010031478.1|  PREDICTED: histone deacetylase 9 isoform X2        318   9e-106   Eucalyptus grandis [rose gum]
ref|XP_004506146.1|  PREDICTED: histone deacetylase 9-like              325   1e-105   Cicer arietinum [garbanzo]
ref|XP_009364877.1|  PREDICTED: histone deacetylase 9-like              324   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_008227403.1|  PREDICTED: histone deacetylase 9 isoform X2        321   1e-105   
gb|KDP34706.1|  hypothetical protein JCGZ_10911                         324   2e-105   Jatropha curcas
ref|XP_007205234.1|  hypothetical protein PRUPE_ppa006053mg             323   3e-105   Prunus persica
emb|CAN77816.1|  hypothetical protein VITISV_020659                     323   4e-105   Vitis vinifera
gb|KEH29890.1|  histone deacetylase family protein                      322   4e-105   Medicago truncatula
ref|XP_002266492.1|  PREDICTED: histone deacetylase 9 isoform X1        323   4e-105   Vitis vinifera
ref|XP_002300554.1|  histone deacetylase-related family protein         323   6e-105   Populus trichocarpa [western balsam poplar]
ref|XP_006471388.1|  PREDICTED: histone deacetylase 9-like              323   7e-105   Citrus sinensis [apfelsine]
ref|XP_011005322.1|  PREDICTED: histone deacetylase 9 isoform X3        322   9e-105   Populus euphratica
ref|XP_006424306.1|  hypothetical protein CICLE_v10029823mg             322   1e-104   Citrus clementina [clementine]
ref|XP_008227393.1|  PREDICTED: histone deacetylase 9 isoform X1        322   1e-104   Prunus mume [ume]
ref|XP_003606237.1|  Histone deacetylase                                322   1e-104   Medicago truncatula
gb|KHG07653.1|  Histone deacetylase 9 -like protein                     314   2e-104   Gossypium arboreum [tree cotton]
ref|XP_007142469.1|  hypothetical protein PHAVU_008G283200g             321   3e-104   Phaseolus vulgaris [French bean]
ref|XP_008788401.1|  PREDICTED: histone deacetylase 17 isoform X3       314   3e-104   Phoenix dactylifera
ref|XP_010651716.1|  PREDICTED: histone deacetylase 9                   321   3e-104   Vitis vinifera
gb|KCW50786.1|  hypothetical protein EUGRSUZ_J00456                     321   4e-104   Eucalyptus grandis [rose gum]
emb|CDY08684.1|  BnaC03g54980D                                          320   4e-104   Brassica napus [oilseed rape]
ref|XP_009150313.1|  PREDICTED: histone deacetylase 9                   319   1e-103   
ref|XP_008458610.1|  PREDICTED: histone deacetylase 9 isoform X4        317   2e-103   Cucumis melo [Oriental melon]
ref|XP_007132395.1|  hypothetical protein PHAVU_011G091100g             319   2e-103   Phaseolus vulgaris [French bean]
ref|XP_010692974.1|  PREDICTED: histone deacetylase 9 isoform X2        318   2e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004300044.1|  PREDICTED: histone deacetylase 9                   319   2e-103   Fragaria vesca subsp. vesca
ref|XP_008458609.1|  PREDICTED: histone deacetylase 9 isoform X3        318   2e-103   Cucumis melo [Oriental melon]
ref|XP_002529076.1|  histone deacetylase 1, 2 ,3, putative              318   4e-103   Ricinus communis
ref|XP_006591090.1|  PREDICTED: histone deacetylase 9-like isofor...    318   4e-103   
gb|KJB35350.1|  hypothetical protein B456_006G110500                    311   4e-103   Gossypium raimondii
ref|XP_010692973.1|  PREDICTED: histone deacetylase 9 isoform X1        318   5e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003538135.1|  PREDICTED: histone deacetylase 9-like isofor...    318   5e-103   Glycine max [soybeans]
gb|KHN38656.1|  Histone deacetylase 9                                   318   6e-103   Glycine soja [wild soybean]
ref|XP_006592310.1|  PREDICTED: histone deacetylase 9 isoform X2        315   6e-103   Glycine max [soybeans]
ref|XP_008458605.1|  PREDICTED: histone deacetylase 9 isoform X1        318   6e-103   Cucumis melo [Oriental melon]
ref|XP_004145792.1|  PREDICTED: histone deacetylase 9-like              318   6e-103   Cucumis sativus [cucumbers]
ref|XP_009404814.1|  PREDICTED: histone deacetylase 9 isoform X3        313   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279377.1|  hypothetical protein CARUB_v10007995mg             316   2e-102   Capsella rubella
ref|XP_006419115.1|  hypothetical protein EUTSA_v10002540mg             316   2e-102   Eutrema salsugineum [saltwater cress]
ref|XP_010031477.1|  PREDICTED: histone deacetylase 9 isoform X1        316   3e-102   Eucalyptus grandis [rose gum]
ref|XP_003539814.1|  PREDICTED: histone deacetylase 9 isoform X1        315   4e-102   Glycine max [soybeans]
ref|XP_009404813.1|  PREDICTED: histone deacetylase 9 isoform X2        312   9e-102   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU20217.1|  unknown                                                 314   1e-101   Glycine max [soybeans]
ref|XP_010514792.1|  PREDICTED: histone deacetylase 9                   314   1e-101   Camelina sativa [gold-of-pleasure]
ref|NP_190054.2|  histone deacetylase 9                                 313   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404815.1|  PREDICTED: histone deacetylase 9 isoform X4        312   3e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010425885.1|  PREDICTED: histone deacetylase 9 isoform X1        313   4e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010503116.1|  PREDICTED: histone deacetylase 9-like              312   9e-101   Camelina sativa [gold-of-pleasure]
ref|XP_007015910.1|  Histone deacetylase 9 isoform 7                    311   1e-100   
ref|XP_010940301.1|  PREDICTED: histone deacetylase 9                   312   1e-100   Elaeis guineensis
ref|XP_009404812.1|  PREDICTED: histone deacetylase 9 isoform X1        311   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008788384.1|  PREDICTED: histone deacetylase 9 isoform X1        311   2e-100   Phoenix dactylifera
ref|XP_006851552.1|  hypothetical protein AMTR_s00040p00182290          311   3e-100   
ref|XP_007015904.1|  Histone deacetylase 9 isoform 1                    311   3e-100   Theobroma cacao [chocolate]
ref|XP_010541292.1|  PREDICTED: histone deacetylase 9 isoform X2        304   3e-100   Tarenaya hassleriana [spider flower]
emb|CAE04901.1|  OSJNBa0042I15.23                                       301   4e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011005321.1|  PREDICTED: histone deacetylase 9 isoform X2        307   7e-99    Populus euphratica
ref|XP_008668621.1|  PREDICTED: histone deacetylase isoform X1          305   8e-99    Zea mays [maize]
emb|CAB72470.1|  putative protein                                       306   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005320.1|  PREDICTED: histone deacetylase 9 isoform X1        307   2e-98    Populus euphratica
ref|NP_001052725.1|  Os04g0409600                                       301   4e-98    
gb|ACR37742.1|  unknown                                                 304   5e-98    Zea mays [maize]
gb|EMT12816.1|  Histone deacetylase 9                                   302   2e-97    
tpg|DAA37954.1|  TPA: histone deacetylase                               303   2e-97    
tpg|DAA37953.1|  TPA: histone deacetylase, mRNA                         303   2e-97    
ref|NP_001105077.1|  histone deacetylase                                303   2e-97    Zea mays [maize]
gb|ACD50313.1|  histone deacetylase RPD3/HDA1 class I isoform 1         303   2e-97    Hordeum vulgare [barley]
ref|XP_004975539.1|  PREDICTED: histone deacetylase 9-like isofor...    301   3e-97    
ref|XP_010541291.1|  PREDICTED: histone deacetylase 9 isoform X1        303   3e-97    Tarenaya hassleriana [spider flower]
ref|XP_008458611.1|  PREDICTED: histone deacetylase 17 isoform X5       294   4e-97    
ref|XP_003579685.1|  PREDICTED: histone deacetylase 9 isoform X1        302   7e-97    Brachypodium distachyon [annual false brome]
ref|XP_006652253.1|  PREDICTED: histone deacetylase 9-like              302   9e-97    Oryza brachyantha
ref|XP_002446401.1|  hypothetical protein SORBIDRAFT_06g015420          301   2e-96    Sorghum bicolor [broomcorn]
ref|XP_004975538.1|  PREDICTED: histone deacetylase 9-like isofor...    300   3e-96    Setaria italica
ref|XP_011090014.1|  PREDICTED: histone deacetylase 17 isoform X2       294   5e-96    Sesamum indicum [beniseed]
emb|CAH66503.1|  H0321H01.12                                            300   5e-96    Oryza sativa [red rice]
gb|EYU36088.1|  hypothetical protein MIMGU_mgv1a006831mg                297   7e-95    Erythranthe guttata [common monkey flower]
gb|KCW50787.1|  hypothetical protein EUGRSUZ_J00456                     295   2e-94    Eucalyptus grandis [rose gum]
ref|XP_011090013.1|  PREDICTED: histone deacetylase 9 isoform X1        293   3e-93    Sesamum indicum [beniseed]
ref|XP_001774667.1|  class I RPD3 type histone deacetylase protein      293   3e-93    
ref|XP_002877352.1|  hypothetical protein ARALYDRAFT_347545             309   6e-93    
ref|XP_008458608.1|  PREDICTED: histone deacetylase 9 isoform X2        291   9e-93    Cucumis melo [Oriental melon]
ref|XP_007015905.1|  Histone deacetylase 9 isoform 2                    290   1e-92    
emb|CAN75079.1|  hypothetical protein VITISV_007579                     284   2e-90    Vitis vinifera
ref|XP_002966032.1|  hypothetical protein SELMODRAFT_84957              284   8e-90    
ref|XP_002971460.1|  hypothetical protein SELMODRAFT_172161             283   2e-89    
gb|EYU36089.1|  hypothetical protein MIMGU_mgv1a006831mg                280   1e-88    Erythranthe guttata [common monkey flower]
gb|KHN21123.1|  Histone deacetylase 9                                   271   3e-84    Glycine soja [wild soybean]
ref|XP_010692975.1|  PREDICTED: histone deacetylase 17 isoform X3       254   7e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_190035.1|  histone deacetylase 17                                253   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425886.1|  PREDICTED: histone deacetylase 17 isoform X2       248   2e-79    Camelina sativa [gold-of-pleasure]
gb|KCW50788.1|  hypothetical protein EUGRSUZ_J00456                     252   9e-78    Eucalyptus grandis [rose gum]
gb|KCW50789.1|  hypothetical protein EUGRSUZ_J00456                     252   1e-77    Eucalyptus grandis [rose gum]
ref|XP_007015911.1|  Histone deacetylase 9 isoform 8                    249   9e-77    
ref|XP_007015906.1|  Histone deacetylase 9 isoform 3                    248   8e-76    
ref|NP_190052.1|  histone deacetylase 10                                214   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003060152.1|  histone deacetylase                                223   3e-66    Micromonas pusilla CCMP1545
ref|XP_002504208.1|  histone deacetylase                                220   4e-65    Micromonas commoda
ref|XP_005652289.1|  class I RPD3 type histone deacetylase protein      217   7e-64    Coccomyxa subellipsoidea C-169
gb|EMS54283.1|  putative histone deacetylase 19                         217   5e-63    Triticum urartu
ref|XP_010227570.1|  PREDICTED: probable histone deacetylase 19 i...    216   5e-63    
ref|XP_010028889.1|  PREDICTED: histone deacetylase 19 isoform X1       216   7e-63    Eucalyptus grandis [rose gum]
ref|XP_010028890.1|  PREDICTED: histone deacetylase 19 isoform X2       215   7e-63    Eucalyptus grandis [rose gum]
ref|XP_003563706.1|  PREDICTED: probable histone deacetylase 19 i...    216   8e-63    Brachypodium distachyon [annual false brome]
ref|XP_001162233.1|  PREDICTED: histone deacetylase 1 isoform X3        214   9e-63    
ref|XP_009451191.1|  PREDICTED: histone deacetylase 1 isoform X2        214   2e-62    
gb|AFK48350.1|  unknown                                                 209   2e-62    Lotus japonicus
ref|XP_519834.2|  PREDICTED: histone deacetylase 1 isoform X1           214   3e-62    
ref|XP_009389921.1|  PREDICTED: probable histone deacetylase 19         214   4e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010881163.1|  PREDICTED: histone deacetylase 2                   214   5e-62    Esox lucius
ref|XP_008809711.1|  PREDICTED: probable histone deacetylase 19         214   5e-62    Phoenix dactylifera
ref|XP_011099710.1|  PREDICTED: histone deacetylase 19 isoform X2       213   6e-62    Sesamum indicum [beniseed]
ref|XP_006158173.1|  PREDICTED: histone deacetylase 1                   213   9e-62    Tupaia chinensis
gb|KDO51346.1|  hypothetical protein CISIN_1g0130382mg                  203   1e-61    Citrus sinensis [apfelsine]
ref|XP_011260199.1|  PREDICTED: histone deacetylase Rpd3                212   1e-61    
ref|XP_011099707.1|  PREDICTED: histone deacetylase 19 isoform X1       212   2e-61    Sesamum indicum [beniseed]
gb|ELW48624.1|  Histone deacetylase 1                                   212   3e-61    Tupaia chinensis
ref|XP_004225492.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    213   3e-61    Ciona intestinalis [sea vase]
ref|XP_010008493.1|  PREDICTED: histone deacetylase 1                   205   4e-61    Nestor notabilis
ref|XP_002424887.1|  histone deacetylase RPD3, putative                 207   5e-61    Pediculus humanus corporis [human body lice]
ref|XP_008482135.1|  PREDICTED: histone deacetylase Rpd3-like           209   8e-61    Diaphorina citri
ref|XP_003690250.1|  PREDICTED: histone deacetylase Rpd3-like           210   1e-60    
ref|XP_394976.4|  PREDICTED: histone deacetylase Rpd3 isoform 1         210   1e-60    Apis mellifera [bee]
ref|XP_004358601.1|  histone deacetylase family protein                 209   2e-60    Cavenderia fasciculata
ref|XP_003707550.1|  PREDICTED: histone deacetylase Rpd3-like           209   2e-60    Megachile rotundata
ref|NP_001161325.1|  Rpd3 histone deacetylase                           209   2e-60    Nasonia vitripennis
ref|XP_003485786.1|  PREDICTED: histone deacetylase Rpd3-like           209   2e-60    
ref|XP_005984211.1|  PREDICTED: histone deacetylase 2-like              209   3e-60    Pantholops hodgsonii [Tibetan antelope]
gb|KDR17587.1|  Histone deacetylase Rpd3                                207   3e-60    Zootermopsis nevadensis
ref|XP_011181414.1|  PREDICTED: histone deacetylase Rpd3 isoform X2     208   3e-60    
ref|XP_011154868.1|  PREDICTED: histone deacetylase Rpd3                209   4e-60    Harpegnathos saltator
ref|XP_010934971.1|  PREDICTED: histone deacetylase 19-like isofo...    208   6e-60    Elaeis guineensis
ref|XP_010935047.1|  PREDICTED: histone deacetylase 19-like isofo...    208   7e-60    Elaeis guineensis
ref|XP_011494484.1|  PREDICTED: histone deacetylase Rpd3                208   7e-60    Ceratosolen solmsi marchali
ref|XP_002983212.1|  hypothetical protein SELMODRAFT_234196             206   8e-60    
ref|XP_011204627.1|  PREDICTED: histone deacetylase Rpd3                207   8e-60    Bactrocera dorsalis [papaya fruit fly]
ref|XP_011311168.1|  PREDICTED: histone deacetylase Rpd3                207   8e-60    Fopius arisanus
ref|XP_011181413.1|  PREDICTED: histone deacetylase Rpd3 isoform X1     207   9e-60    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011158304.1|  PREDICTED: histone deacetylase Rpd3-like           207   1e-59    Solenopsis invicta [imported red fire ant]
ref|XP_011334448.1|  PREDICTED: histone deacetylase Rpd3-like           207   1e-59    Ooceraea biroi
ref|XP_004519082.1|  PREDICTED: histone deacetylase Rpd3-like           207   1e-59    Ceratitis capitata [medfly]
ref|XP_009202183.1|  PREDICTED: histone deacetylase 1                   202   1e-59    
gb|EFN65822.1|  Histone deacetylase Rpd3                                207   1e-59    Camponotus floridanus
ref|XP_011260173.1|  PREDICTED: histone deacetylase Rpd3-like           207   1e-59    Camponotus floridanus
ref|XP_006537073.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-59    
gb|KFP83316.1|  Histone deacetylase 1                                   204   1e-59    Acanthisitta chloris
ref|XP_011061203.1|  PREDICTED: histone deacetylase Rpd3 isoform X2     206   1e-59    Acromyrmex echinatior
ref|XP_011061204.1|  PREDICTED: histone deacetylase Rpd3 isoform X3     206   1e-59    Acromyrmex echinatior
ref|XP_011061205.1|  PREDICTED: histone deacetylase Rpd3 isoform X4     206   2e-59    Acromyrmex echinatior
gb|KFP50838.1|  Histone deacetylase 1                                   204   2e-59    Cathartes aura
dbj|BAG61272.1|  unnamed protein product                                201   2e-59    Homo sapiens [man]
ref|XP_002114310.1|  hypothetical protein TRIADDRAFT_64072              208   2e-59    Trichoplax adhaerens
ref|XP_004329860.1|  PREDICTED: histone deacetylase 1-like              201   2e-59    
ref|XP_011334447.1|  PREDICTED: histone deacetylase Rpd3-like           207   2e-59    Ooceraea biroi
gb|KHJ79031.1|  hypothetical protein OESDEN_21332                       200   2e-59    Oesophagostomum dentatum [nodule worm]
gb|ETN61439.1|  histone deacetylase                                     206   2e-59    Anopheles darlingi [American malaria mosquito]
ref|XP_002060037.1|  GJ15512                                            207   2e-59    Drosophila virilis
ref|XP_009076065.1|  PREDICTED: histone deacetylase 1                   204   2e-59    Acanthisitta chloris
dbj|GAN08679.1|  histone deacetylase 1/2                                211   2e-59    Mucor ambiguus
ref|XP_008554767.1|  PREDICTED: histone deacetylase Rpd3                206   3e-59    
ref|XP_001848775.1|  histone deacetylase Rpd3                           206   3e-59    Culex quinquefasciatus
gb|KFO76881.1|  Histone deacetylase 1                                   203   3e-59    Cuculus canorus
ref|XP_002961351.1|  hypothetical protein SELMODRAFT_74186              206   3e-59    
gb|EPB86954.1|  histone deacetylase 1/2                                 210   3e-59    Mucor circinelloides f. circinelloides 1006PhL
gb|EUB61434.1|  Histone deacetylase                                     207   3e-59    Echinococcus granulosus
ref|XP_011061202.1|  PREDICTED: histone deacetylase Rpd3 isoform X1     206   3e-59    Acromyrmex echinatior
gb|AHW42410.1|  hdac1                                                   206   3e-59    Echinococcus multilocularis
ref|XP_001943175.3|  PREDICTED: histone deacetylase Rpd3-like           206   4e-59    
ref|XP_008869930.1|  hypothetical protein H310_06587                    205   4e-59    Aphanomyces invadans
ref|XP_001946674.2|  PREDICTED: histone deacetylase Rpd3-like           205   4e-59    
ref|XP_010073968.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    205   4e-59    Pterocles gutturalis
gb|EPQ15222.1|  Histone deacetylase 1                                   203   4e-59    Myotis brandtii
ref|XP_004643035.1|  PREDICTED: histone deacetylase 1                   203   5e-59    
gb|KFB51427.1|  histone deacetylase Rpd3                                206   5e-59    Anopheles sinensis
ref|XP_316539.2|  AGAP006511-PA                                         205   5e-59    Anopheles gambiae str. PEST
ref|XP_009906717.1|  PREDICTED: histone deacetylase 1                   205   5e-59    Picoides pubescens
emb|CDS23263.1|  histone deacetylase 1                                  206   5e-59    Echinococcus granulosus
ref|XP_009469103.1|  PREDICTED: histone deacetylase 1                   204   5e-59    Nipponia nippon
ref|XP_005509669.1|  PREDICTED: histone deacetylase 1                   204   5e-59    Columba livia [carrier pigeon]
ref|XP_009560131.1|  PREDICTED: histone deacetylase 1                   204   5e-59    Cuculus canorus
ref|XP_008491052.1|  PREDICTED: histone deacetylase 1                   204   5e-59    Calypte anna
ref|XP_009968174.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Tyto alba [Schleiereule]
ref|XP_009330447.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Pygoscelis adeliae
ref|XP_005142468.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Melopsittacus undulatus
ref|XP_010721789.1|  PREDICTED: histone deacetylase 1                   204   6e-59    
ref|XP_010209083.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Colius striatus
ref|XP_004358133.1|  histone deacetylase family protein                 200   6e-59    Cavenderia fasciculata
ref|XP_009699610.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Cariama cristata
ref|XP_009679321.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Struthio camelus australis
ref|XP_007444029.1|  PREDICTED: histone deacetylase 1-like              200   6e-59    
ref|XP_010129593.1|  PREDICTED: histone deacetylase 1                   204   6e-59    Buceros rhinoceros silvestris
ref|XP_008918838.1|  PREDICTED: histone deacetylase 1                   204   6e-59    
gb|KFR03534.1|  Histone deacetylase 1                                   204   7e-59    Nipponia nippon
ref|XP_005191575.1|  PREDICTED: histone deacetylase Rpd3                205   7e-59    Musca domestica
ref|XP_011050777.1|  PREDICTED: histone deacetylase Rpd3-like           205   7e-59    Acromyrmex echinatior
ref|XP_005058307.1|  PREDICTED: histone deacetylase 1 isoform X2        204   7e-59    
gb|KFR06102.1|  Histone deacetylase 1                                   203   7e-59    Opisthocomus hoazin [hoatzin]
ref|XP_003397521.1|  PREDICTED: hypothetical protein LOC100642763       213   7e-59    
ref|XP_007669959.1|  PREDICTED: histone deacetylase 1                   204   7e-59    
ref|XP_005427182.1|  PREDICTED: histone deacetylase 1                   204   8e-59    
gb|KFO60221.1|  Histone deacetylase 1                                   204   8e-59    Corvus brachyrhynchos
gb|EOB00696.1|  Histone deacetylase 1                                   204   8e-59    Anas platyrhynchos [duck]
gb|KFV75060.1|  Histone deacetylase 1                                   204   8e-59    Picoides pubescens
gb|KFV55204.1|  Histone deacetylase 1                                   204   8e-59    Tyto alba [Schleiereule]
gb|KFP28914.1|  Histone deacetylase 1                                   204   8e-59    Colius striatus
gb|KFM11275.1|  Histone deacetylase 1                                   204   8e-59    Aptenodytes forsteri
gb|KFV84480.1|  Histone deacetylase 1                                   204   8e-59    Struthio camelus australis
gb|KFP00125.1|  Histone deacetylase 1                                   204   9e-59    Calypte anna
gb|KFP10889.1|  Histone deacetylase 1                                   204   9e-59    Egretta garzetta
gb|KGL79664.1|  Histone deacetylase 1                                   204   9e-59    Tinamus guttatus
gb|KFU91820.1|  Histone deacetylase 1                                   204   1e-58    Chaetura pelagica
gb|ACN25329.1|  unknown                                                 204   1e-58    Zea mays [maize]
ref|XP_009030811.1|  hypothetical protein HELRODRAFT_194553             207   1e-58    Helobdella robusta
ref|XP_008633314.1|  PREDICTED: histone deacetylase 1                   204   1e-58    
ref|XP_009929569.1|  PREDICTED: histone deacetylase 1                   203   1e-58    Opisthocomus hoazin [hoatzin]
gb|KFQ67796.1|  Histone deacetylase 1                                   204   1e-58    Phaethon lepturus
gb|EFX81904.1|  putative histone deacetylase HDAC3 protein              203   1e-58    Daphnia pulex
gb|EMC82692.1|  Histone deacetylase 1                                   204   1e-58    
gb|KFW72873.1|  Histone deacetylase 1                                   204   1e-58    Pygoscelis adeliae
emb|CDJ05997.1|  histone deacetylase 1                                  206   1e-58    
ref|XP_002438614.1|  hypothetical protein SORBIDRAFT_10g022820          205   1e-58    Sorghum bicolor [broomcorn]
ref|XP_002194370.2|  PREDICTED: histone deacetylase 1                   204   1e-58    
gb|KDO16344.1|  hypothetical protein SPRG_18127                         196   2e-58    Saprolegnia parasitica CBS 223.65
ref|NP_989487.1|  histone deacetylase 1                                 204   2e-58    Gallus gallus [bantam]
ref|XP_008788392.1|  PREDICTED: histone deacetylase 9 isoform X2        201   2e-58    Phoenix dactylifera
gb|AAB99850.1|  histone deacetylase 1                                   204   2e-58    Gallus gallus [bantam]
ref|XP_005058306.1|  PREDICTED: histone deacetylase 1 isoform X1        204   2e-58    
gb|AEP04145.1|  histone deacetylase 19                                  196   2e-58    Musa acuminata AAA Group [Cavendish banana]
ref|XP_009096801.1|  PREDICTED: histone deacetylase 1                   204   2e-58    
ref|XP_001946324.2|  PREDICTED: histone deacetylase Rpd3-like           204   2e-58    Acyrthosiphon pisum
ref|XP_010406403.1|  PREDICTED: histone deacetylase 1                   204   2e-58    
gb|ADO79635.1|  histone deacetylase                                     204   2e-58    Drosophila nasuta
gb|ADO79632.1|  histone deacetylase                                     204   2e-58    Drosophila albomicans
gb|EPY87302.1|  histone deacetylase 1 isoform 5-like protein            202   2e-58    Camelus ferus
ref|XP_006777443.1|  PREDICTED: histone deacetylase 1                   203   2e-58    
ref|XP_005529817.1|  PREDICTED: histone deacetylase 1                   204   2e-58    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004966013.1|  PREDICTED: probable histone deacetylase 19-like    204   2e-58    Setaria italica
gb|ADO79638.1|  histone deacetylase                                     204   2e-58    Drosophila nasuta
gb|AAK11182.1|AF321129_1  histone deacetylase 1                         197   2e-58    Rattus norvegicus [brown rat]
ref|XP_005020509.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    204   2e-58    
gb|EDL75478.1|  rCG23915                                                197   2e-58    Rattus norvegicus [brown rat]
gb|ADO79639.1|  histone deacetylase                                     204   3e-58    Drosophila nasuta
ref|XP_010216417.1|  PREDICTED: histone deacetylase 1                   204   3e-58    Tinamus guttatus
gb|EDL30187.1|  mCG12239                                                202   3e-58    Mus musculus [mouse]
ref|NP_001079396.1|  histone deacetylase 1                              203   3e-58    Xenopus laevis [clawed frog]
ref|XP_002007081.1|  GI12742                                            204   3e-58    Drosophila mojavensis
ref|XP_006117612.1|  PREDICTED: histone deacetylase 1                   203   4e-58    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008658381.1|  PREDICTED: uncharacterized protein LOC100276...    203   4e-58    
gb|AAF82385.1|  histone deacetylase                                     203   4e-58    Mesembryanthemum crystallinum
emb|CEP19880.1|  hypothetical protein                                   208   5e-58    Parasitella parasitica
ref|XP_005665257.1|  PREDICTED: histone deacetylase 1                   201   5e-58    
ref|XP_009412377.1|  PREDICTED: histone deacetylase 19-like             201   5e-58    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005302255.1|  PREDICTED: histone deacetylase 1                   202   5e-58    Chrysemys picta bellii
ref|XP_007977778.1|  PREDICTED: histone deacetylase 1 isoform X2        202   5e-58    Chlorocebus sabaeus
gb|EEE65931.1|  hypothetical protein OsJ_21797                          202   5e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004025420.1|  PREDICTED: histone deacetylase 1 isoform 2         202   5e-58    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_005544163.1|  PREDICTED: histone deacetylase 1 isoform X2        202   5e-58    Macaca fascicularis [crab eating macaque]
ref|XP_007507970.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    202   6e-58    
ref|XP_003276412.1|  PREDICTED: histone deacetylase 1 isoform 2         202   6e-58    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_008064942.1|  PREDICTED: histone deacetylase 1                   202   6e-58    
gb|ELU06885.1|  hypothetical protein CAPTEDRAFT_184599                  201   6e-58    Capitella teleta
ref|XP_006734228.1|  PREDICTED: histone deacetylase 1 isoform X2        202   6e-58    Leptonychotes weddellii
ref|XP_006274872.1|  PREDICTED: histone deacetylase 1 isoform X1        202   6e-58    
ref|XP_006019411.1|  PREDICTED: histone deacetylase 1 isoform X1        202   6e-58    
ref|XP_006094298.1|  PREDICTED: histone deacetylase 1                   202   6e-58    Myotis lucifugus
ref|XP_005878413.1|  PREDICTED: histone deacetylase 1                   202   6e-58    Myotis brandtii
ref|XP_006054695.1|  PREDICTED: histone deacetylase 1 isoform X2        202   6e-58    
ref|XP_006176266.1|  PREDICTED: histone deacetylase 1                   202   6e-58    
ref|XP_005676762.1|  PREDICTED: histone deacetylase 1                   202   6e-58    
ref|XP_005202952.1|  PREDICTED: histone deacetylase 1 isoform X1        202   6e-58    
sp|O42227.1|HDA1B_XENLA  RecName: Full=Probable histone deacetyla...    202   7e-58    
ref|XP_006924353.1|  PREDICTED: histone deacetylase 1                   202   7e-58    
ref|XP_002287594.1|  histone deactylase 1 HDAC Hda1p HDA1               201   7e-58    
ref|XP_007170675.1|  PREDICTED: histone deacetylase 1 isoform X2        202   7e-58    
gb|EMP28416.1|  Histone deacetylase 1                                   202   7e-58    
ref|XP_006734229.1|  PREDICTED: histone deacetylase 1 isoform X3        201   7e-58    
ref|XP_009827282.1|  hypothetical protein, variant 1                    200   7e-58    
dbj|BAD68731.1|  putative histone deacetylase HDAC1                     202   8e-58    
ref|XP_001946595.2|  PREDICTED: histone deacetylase Rpd3-like           202   8e-58    
ref|XP_004425952.1|  PREDICTED: histone deacetylase 1                   202   8e-58    
gb|EFB27370.1|  hypothetical protein PANDA_010851                       201   8e-58    
gb|EYC26109.1|  hypothetical protein Y032_0011g1565                     202   9e-58    
ref|NP_001273520.1|  histone deacetylase 1                              202   9e-58    
dbj|GAA41197.2|  histone deacetylase 1/2                                201   1e-57    
ref|XP_010619862.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|NP_001143835.1|  uncharacterized protein LOC100276617               201   1e-57    
ref|NP_001057943.1|  Os06g0583400                                       202   1e-57    
ref|XP_002742058.1|  PREDICTED: histone deacetylase 3-like              201   1e-57    
ref|XP_007468739.1|  PREDICTED: histone deacetylase 1 isoform X2        202   1e-57    
ref|XP_006734227.1|  PREDICTED: histone deacetylase 1 isoform X1        202   1e-57    
ref|XP_004740974.1|  PREDICTED: histone deacetylase 1 isoform X2        202   1e-57    
ref|XP_010184404.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
ref|XP_003828201.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_004025419.1|  PREDICTED: histone deacetylase 1 isoform 1         202   1e-57    
ref|NP_004955.2|  histone deacetylase 1                                 202   1e-57    
ref|XP_002921911.1|  PREDICTED: histone deacetylase 1                   202   1e-57    
ref|XP_007092478.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
gb|AAP36140.1|  Homo sapiens histone deacetylase 1                      202   1e-57    
ref|XP_009453837.1|  PREDICTED: histone deacetylase 1 isoform X2        201   1e-57    
ref|XP_004678799.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
gb|ELR48738.1|  Histone deacetylase 1                                   201   1e-57    
ref|XP_004850908.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
ref|XP_004406478.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
ref|XP_003801297.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
ref|XP_008846179.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
ref|NP_032254.1|  histone deacetylase 1                                 201   1e-57    
ref|XP_003276411.1|  PREDICTED: histone deacetylase 1 isoform 1         201   1e-57    
gb|EDL38458.1|  mCG128529                                               201   1e-57    
ref|XP_006678427.1|  hypothetical protein BATDEDRAFT_24371              203   1e-57    
ref|XP_007523321.1|  PREDICTED: histone deacetylase 1                   201   1e-57    
gb|AAB68398.1|  putative histone deacetylase                            201   2e-57    
ref|XP_003471128.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|NP_001020580.1|  histone deacetylase 1                              201   2e-57    
ref|XP_004591679.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|NP_001032521.1|  histone deacetylase 1                              201   2e-57    
ref|XP_006054694.1|  PREDICTED: histone deacetylase 1 isoform X1        201   2e-57    
ref|XP_006196994.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_004266568.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_003500683.1|  PREDICTED: histone deacetylase 1 isoform X1        201   2e-57    
ref|XP_002594632.1|  hypothetical protein BRAFLDRAFT_217516             201   2e-57    
ref|XP_008070975.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_002720761.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_002750618.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_004665328.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
gb|KHJ90568.1|  histone deacetylase family protein                      200   2e-57    
ref|XP_004887243.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_007170674.1|  PREDICTED: histone deacetylase 1 isoform X1        201   2e-57    
ref|XP_004603624.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_009174258.1|  hypothetical protein T265_09811                    202   2e-57    
ref|XP_010346435.1|  PREDICTED: histone deacetylase 1                   201   2e-57    
ref|XP_009827426.1|  hypothetical protein H257_04553                    200   2e-57    
ref|XP_003356353.2|  PREDICTED: histone deacetylase 1-like              201   2e-57    
ref|XP_005739016.1|  PREDICTED: histone deacetylase 1-like              201   2e-57    
ref|XP_005717961.1|  histone deacetylase                                200   2e-57    
ref|XP_009827280.1|  hypothetical protein H257_04460                    200   2e-57    
gb|KFQ23420.1|  Histone deacetylase 1                                   200   2e-57    
ref|XP_010149876.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    199   2e-57    
ref|XP_008877470.1|  hypothetical protein H310_12254                    199   2e-57    
ref|XP_010239874.1|  PREDICTED: histone deacetylase 9 isoform X2        197   3e-57    
ref|XP_001499986.4|  PREDICTED: histone deacetylase 1                   201   3e-57    
ref|XP_544435.2|  PREDICTED: histone deacetylase 1 isoform 1            201   3e-57    
ref|XP_007015912.1|  Histone deacetylase 9 isoform 9                    198   3e-57    
ref|XP_001655108.1|  AAEL011117-PA                                      199   3e-57    
ref|XP_007125154.1|  PREDICTED: histone deacetylase 1 isoform X1        202   4e-57    
ref|XP_002952849.1|  hypothetical protein VOLCADRAFT_62995              199   4e-57    
ref|XP_007468738.1|  PREDICTED: histone deacetylase 1 isoform X1        202   4e-57    
ref|XP_004740973.1|  PREDICTED: histone deacetylase 1 isoform X1        201   4e-57    
gb|KHJ80932.1|  hypothetical protein OESDEN_19387                       191   4e-57    
ref|XP_007637109.1|  PREDICTED: histone deacetylase 1 isoform X2        201   5e-57    
ref|XP_006085432.1|  PREDICTED: histone deacetylase 1-like              200   5e-57    
gb|KHJ82537.1|  hypothetical protein OESDEN_17769                       191   6e-57    
ref|XP_001695812.1|  histone deacetylase                                198   7e-57    
dbj|BAG70111.1|  histone deacetylase 1                                  200   7e-57    
ref|XP_008364370.1|  PREDICTED: histone deacetylase 19-like isofo...    200   7e-57    
emb|CAC19454.1|  histone deacetylase                                    201   7e-57    
gb|EHB04555.1|  Histone deacetylase 1                                   202   7e-57    
ref|XP_007125155.1|  PREDICTED: histone deacetylase 1 isoform X2        201   7e-57    
ref|XP_008364371.1|  PREDICTED: histone deacetylase 19-like isofo...    200   7e-57    
gb|EHJ72565.1|  histone deacetylase Rpd3                                199   8e-57    
ref|XP_001096929.2|  PREDICTED: histone deacetylase 1-like              200   8e-57    
ref|XP_008520120.1|  PREDICTED: histone deacetylase 1                   201   8e-57    
ref|XP_007873421.1|  hypothetical protein PNEG_01482                    197   8e-57    
ref|XP_007840320.1|  hypothetical protein PFICI_13548                   203   9e-57    
ref|XP_003292577.1|  hypothetical protein DICPUDRAFT_40779              199   9e-57    
ref|XP_008120699.1|  PREDICTED: histone deacetylase 1                   199   9e-57    
ref|XP_004931440.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    199   9e-57    
ref|XP_004705065.1|  PREDICTED: histone deacetylase 1                   199   1e-56    
ref|XP_003283132.1|  hypothetical protein DICPUDRAFT_85725              198   1e-56    
gb|AEE62688.1|  unknown                                                 199   1e-56    
ref|XP_010925053.1|  PREDICTED: histone deacetylase 19-like             199   1e-56    
ref|XP_009358923.1|  PREDICTED: histone deacetylase 19                  199   1e-56    
ref|XP_646719.1|  histone deacetylase family protein                    197   1e-56    
ref|XP_004322371.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    199   2e-56    
ref|XP_011387414.1|  histone deacetylase                                201   2e-56    
gb|ENN73569.1|  hypothetical protein YQE_09818                          199   2e-56    
gb|EYU34888.1|  hypothetical protein MIMGU_mgv1a006051mg                198   2e-56    
ref|XP_007043130.1|  Histone deacetylase 1 isoform 1                    199   2e-56    
ref|XP_006360329.1|  PREDICTED: histone deacetylase 19-like             199   3e-56    
ref|XP_007043132.1|  Histone deacetylase 1 isoform 3                    198   3e-56    
dbj|BAE22585.1|  unnamed protein product                                192   3e-56    
emb|CDI52252.1|  histone deacetylase                                    198   4e-56    
ref|XP_009399782.1|  PREDICTED: probable histone deacetylase 19         199   4e-56    
emb|CCX17442.1|  Similar to Histone deacetylase RPD3; acc. no. P3...    200   4e-56    
ref|XP_008382752.1|  PREDICTED: histone deacetylase 19                  198   4e-56    
ref|XP_006895025.1|  PREDICTED: histone deacetylase 1                   198   4e-56    
ref|XP_006862222.1|  PREDICTED: histone deacetylase 1                   198   4e-56    
ref|XP_004372056.1|  PREDICTED: histone deacetylase 1                   198   4e-56    
gb|KIW34517.1|  histone deacetylase RPD3                                201   4e-56    
ref|XP_966633.1|  PREDICTED: histone deacetylase Rpd3                   198   4e-56    
ref|XP_008348955.1|  PREDICTED: histone deacetylase 19-like             198   4e-56    
gb|EEC74955.1|  hypothetical protein OsI_10942                          203   5e-56    
gb|EFX74892.1|  putative histone deacetylase Rpd3 protein               199   5e-56    
ref|XP_004471453.1|  PREDICTED: histone deacetylase 1                   200   5e-56    
ref|XP_003571679.1|  PREDICTED: probable histone deacetylase 19         198   6e-56    
gb|EAZ22226.1|  hypothetical protein OsJ_05881                          198   6e-56    
ref|XP_011435047.1|  PREDICTED: histone deacetylase 3-like              196   6e-56    
gb|KFB43744.1|  AGAP001143-PA-like protein                              196   7e-56    
emb|CCJ31025.1|  unnamed protein product                                192   7e-56    
ref|XP_010380656.1|  PREDICTED: histone deacetylase 1-like isofor...    197   7e-56    
ref|XP_007948636.1|  PREDICTED: histone deacetylase 1                   197   8e-56    
ref|XP_009629140.1|  PREDICTED: histone deacetylase 19                  197   8e-56    
emb|CDS28565.1|  histone deacetylase 1                                  197   8e-56    
gb|ETL49347.1|  hypothetical protein L916_01156                         196   8e-56    
ref|XP_004247825.1|  PREDICTED: histone deacetylase 19                  197   8e-56    
emb|CBI37705.3|  unnamed protein product                                195   9e-56    
ref|XP_001732472.1|  hypothetical protein MGL_0247                      197   9e-56    
ref|XP_004922748.1|  PREDICTED: histone deacetylase 3-like              194   9e-56    
ref|NP_445898.1|  histone deacetylase 1-like                            197   1e-55    
ref|XP_008890897.1|  hypothetical protein PPTG_01052                    196   1e-55    
gb|ETI56169.1|  hypothetical protein F443_01243                         196   1e-55    
ref|XP_003415511.1|  PREDICTED: histone deacetylase 1                   197   1e-55    
ref|XP_004083964.1|  PREDICTED: histone deacetylase 2                   197   1e-55    
gb|ETN59692.1|  histone deacetylase                                     195   1e-55    
ref|XP_647498.1|  histone deacetylase family protein                    197   1e-55    
gb|EYU41224.1|  hypothetical protein MIMGU_mgv1a005940mg                196   1e-55    
dbj|BAA08909.1|  RPD3 protein                                           196   1e-55    
gb|EYU41225.1|  hypothetical protein MIMGU_mgv1a005940mg                196   1e-55    
gb|EYU41223.1|  hypothetical protein MIMGU_mgv1a005940mg                196   1e-55    
ref|XP_002171858.1|  histone deacetylase Clr6                           194   1e-55    
emb|CEG73087.1|  Putative Histone deacetylase domain-containing p...    198   1e-55    
ref|XP_001631125.1|  predicted protein                                  195   1e-55    
ref|XP_001592901.1|  hypothetical protein SS1G_05823                    199   1e-55    
ref|NP_001046284.1|  Os02g0214900                                       197   1e-55    
gb|EST06072.1|  histone deacetylase                                     198   1e-55    
ref|XP_008810081.1|  PREDICTED: histone deacetylase 19-like             196   2e-55    
ref|XP_009770456.1|  PREDICTED: histone deacetylase 19                  196   2e-55    
dbj|GAC96889.1|  potential Sin3.Rpd3 histone deacetylase complex ...    198   2e-55    
ref|XP_010915158.1|  PREDICTED: probable histone deacetylase 19         196   2e-55    
ref|XP_008558948.1|  PREDICTED: histone deacetylase 3                   195   2e-55    
gb|EIE85135.1|  histone deacetylase RPD3                                196   2e-55    
ref|XP_010925380.1|  PREDICTED: probable histone deacetylase 19         197   2e-55    
ref|XP_011083370.1|  PREDICTED: histone deacetylase 19                  196   2e-55    
ref|XP_003742933.1|  PREDICTED: histone deacetylase 1-like              196   2e-55    
gb|KIW81766.1|  histone deacetylase RPD3                                199   2e-55    
ref|XP_008235847.1|  PREDICTED: histone deacetylase 19                  196   2e-55    
gb|EZF25634.1|  hypothetical protein H100_02064                         195   2e-55    
ref|XP_010266325.1|  PREDICTED: histone deacetylase 19 isoform X1       196   2e-55    
ref|XP_010128574.1|  PREDICTED: histone deacetylase 2                   194   2e-55    
ref|XP_007265905.1|  hypothetical protein FOMMEDRAFT_81600              198   3e-55    
gb|ERE77200.1|  histone deacetylase 1-like protein                      196   3e-55    
gb|KFQ37861.1|  Histone deacetylase 2                                   194   3e-55    
emb|CEI90063.1|  Putative Histone deacetylase                           197   3e-55    
ref|XP_007787138.1|  hypothetical protein EPUS_08444                    198   3e-55    
ref|XP_002908492.1|  histone deacetylase, putative                      195   3e-55    
ref|XP_010526532.1|  PREDICTED: histone deacetylase 19                  196   3e-55    
ref|XP_004537015.1|  PREDICTED: histone deacetylase 3-like              194   3e-55    
ref|XP_008619746.1|  histone deacetylase 1                              194   3e-55    
emb|CEI89045.1|  Putative Histone deacetylase                           197   3e-55    
emb|CEG73086.1|  Putative Histone deacetylase                           197   3e-55    
ref|XP_010185293.1|  PREDICTED: histone deacetylase 2                   194   3e-55    
gb|KDO68452.1|  hypothetical protein CISIN_1g010834mg                   194   3e-55    
gb|KIM97807.1|  hypothetical protein OIDMADRAFT_168005                  198   3e-55    
ref|XP_007624850.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    195   4e-55    
gb|KDO68451.1|  hypothetical protein CISIN_1g010834mg                   195   4e-55    
gb|EHJ71179.1|  histone deacetylase 3                                   193   4e-55    
gb|KEF55411.1|  histone deacetylase 1/2                                 199   4e-55    
gb|AJH76982.1|  histone deacetylase 3                                   194   4e-55    
emb|CCA14006.1|  histone deacetylase putative                           196   4e-55    
ref|XP_009385604.1|  PREDICTED: histone deacetylase 19-like             194   4e-55    
ref|XP_002029476.1|  GL22005                                            189   4e-55    
ref|XP_006743523.1|  PREDICTED: histone deacetylase 2-like isofor...    194   4e-55    
ref|XP_008396745.1|  PREDICTED: histone deacetylase 2                   194   4e-55    
gb|ELK32919.1|  Histone deacetylase 2                                   193   5e-55    
ref|XP_006743524.1|  PREDICTED: histone deacetylase 2-like isofor...    194   5e-55    
ref|XP_003977374.1|  PREDICTED: histone deacetylase 2-like              195   5e-55    
gb|EJK57351.1|  hypothetical protein THAOC_22614                        194   5e-55    
ref|XP_006486546.1|  PREDICTED: histone deacetylase 19-like             195   5e-55    
ref|XP_006422366.1|  hypothetical protein CICLE_v10028261mg             195   5e-55    
ref|XP_001641983.1|  predicted protein                                  194   5e-55    
ref|XP_007563814.1|  PREDICTED: probable histone deacetylase 1-B        195   5e-55    
ref|XP_010690952.1|  PREDICTED: histone deacetylase 19                  195   5e-55    
gb|EFA80855.1|  WD40 repeat-containing protein                          202   5e-55    
ref|XP_794761.1|  PREDICTED: histone deacetylase 3-like                 194   5e-55    
ref|XP_005409821.1|  PREDICTED: histone deacetylase 2                   194   5e-55    
ref|XP_006422367.1|  hypothetical protein CICLE_v10028261mg             195   5e-55    
ref|XP_003633720.1|  PREDICTED: histone deacetylase 19                  195   5e-55    
ref|XP_001560049.1|  hypothetical protein BC1G_01608                    197   5e-55    
emb|CCD46681.1|  similar to histone deacetylase RpdA/Rpd3               197   6e-55    
ref|XP_008065357.1|  PREDICTED: histone deacetylase 2                   194   6e-55    
ref|XP_009863691.1|  PREDICTED: histone deacetylase 2                   194   6e-55    
ref|XP_009891908.1|  PREDICTED: histone deacetylase 2 isoform X2        194   6e-55    
ref|XP_009287417.1|  PREDICTED: histone deacetylase 2                   194   6e-55    
emb|CDQ67004.1|  unnamed protein product                                194   6e-55    
ref|NP_001265942.1|  Histone deacetylase 2                              194   6e-55    
ref|XP_009499900.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    194   6e-55    
gb|EEC72745.1|  hypothetical protein OsI_06369                          195   6e-55    
gb|AAK01712.1|AF332875_1  histone deacetylase HD1                       195   6e-55    



>emb|CDP06960.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLL+TGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLITGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA+ETGVLLD+ELPNEIP+NDYIK+F PDYSLKIPGGHIENLNSKSYLGTIK
Sbjct  301  TKENVARCWAFETGVLLDTELPNEIPENDYIKFFEPDYSLKIPGGHIENLNSKSYLGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
             +VLENLRYIQHAP VQMQEVPPDFY+PDFDED QNPDER+DQHTQDKQIQRDDEYY+GD
Sbjct  361  MNVLENLRYIQHAPGVQMQEVPPDFYLPDFDEDEQNPDERMDQHTQDKQIQRDDEYYDGD  420

Query  156  ndnDHSMDD  130
            NDNDH+M+D
Sbjct  421  NDNDHNMED  429



>dbj|BAF37798.1| hypothetical protein [Ipomoea trifida]
Length=496

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/241 (78%), Positives = 189/241 (78%), Gaps = 51/241 (21%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDG-----------------------  586
            IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDG                       
Sbjct  256  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGASLLVIKVLFGHHSTFCKDISVV  315

Query  585  ----------------------------HAECVRFVKKFNIPLLVTGGGGYTKENVARCW  490
                                        HAECVRFVKKFNIPLLVTGGGGYTKENVARCW
Sbjct  316  YLFPSTNLSCNFLGDFYMGMFYLMLLAGHAECVRFVKKFNIPLLVTGGGGYTKENVARCW  375

Query  489  AYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRY  310
             YETG+LLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK+HVLENLRY
Sbjct  376  TYETGILLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKTHVLENLRY  435

Query  309  IQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegdndnDHSMDD  130
            IQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRDDEYYEGDNDNDHSMDD
Sbjct  436  IQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRDDEYYEGDNDNDHSMDD  495

Query  129  A  127
            A
Sbjct  496  A  496



>ref|XP_009605994.1| PREDICTED: histone deacetylase 9 [Nicotiana tomentosiformis]
 ref|XP_009788798.1| PREDICTED: histone deacetylase 9 isoform X1 [Nicotiana sylvestris]
 ref|XP_009788799.1| PREDICTED: histone deacetylase 9 isoform X2 [Nicotiana sylvestris]
Length=430

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYSPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIPDNDYIKYFGPDYSLK+PGGHIENLNSKSY+GTIK
Sbjct  301  TKENVARCWALETGVLLDTELPNEIPDNDYIKYFGPDYSLKLPGGHIENLNSKSYIGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+ENLR IQHAP VQMQEVPPDFYIPDFDED QNPDER+DQHTQDK IQR
Sbjct  361  MQVMENLRCIQHAPGVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKHIQR  412



>ref|XP_004251031.1| PREDICTED: histone deacetylase 9 [Solanum lycopersicum]
Length=430

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIPDNDYIKYF PDYSLK+PGGHIENLNSKSY+GTIK
Sbjct  301  TKENVARCWALETGVLLDTELPNEIPDNDYIKYFAPDYSLKLPGGHIENLNSKSYIGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+ENLR +QHAPSVQMQEVPPDFYIPDFDED QNPDER++QHTQDK IQR
Sbjct  361  MQVMENLRCLQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVNQHTQDKHIQR  412



>ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solanum tuberosum]
Length=430

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIPDNDYIKYF PDYSLK+PGGHIENLNSKSY+GTIK
Sbjct  301  TKENVARCWALETGVLLDTELPNEIPDNDYIKYFAPDYSLKLPGGHIENLNSKSYIGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+ENLR +QHAPSVQMQEVPPDF+IPDFDED QNPDER++QHTQDK IQR
Sbjct  361  MQVMENLRCLQHAPSVQMQEVPPDFFIPDFDEDEQNPDERVNQHTQDKHIQR  412



>ref|XP_010093211.1| Histone deacetylase 9 [Morus notabilis]
 gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis]
Length=429

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF P++SLKIP GHIENLNSKSYLGTIK
Sbjct  301  TKENVARCWTLETGVLLDTELPNEIPDNEYIKYFAPEFSLKIPHGHIENLNSKSYLGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQH +DKQIQR
Sbjct  361  VQVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHARDKQIQR  412



>gb|KDO51343.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
 gb|KDO51344.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
 gb|KDO51345.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
Length=220

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  32   IISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  91

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+N+YIKYF P+ SL+IP GHIENLNSKSYL TIK
Sbjct  92   TKENVARCWTVETGILLDTELPNEIPENEYIKYFAPECSLRIPNGHIENLNSKSYLSTIK  151

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDKQIQR
Sbjct  152  MQVLENLRSIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQIQR  203



>ref|XP_010661436.1| PREDICTED: histone deacetylase 9 isoform X2 [Vitis vinifera]
Length=241

 Score =   324 bits (830),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  52   IIAKVVETYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  111

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+YSLKIP GHIENLNSKSY+GTIK
Sbjct  112  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPEYSLKIPNGHIENLNSKSYIGTIK  171

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+D+QIQR
Sbjct  172  MQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQIQR  223



>ref|XP_010243527.1| PREDICTED: histone deacetylase 9 [Nelumbo nucifera]
Length=430

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETG LLD+ELPNEIPDN+YIKYF PDYSLKIP G++ENLNSKSYLGTIK
Sbjct  301  TKENVARCWAVETGALLDTELPNEIPDNEYIKYFAPDYSLKIPNGNLENLNSKSYLGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              V ENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQIQRDDEYYEGD
Sbjct  361  MQVFENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTQDKQIQRDDEYYEGD  420

Query  156  ndnDHSMDDA  127
            NDND SMDDA
Sbjct  421  NDNDQSMDDA  430



>ref|XP_009364273.1| PREDICTED: histone deacetylase 9 [Pyrus x bretschneideri]
Length=430

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDSELPNEIPDN+YIKYF PD SL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDSELPNEIPDNEYIKYFSPDCSLRIPSGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDERLDQHTQDK IQRDDEYYEGD
Sbjct  361  IQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERLDQHTQDKNIQRDDEYYEGD  420

Query  156  ndnDHSMDD  130
            NDNDH+M+D
Sbjct  421  NDNDHNMED  429



>ref|XP_004160104.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus]
Length=248

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  59   IISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  118

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK
Sbjct  119  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIK  178

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  179  TQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  230



>ref|XP_010692976.1| PREDICTED: histone deacetylase 9 isoform X4 [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score =   318 bits (816),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  52   IISKVVEFYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  111

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIPDN+YIKYFGPDYSL+IP GHIENLNSKSYL TIK
Sbjct  112  TKENVARCWTVETGVLLDTDLPNEIPDNEYIKYFGPDYSLRIPNGHIENLNSKSYLTTIK  171

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQMQEVPPDFY+PDFDED +NPDER++QHTQDK IQRDDEYY+GD
Sbjct  172  MQVLENLRCIQHAPSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGD  230

Query  156  ndnDHSMDD  130
             DNDH+MDD
Sbjct  231  QDNDHNMDD  239



>ref|XP_008349785.1| PREDICTED: histone deacetylase 9 [Malus domestica]
Length=430

 Score =   325 bits (833),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDSELPNEIPDN+YIKYF PD SL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDSELPNEIPDNEYIKYFSPDCSLRIPNGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDERLDQ+TQDK IQR
Sbjct  361  IQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERLDQNTQDKHIQR  412



>ref|XP_010031478.1| PREDICTED: histone deacetylase 9 isoform X2 [Eucalyptus grandis]
Length=243

 Score =   318 bits (815),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 2/174 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  52   IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  111

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--ENLNSKSYLGT  343
            TKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  ENLNSKSYL  
Sbjct  112  TKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLENLNSKSYLSA  171

Query  342  IKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQIQR
Sbjct  172  IKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  225



>ref|XP_004506146.1| PREDICTED: histone deacetylase 9-like [Cicer arietinum]
Length=430

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVK+FN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKRFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N YIKYFGPD+SLKIP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENVYIKYFGPDFSLKIPHGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK IQRDDEYYEGD
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDLQNPDERIDQHTQDKHIQRDDEYYEGD  420

Query  156  ndnDHSMDDA  127
            NDNDH MD A
Sbjct  421  NDNDHQMDIA  430



>ref|XP_009364877.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
 ref|XP_009339956.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
Length=429

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IISKVVETYLPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDSELPNEIPDN+YIKYF PD SL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDSELPNEIPDNEYIKYFSPDCSLRIPSGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDERL+QHTQDK IQR
Sbjct  361  IQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERLNQHTQDKNIQR  412



>ref|XP_008227403.1| PREDICTED: histone deacetylase 9 isoform X2 [Prunus mume]
Length=343

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGHA+CVRFVKKFN+PLLVTGGGGY
Sbjct  154  IISKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHADCVRFVKKFNLPLLVTGGGGY  213

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDSELPNEIP+N+YIKYF PD+SL+IP GHIENLNSKSY+ TIK
Sbjct  214  TKENVARCWTVETGVLLDSELPNEIPENEYIKYFSPDFSLRIPNGHIENLNSKSYISTIK  273

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR IQHAP+VQMQEVPPDFYIPDFDED QNPDER+DQHT+DK IQR
Sbjct  274  TQVLENLRCIQHAPNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTEDKHIQR  325



>gb|KDP34706.1| hypothetical protein JCGZ_10911 [Jatropha curcas]
Length=430

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PG IVLQCGADSLA DRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYLPGVIVLQCGADSLARDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLL++ELPNEIPDN+YIKYFGP+YSLKIPGG IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLETELPNEIPDNEYIKYFGPEYSLKIPGGQIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK IQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKHIQR  412



>ref|XP_007205234.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
 gb|EMJ06433.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
Length=430

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDSELPNEIP+N+YIKYF PD+SL+IP GHIENLNSKSY+ TIK
Sbjct  301  TKENVARCWTVETGVLLDSELPNEIPENEYIKYFSPDFSLRIPNGHIENLNSKSYISTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAP+VQMQEVPPDFYIPDFDED QNPDER+DQHTQDK IQR
Sbjct  361  MQVLENLRCIQHAPNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTQDKHIQR  412



>emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera]
Length=430

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+YSLKIP GHIENLNSKSY+GTIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPEYSLKIPNGHIENLNSKSYIGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+D+QIQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQIQR  412



>gb|KEH29890.1| histone deacetylase family protein [Medicago truncatula]
Length=405

 Score =   322 bits (826),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  216  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNVPLLVTGGGGY  275

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+NDYIKYFGPD+SLKIP G IENLNSKSYL TIK
Sbjct  276  TKENVARCWTVETGVLLDTELPNEIPENDYIKYFGPDFSLKIPNGFIENLNSKSYLSTIK  335

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              V+ENLR IQHAPSVQMQEVPPDFYIPD DED QNPDER DQHTQDK IQRDDEYY+GD
Sbjct  336  MQVMENLRCIQHAPSVQMQEVPPDFYIPDIDEDLQNPDERNDQHTQDKHIQRDDEYYDGD  395

Query  156  ndnDHSMD  133
            NDNDH MD
Sbjct  396  NDNDHQMD  403



>ref|XP_002266492.1| PREDICTED: histone deacetylase 9 isoform X1 [Vitis vinifera]
 emb|CBI16725.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+YSLKIP GHIENLNSKSY+GTIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPEYSLKIPNGHIENLNSKSYIGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+D+QIQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTRDRQIQR  412



>ref|XP_002300554.1| histone deacetylase-related family protein [Populus trichocarpa]
 gb|EEE85359.1| histone deacetylase-related family protein [Populus trichocarpa]
Length=429

 Score =   323 bits (827),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +ENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLMENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDF+IPDFDED QNPDER+DQHTQDKQIQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQR  412



>ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citrus sinensis]
Length=429

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+ SL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECSLRIPNGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDKQIQR
Sbjct  361  MQVLENLRSIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQIQR  412



>ref|XP_011005322.1| PREDICTED: histone deacetylase 9 isoform X3 [Populus euphratica]
Length=429

 Score =   322 bits (826),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +ENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLVENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VL+NLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQIQR
Sbjct  361  MQVLDNLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  412



>ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
 gb|ESR37546.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
Length=429

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+N+YIKYF P+ SL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENEYIKYFAPECSLRIPNGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDKQIQR
Sbjct  361  MQVLENLRSIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERMDQHTQDKQIQR  412



>ref|XP_008227393.1| PREDICTED: histone deacetylase 9 isoform X1 [Prunus mume]
Length=430

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY+PG IVLQCGADSLAGDRLGCFNLSIDGHA+CVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIDGHADCVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDSELPNEIP+N+YIKYF PD+SL+IP GHIENLNSKSY+ TIK
Sbjct  301  TKENVARCWTVETGVLLDSELPNEIPENEYIKYFSPDFSLRIPNGHIENLNSKSYISTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR IQHAP+VQMQEVPPDFYIPDFDED QNPDER+DQHT+DK IQR
Sbjct  361  TQVLENLRCIQHAPNVQMQEVPPDFYIPDFDEDAQNPDERVDQHTEDKHIQR  412



>ref|XP_003606237.1| Histone deacetylase [Medicago truncatula]
 gb|AES88434.1| histone deacetylase family protein [Medicago truncatula]
Length=430

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNVPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+NDYIKYFGPD+SLKIP G IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENDYIKYFGPDFSLKIPNGFIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              V+ENLR IQHAPSVQMQEVPPDFYIPD DED QNPDER DQHTQDK IQRDDEYY+GD
Sbjct  361  MQVMENLRCIQHAPSVQMQEVPPDFYIPDIDEDLQNPDERNDQHTQDKHIQRDDEYYDGD  420

Query  156  ndnDHSMD  133
            NDNDH MD
Sbjct  421  NDNDHQMD  428



>gb|KHG07653.1| Histone deacetylase 9 -like protein [Gossypium arboreum]
Length=240

 Score =   314 bits (805),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+ VKKFN+PLLVTGGGGY
Sbjct  52   IISKVVEMYRPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKIVKKFNLPLLVTGGGGY  111

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PD  L IP GHIENLNSKSYL TIK
Sbjct  112  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDCLLNIPNGHIENLNSKSYLSTIK  171

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAP VQMQEVPPDFYIPDFDED  NPDER+DQHTQDKQIQRDDEYY+GD
Sbjct  172  MQVLENLRSIQHAPGVQMQEVPPDFYIPDFDEDEHNPDERMDQHTQDKQIQRDDEYYDGD  231

Query  156  ndnDHSMD  133
            NDNDH+MD
Sbjct  232  NDNDHNMD  239



>ref|XP_007142469.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
 gb|ESW14463.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
Length=429

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            DL     +  IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECV FVKKFN+
Sbjct  231  DLSFTRLFKTIISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVSFVKKFNL  290

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  350

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK+I
Sbjct  351  NSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKRI  410

Query  186  QR  181
            QR
Sbjct  411  QR  412



>ref|XP_008788401.1| PREDICTED: histone deacetylase 17 isoform X3 [Phoenix dactylifera]
Length=241

 Score =   314 bits (805),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  51   IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  110

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PDY+LK   G+IENLNSKSYL TIK
Sbjct  111  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDYTLKTQNGNIENLNSKSYLSTIK  170

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLE+LR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+ QHTQDKQIQR
Sbjct  171  VQVLESLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQIQR  222



>ref|XP_010651716.1| PREDICTED: histone deacetylase 9 [Vitis vinifera]
 emb|CBI17064.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVEIYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYFGP++SLKIP GHIENLNSKSYLGTIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFGPEHSLKIPNGHIENLNSKSYLGTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+DKQIQR
Sbjct  361  QQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTKDKQIQR  412



>gb|KCW50786.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=430

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+IENLNSKSYL  IK
Sbjct  301  TKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIENLNSKSYLSAIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQIQR
Sbjct  361  VQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  412



>emb|CDY08684.1| BnaC03g54980D [Brassica napus]
Length=401

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFNIPLLVTGGGGY
Sbjct  216  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNIPLLVTGGGGY  275

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIPDNDYIKYFGPDYSLKIPGGHIENLN+KSY+ TIK
Sbjct  276  TKENVARCWTVETGILLDTELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNTKSYISTIK  335

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + +L+NLRYIQHAPSVQMQEVPPDFYIPDFDED +NPD R+DQ ++DKQIQR
Sbjct  336  AQILDNLRYIQHAPSVQMQEVPPDFYIPDFDEDERNPDVRVDQRSRDKQIQR  387



>ref|XP_009150313.1| PREDICTED: histone deacetylase 9 [Brassica rapa]
 emb|CDX99186.1| BnaA06g18770D [Brassica napus]
Length=426

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIPDNDYIKYFGPDYSLKIPGGHIENLN+KSY+ TIK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNTKSYISTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + +L+NLRYIQHAPSVQMQEVPPDFYIPDFDED +NPD R+DQ ++DKQIQR
Sbjct  361  AQILDNLRYIQHAPSVQMQEVPPDFYIPDFDEDERNPDVRVDQRSRDKQIQR  412



>ref|XP_008458610.1| PREDICTED: histone deacetylase 9 isoform X4 [Cucumis melo]
Length=382

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  193  IISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  252

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK
Sbjct  253  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIK  312

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  313  TQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  364



>ref|XP_007132395.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
 gb|ESW04389.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
Length=429

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            DL     +  I+SKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECV FVK+FN+
Sbjct  231  DLSFTRLFKTIVSKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVSFVKRFNL  290

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            PLLVTGGGGYTKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENL
Sbjct  291  PLLVTGGGGYTKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENL  350

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            NSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDK+I
Sbjct  351  NSKSYLSTIKIQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKRI  410

Query  186  QR  181
            QR
Sbjct  411  QR  412



>ref|XP_010692974.1| PREDICTED: histone deacetylase 9 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=403

 Score =   318 bits (815),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  215  IISKVVEFYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIPDN+YIKYFGPDYSL+IP GHIENLNSKSYL TIK
Sbjct  275  TKENVARCWTVETGVLLDTDLPNEIPDNEYIKYFGPDYSLRIPNGHIENLNSKSYLTTIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQMQEVPPDFY+PDFDED +NPDER++QHTQDK IQRDDEYY+GD
Sbjct  335  MQVLENLRCIQHAPSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGD  393

Query  156  ndnDHSMDD  130
             DNDH+MDD
Sbjct  394  QDNDHNMDD  402



>ref|XP_004300044.1| PREDICTED: histone deacetylase 9 [Fragaria vesca subsp. vesca]
Length=430

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY
Sbjct  241  IISKVIETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLDS+LPNEIP+N+YIKYF P++SL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDSDLPNEIPENEYIKYFSPEFSLRIPNGHIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQ+ EVPPDFYIPDFDED QNPDER+ QHTQDK IQRDDEYYEGD
Sbjct  361  MQVLENLRCIQHAPSVQLHEVPPDFYIPDFDEDEQNPDERVHQHTQDKHIQRDDEYYEGD  420

Query  156  ndnDHSMDDA  127
            NDNDH+M+D 
Sbjct  421  NDNDHNMEDT  430



>ref|XP_008458609.1| PREDICTED: histone deacetylase 9 isoform X3 [Cucumis melo]
Length=405

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  216  IISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  275

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK
Sbjct  276  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIK  335

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  336  TQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  387



>ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis]
 gb|EEF33320.1| histone deacetylase 1, 2, 3, putative [Ricinus communis]
Length=429

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PG IVLQCGADSLA DRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGVIVLQCGADSLARDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDNDYI+YF P+YSLKIPGG IEN NSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPDNDYIEYFAPEYSLKIPGGQIENFNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQ+QEVPPDFY+PDFDED QNPDER++QHTQDK IQRDDEYYEGD
Sbjct  361  MQVLENLRCIQHAPSVQLQEVPPDFYVPDFDEDEQNPDERVNQHTQDKHIQRDDEYYEGD  420

Query  156  ndnDHSMD  133
            ND+DH+MD
Sbjct  421  NDHDHNMD  428



>ref|XP_006591090.1| PREDICTED: histone deacetylase 9-like isoform X2 [Glycine max]
Length=421

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  233  IISKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  292

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENLNSKSYL TIK
Sbjct  293  TKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENLNSKSYLSTIK  352

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDERLDQHTQDK IQR
Sbjct  353  MQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHIQR  404



>gb|KJB35350.1| hypothetical protein B456_006G110500 [Gossypium raimondii]
Length=240

 Score =   311 bits (797),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV+ VKKFN+PLLVTGGGGY
Sbjct  52   IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVKIVKKFNLPLLVTGGGGY  111

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PD  L IP GHIENLNSKSYL TI 
Sbjct  112  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDCLLNIPNGHIENLNSKSYLKTIT  171

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAP VQMQEVPPDFYIPDFDED QN DER+DQHTQDKQIQRDDEYY+GD
Sbjct  172  MQVLENLRSIQHAPGVQMQEVPPDFYIPDFDEDEQNADERMDQHTQDKQIQRDDEYYDGD  231

Query  156  ndnDHSMD  133
            NDNDH+MD
Sbjct  232  NDNDHNMD  239



>ref|XP_010692973.1| PREDICTED: histone deacetylase 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=429

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEFYQPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIPDN+YIKYFGPDYSL+IP GHIENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTDLPNEIPDNEYIKYFGPDYSLRIPNGHIENLNSKSYLTTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLENLR IQHAPSVQMQEVPPDFY+PDFDED +NPDER++QHTQDK IQRDDEYY+GD
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYVPDFDED-ENPDERINQHTQDKLIQRDDEYYDGD  419

Query  156  ndnDHSMDD  130
             DNDH+MDD
Sbjct  420  QDNDHNMDD  428



>ref|XP_003538135.1| PREDICTED: histone deacetylase 9-like isoform X1 [Glycine max]
Length=429

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  241  IISKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDERLDQHTQDK IQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHIQR  412



>gb|KHN38656.1| Histone deacetylase 9 [Glycine soja]
Length=429

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  241  IISKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+NDYIKYF P++SLKIP G IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDERLDQHTQDK IQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERLDQHTQDKHIQR  412



>ref|XP_006592310.1| PREDICTED: histone deacetylase 9 isoform X2 [Glycine max]
Length=352

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  164  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  223

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP NDYIKYF P++SLK+P G IENLNSKSYL TIK
Sbjct  224  TKENVARCWTVETGVLLDTELPNEIPQNDYIKYFAPEFSLKVPNGPIENLNSKSYLSTIK  283

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK IQR
Sbjct  284  MQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  335



>ref|XP_008458605.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
 ref|XP_008458606.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
Length=430

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  361  TQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  412



>ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus]
 gb|KGN46931.1| hypothetical protein Csa_6G151680 [Cucumis sativus]
Length=430

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PG IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            + VLENLR+IQHAP VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  361  TQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  412



>ref|XP_009404814.1| PREDICTED: histone deacetylase 9 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  134  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  193

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENLNSKSYL TIK
Sbjct  194  TKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENLNSKSYLSTIK  253

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQIQRDDEY+EGD
Sbjct  254  VQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGD  313

Query  156  ndnDHSMDDA  127
            NDNDH+M+D 
Sbjct  314  NDNDHNMEDG  323



>ref|XP_006279377.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
 gb|EOA12275.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
Length=426

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQ ++DKQ+QR
Sbjct  361  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQRSRDKQVQR  412



>ref|XP_006419115.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
 gb|ESQ37551.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
Length=426

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIEN+N+KSY+ +IK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENMNTKSYISSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQ ++DKQIQR
Sbjct  361  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQRSRDKQIQR  412



>ref|XP_010031477.1| PREDICTED: histone deacetylase 9 isoform X1 [Eucalyptus grandis]
 gb|KCW50785.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=432

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 160/174 (92%), Gaps = 2/174 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--ENLNSKSYLGT  343
            TKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  ENLNSKSYL  
Sbjct  301  TKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLENLNSKSYLSA  360

Query  342  IKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHTQDKQIQR
Sbjct  361  IKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDQHTQDKQIQR  414



>ref|XP_003539814.1| PREDICTED: histone deacetylase 9 isoform X1 [Glycine max]
Length=429

 Score =   315 bits (808),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP NDYIKYF P++SLK+P G IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPQNDYIKYFAPEFSLKVPNGPIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK IQR
Sbjct  361  MQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  412



>ref|XP_009404813.1| PREDICTED: histone deacetylase 9 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=354

 Score =   312 bits (799),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  164  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  223

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENLNSKSYL TIK
Sbjct  224  TKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENLNSKSYLSTIK  283

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQIQRDDEY+EGD
Sbjct  284  VQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGD  343

Query  156  ndnDHSMDDA  127
            NDNDH+M+D 
Sbjct  344  NDNDHNMEDG  353



>gb|ACU20217.1| unknown [Glycine max]
Length=429

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 157/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP NDYIKYF P++SLK+P G IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPQNDYIKYFAPEFSLKVPNGPIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLEN R IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQHTQDK IQR
Sbjct  361  MQVLENFRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQHTQDKHIQR  412



>ref|XP_010514792.1| PREDICTED: histone deacetylase 9 [Camelina sativa]
Length=426

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R+DQ ++DKQIQR
Sbjct  361  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  412



>ref|NP_190054.2| histone deacetylase 9 [Arabidopsis thaliana]
 sp|Q8H0W2.1|HDA9_ARATH RecName: Full=Histone deacetylase 9 [Arabidopsis thaliana]
 gb|AAN72014.1| putative protein [Arabidopsis thaliana]
 gb|AAP31920.1| At3g44680 [Arabidopsis thaliana]
 gb|AEE77930.1| histone deacetylase 9 [Arabidopsis thaliana]
Length=426

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R DQ ++DKQIQR
Sbjct  361  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRADQRSRDKQIQR  412



>ref|XP_009404815.1| PREDICTED: histone deacetylase 9 isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=406

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  216  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  275

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENLNSKSYL TIK
Sbjct  276  TKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENLNSKSYLSTIK  335

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQIQRDDEY+EGD
Sbjct  336  VQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGD  395

Query  156  ndnDHSMDDA  127
            NDNDH+M+D 
Sbjct  396  NDNDHNMEDG  405



>ref|XP_010425885.1| PREDICTED: histone deacetylase 9 isoform X1 [Camelina sativa]
Length=426

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 160/172 (93%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLR+IQHAPSVQMQEVPPDFYIPDFDED QNPD R+DQ ++DKQIQR
Sbjct  361  VQILENLRFIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRVDQRSRDKQIQR  412



>ref|XP_010503116.1| PREDICTED: histone deacetylase 9-like [Camelina sativa]
Length=426

 Score =   312 bits (799),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  301  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QN D R+DQ ++DKQIQR
Sbjct  361  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNRDVRVDQRSRDKQIQR  412



>ref|XP_007015910.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
 gb|EOY33529.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
Length=406

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+PLLVTGGGGY
Sbjct  235  IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY  294

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENLNSKSY+ TIK
Sbjct  295  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENLNSKSYISTIK  354

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAP VQMQEVPPDF+IPDFDED QNPDER+DQHTQDKQIQR
Sbjct  355  MQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQR  406



>ref|XP_010940301.1| PREDICTED: histone deacetylase 9 [Elaeis guineensis]
Length=431

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+Y KYF PDY+LKI  G++ENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDAELPNEIPDNEYAKYFAPDYTLKIQNGNMENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLE+LR IQHAP VQMQEVPPDFYIPDFDED QNPDER+ QHTQDKQIQRDDEYY+GD
Sbjct  361  VQVLESLRCIQHAPGVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQIQRDDEYYDGD  420

Query  156  ndnDHSMDDA  127
            NDNDH+M+D 
Sbjct  421  NDNDHNMEDG  430



>ref|XP_009404812.1| PREDICTED: histone deacetylase 9 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=431

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD++LPNEIP+N+YIKYF PDY+LKIP G++ENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDADLPNEIPENEYIKYFAPDYTLKIPNGNMENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              VLE+LR IQHAP VQMQEVPPDFYIP+FDED QNPDER+DQHT DKQIQRDDEY+EGD
Sbjct  361  VQVLESLRCIQHAPGVQMQEVPPDFYIPEFDEDEQNPDERVDQHTTDKQIQRDDEYFEGD  420

Query  156  ndnDHSMDDA  127
            NDNDH+M+D 
Sbjct  421  NDNDHNMEDG  430



>ref|XP_008788384.1| PREDICTED: histone deacetylase 9 isoform X1 [Phoenix dactylifera]
Length=431

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PDY+LK   G+IENLNSKSYL TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDYTLKTQNGNIENLNSKSYLSTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLE+LR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+ QHTQDKQIQR
Sbjct  361  VQVLESLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVGQHTQDKQIQR  412



>ref|XP_006851552.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
 gb|ERN13133.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
Length=432

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KV+ETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVLETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI-ENLNSKSYLGTI  340
            TKENVARCW  ETGVLLD+ELPNEIPDNDYIKYFGPDYSLKI  G++ ENLNSKSYL +I
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPDNDYIKYFGPDYSLKIQNGNVQENLNSKSYLSSI  360

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyeg  160
            K  V+E+LR IQHAP VQMQEVP DFYIPD DED QNPDER+DQHT+DKQIQR+DEYY+G
Sbjct  361  KVQVMESLRCIQHAPGVQMQEVPRDFYIPDSDEDEQNPDERVDQHTEDKQIQREDEYYDG  420

Query  159  dndnDHSMDDA  127
            DNDNDH+M+DA
Sbjct  421  DNDNDHTMEDA  431



>ref|XP_007015904.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
 gb|EOY33523.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
Length=429

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENLNSKSY+ TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENLNSKSYISTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAP VQMQEVPPDF+IPDFDED QNPDER+DQHTQDKQIQR
Sbjct  361  MQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDQHTQDKQIQR  412



>ref|XP_010541292.1| PREDICTED: histone deacetylase 9 isoform X2 [Tarenaya hassleriana]
Length=237

 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGH+ECV+FVKKFNIPLLVTGGGGY
Sbjct  52   IISKVVEMYQPGAIVLQCGADSLARDRLGCFNLSIDGHSECVKFVKKFNIPLLVTGGGGY  111

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGH-IENLNSKSYLGTI  340
            TKENVARCW  ETGVLLD+EL NEIP+NDYIKYF PD+SLKIPGGH IEN+N+KSY+ +I
Sbjct  112  TKENVARCWTVETGVLLDAELSNEIPENDYIKYFAPDFSLKIPGGHIIENMNTKSYISSI  171

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            K  +LENLRYIQHAPSVQMQEVPPDFYIPDF+ED QNPD R+DQ  +DK IQR
Sbjct  172  KVQILENLRYIQHAPSVQMQEVPPDFYIPDFNEDEQNPDVRVDQRARDKHIQR  224



>emb|CAE04901.1| OSJNBa0042I15.23 [Oryza sativa Japonica Group]
Length=254

 Score =   301 bits (772),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D G    +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  55   DSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  114

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  115  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNL  174

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPD DED  +PDER+DQHTQDKQI
Sbjct  175  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQI  234

Query  186  QR  181
             R
Sbjct  235  HR  236



>ref|XP_011005321.1| PREDICTED: histone deacetylase 9 isoform X2 [Populus euphratica]
Length=433

 Score =   307 bits (787),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 161/201 (80%), Gaps = 29/201 (14%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  216  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  275

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI-------------  376
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +             
Sbjct  276  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLVVCNCTETPCDFCI  335

Query  375  ----------------ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFD  244
                            ENLNSKSYL TIK  VL+NLR IQHAPSVQMQEVPPDFYIPDFD
Sbjct  336  LAAFLIFLLLFCLSEQENLNSKSYLSTIKMQVLDNLRCIQHAPSVQMQEVPPDFYIPDFD  395

Query  243  EDTQNPDERLDQHTQDKQIQR  181
            ED QNPDER+DQHTQDKQIQR
Sbjct  396  EDEQNPDERMDQHTQDKQIQR  416



>ref|XP_008668621.1| PREDICTED: histone deacetylase isoform X1 [Zea mays]
Length=363

 Score =   305 bits (780),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  174  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  233

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  234  TKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  293

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  294  VQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  345



>emb|CAB72470.1| putative protein [Arabidopsis thaliana]
Length=419

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +   VVE Y PGAIVLQCGADSLA DRLGCFNLSIDGHAECV+FVKKFN+PLLVTGGGGY
Sbjct  234  LFRTVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDGHAECVKFVKKFNLPLLVTGGGGY  293

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPGGHIENLN+KSY+ +IK
Sbjct  294  TKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLNTKSYISSIK  353

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R DQ ++DKQIQR
Sbjct  354  VQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRADQRSRDKQIQR  405



>ref|XP_011005320.1| PREDICTED: histone deacetylase 9 isoform X1 [Populus euphratica]
Length=458

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 161/201 (80%), Gaps = 29/201 (14%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI-------------  376
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF PDYSLK PGG +             
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPDYSLKSPGGLVVCNCTETPCDFCI  360

Query  375  ----------------ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFD  244
                            ENLNSKSYL TIK  VL+NLR IQHAPSVQMQEVPPDFYIPDFD
Sbjct  361  LAAFLIFLLLFCLSEQENLNSKSYLSTIKMQVLDNLRCIQHAPSVQMQEVPPDFYIPDFD  420

Query  243  EDTQNPDERLDQHTQDKQIQR  181
            ED QNPDER+DQHTQDKQIQR
Sbjct  421  EDEQNPDERMDQHTQDKQIQR  441



>ref|NP_001052725.1| Os04g0409600 [Oryza sativa Japonica Group]
 dbj|BAF14639.1| Os04g0409600, partial [Oryza sativa Japonica Group]
Length=309

 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D G    +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  110  DSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  169

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  170  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNL  229

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPD DED  +PDER+DQHTQDKQI
Sbjct  230  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQI  289

Query  186  QR  181
             R
Sbjct  290  HR  291



>gb|ACR37742.1| unknown [Zea mays]
Length=405

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  216  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  275

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  276  TKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  335

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  336  VQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  387



>gb|EMT12816.1| Histone deacetylase 9 [Aegilops tauschii]
Length=381

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKF IPLLVTGGGGY
Sbjct  192  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKIPLLVTGGGGY  251

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIPDN+YI+YFGPDY+LK+P  +++NLNSK+YL +IK
Sbjct  252  TKENVARCWAVETGVLLDTELPNEIPDNEYIEYFGPDYTLKVPNLNMDNLNSKTYLSSIK  311

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFY+PDFDED  +PDER+DQHTQDKQ+ R
Sbjct  312  VQVMESLRAIQHAPGVQMQEVPPDFYVPDFDEDELDPDERVDQHTQDKQVHR  363



>tpg|DAA37954.1| TPA: histone deacetylase [Zea mays]
Length=427

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  238  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  297

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  298  TKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  357

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  358  VQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  409



>tpg|DAA37953.1| TPA: histone deacetylase, mRNA [Zea mays]
Length=432

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  243  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  303  TKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  362

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  363  VQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  414



>ref|NP_001105077.1| histone deacetylase [Zea mays]
 gb|AAL33655.1|AF440228_1 histone deacetylase [Zea mays]
 gb|ACF83162.1| unknown [Zea mays]
 gb|ACG38577.1| histone deacetylase [Zea mays]
Length=430

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP N+YI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  301  TKENVARCWAVETGVLLDTELPNEIPKNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LRYIQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  361  VQVMESLRYIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  412



>gb|ACD50313.1| histone deacetylase RPD3/HDA1 class I isoform 1 [Hordeum vulgare]
Length=430

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKF IPLLVTGGGGY
Sbjct  241  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIPDN+YIKYFGPDY+LK+P  +++NLNSK+YL +IK
Sbjct  301  TKENVARCWAVETGVLLDTELPNEIPDNEYIKYFGPDYTLKVPNLNMDNLNSKTYLSSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFY+PDFDED  +PDER+DQHTQDKQ+ R
Sbjct  361  VQVMESLRAIQHAPGVQMQEVPPDFYVPDFDEDELDPDERVDQHTQDKQVHR  412



>ref|XP_004975539.1| PREDICTED: histone deacetylase 9-like isoform X2 [Setaria italica]
Length=364

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  175  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  234

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP+NDYI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  235  TKENVARCWAVETGVLLDTELPNEIPNNDYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  294

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQH QDKQI R
Sbjct  295  VQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHIQDKQIHR  346



>ref|XP_010541291.1| PREDICTED: histone deacetylase 9 isoform X1 [Tarenaya hassleriana]
Length=426

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 157/173 (91%), Gaps = 1/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSIDGH+ECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IISKVVEMYQPGAIVLQCGADSLARDRLGCFNLSIDGHSECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGH-IENLNSKSYLGTI  340
            TKENVARCW  ETGVLLD+EL NEIP+NDYIKYF PD+SLKIPGGH IEN+N+KSY+ +I
Sbjct  301  TKENVARCWTVETGVLLDAELSNEIPENDYIKYFAPDFSLKIPGGHIIENMNTKSYISSI  360

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            K  +LENLRYIQHAPSVQMQEVPPDFYIPDF+ED QNPD R+DQ  +DK IQR
Sbjct  361  KVQILENLRYIQHAPSVQMQEVPPDFYIPDFNEDEQNPDVRVDQRARDKHIQR  413



>ref|XP_008458611.1| PREDICTED: histone deacetylase 17 isoform X5 [Cucumis melo]
Length=183

 Score =   294 bits (752),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  657  IVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYET  478
            +++ CGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ET
Sbjct  7    LLIMCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVET  66

Query  477  GVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHA  298
            GVLLD+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK+ VLENLR+IQHA
Sbjct  67   GVLLDTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHA  126

Query  297  PSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            P VQMQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  127  PGVQMQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  165



>ref|XP_003579685.1| PREDICTED: histone deacetylase 9 isoform X1 [Brachypodium distachyon]
Length=430

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKF IPLLVTGGGGY
Sbjct  241  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFKIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD++LPNEIPDN+YIKYFGPDY+LK+P  +++NLNSK+YL +IK
Sbjct  301  TKENVARCWAVETGVLLDTDLPNEIPDNEYIKYFGPDYTLKVPNLNMDNLNSKTYLSSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQ+ R
Sbjct  361  VQVMESLRAIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQVHR  412



>ref|XP_006652253.1| PREDICTED: histone deacetylase 9-like [Oryza brachyantha]
Length=430

 Score =   302 bits (773),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  VIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NLNSKSYL +IK
Sbjct  301  TKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNLNMDNLNSKSYLSSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  361  VQVMESLRAIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  412



>ref|XP_002446401.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
 gb|EES10729.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
Length=430

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KV+ETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IIAKVIETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP+N+YI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  301  TKENVARCWAVETGVLLDTELPNEIPNNEYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQHTQDKQI R
Sbjct  361  VQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHTQDKQIHR  412



>ref|XP_004975538.1| PREDICTED: histone deacetylase 9-like isoform X1 [Setaria italica]
Length=430

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNIPLLVTGGGGY
Sbjct  241  IIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCWA ETGVLLD+ELPNEIP+NDYI+YF PDY+LK+P  +++NLNSK+YL +IK
Sbjct  301  TKENVARCWAVETGVLLDTELPNEIPNNDYIEYFAPDYTLKVPNLNMDNLNSKTYLSSIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V+E+LR IQHAP VQMQEVPPDFYIPDFDED  +PDER+DQH QDKQI R
Sbjct  361  VQVMESLRSIQHAPGVQMQEVPPDFYIPDFDEDELDPDERVDQHIQDKQIHR  412



>ref|XP_011090014.1| PREDICTED: histone deacetylase 17 isoform X2 [Sesamum indicum]
Length=252

 Score =   294 bits (752),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E Y PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+PLLVTGGGGY
Sbjct  63   IILKVMECYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNLPLLVTGGGGY  122

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG LL  ELPNEIP+NDYIKYF PDYSLK P GH+ENLNSKSYL TI+
Sbjct  123  TKENVARCWTVETGALLGVELPNEIPENDYIKYFAPDYSLKCPSGHLENLNSKSYLNTIR  182

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              V ENL  IQHAP VQM EVPPDFYIPDFDED  NPDER+++H QDK IQRDDEYYEGD
Sbjct  183  QQVCENLSSIQHAPGVQMHEVPPDFYIPDFDEDELNPDERVNRHIQDKHIQRDDEYYEGD  242

Query  156  ndnDHSMDDA  127
            NDND +MDD+
Sbjct  243  NDNDQTMDDS  252



>emb|CAH66503.1| H0321H01.12 [Oryza sativa Indica Group]
 gb|EEC77239.1| hypothetical protein OsI_15792 [Oryza sativa Indica Group]
 gb|EEE60951.1| hypothetical protein OsJ_14708 [Oryza sativa Japonica Group]
Length=430

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D G    +  +I+KVVETY+PGAIVLQCGADSLA DRLGCFNLSI+GHAECV+FVKKFNI
Sbjct  231  DSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNI  290

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            PLLVTGGGGYTKENVARCWA ETGVLLD+ELPNEIPDN+YIKYF PDY+LK+   +++NL
Sbjct  291  PLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNL  350

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            NSKSYL +IK  V+E+LR IQHAP VQMQEVPPDFYIPD DED  +PDER+DQHTQDKQI
Sbjct  351  NSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQI  410

Query  186  QR  181
             R
Sbjct  411  HR  412



>gb|EYU36088.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=430

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 0/172 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E Y+PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+PLLVTGGGGY
Sbjct  241  IILKVMECYVPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG LLD ELPNEIP+N+YIKYF PDYSLK P GH+ENLNSKSYL TI+
Sbjct  301  TKENVARCWTVETGALLDVELPNEIPENEYIKYFAPDYSLKCPSGHMENLNSKSYLNTIR  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              V ENL  IQHAP VQMQEVPPDFYIPDFDED  NPD+R+++H QDKQ+QR
Sbjct  361  QQVCENLSAIQHAPGVQMQEVPPDFYIPDFDEDQHNPDQRVNRHAQDKQVQR  412



>gb|KCW50787.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=406

 Score =   295 bits (755),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--ENLNSKSYLGT  343
            TKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  ENLNSKSYL  
Sbjct  301  TKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLENLNSKSYLSA  360

Query  342  IKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  208
            IK  VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+D+
Sbjct  361  IKVQVLENLRNIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERMDR  405



>ref|XP_011090013.1| PREDICTED: histone deacetylase 9 isoform X1 [Sesamum indicum]
Length=430

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E Y PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+PLLVTGGGGY
Sbjct  241  IILKVMECYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG LL  ELPNEIP+NDYIKYF PDYSLK P GH+ENLNSKSYL TI+
Sbjct  301  TKENVARCWTVETGALLGVELPNEIPENDYIKYFAPDYSLKCPSGHLENLNSKSYLNTIR  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyegd  157
              V ENL  IQHAP VQM EVPPDFYIPDFDED  NPDER+++H QDK IQRDDEYYEGD
Sbjct  361  QQVCENLSSIQHAPGVQMHEVPPDFYIPDFDEDELNPDERVNRHIQDKHIQRDDEYYEGD  420

Query  156  ndnDHSMDDA  127
            NDND +MDD+
Sbjct  421  NDNDQTMDDS  430



>ref|XP_001774667.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
 gb|EDQ60482.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
Length=431

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 151/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I KVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECV+FVKKFNIPLLVTGGGGY
Sbjct  241  VIQKVVEVYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVKFVKKFNIPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGG-HIENLNSKSYLGTI  340
            TKENVARCW  ETGVL+D+ELPNEIPDNDY+KYF PD +LK   G H+ENLN K+YL TI
Sbjct  301  TKENVARCWTVETGVLVDTELPNEIPDNDYLKYFKPDCTLKTTSGNHMENLNGKTYLSTI  360

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            K  V+ENLR I HAPSVQM EVPPD YIP+FDED  NPDER+DQHTQDK IQR
Sbjct  361  KQQVMENLRRIAHAPSVQMHEVPPDTYIPEFDEDELNPDERMDQHTQDKHIQR  413



>ref|XP_002877352.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53611.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
Length=1443

 Score =   309 bits (791),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 160/188 (85%), Gaps = 16/188 (9%)
 Frame = -2

Query  696   IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSID----------------GHAECVRF  565
             IISKVVE Y PGAIVLQCGADSLA DRLGCFNLSID                GHAECV+F
Sbjct  1242  IISKVVEIYQPGAIVLQCGADSLARDRLGCFNLSIDVSVTQILKRLSLMHFPGHAECVKF  1301

Query  564   VKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPG  385
             VKKFN+PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD+SLKIPG
Sbjct  1302  VKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPG  1361

Query  384   GHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQH  205
             GHIENLN+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPDFDED QNPD R+DQ 
Sbjct  1362  GHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDFDEDEQNPDVRVDQR  1421

Query  204   TQDKQIQR  181
             ++DKQ+QR
Sbjct  1422  SRDKQVQR  1429



>ref|XP_008458608.1| PREDICTED: histone deacetylase 9 isoform X2 [Cucumis melo]
Length=413

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  645  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLL  466
            CGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ETGVLL
Sbjct  241  CGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLL  300

Query  465  DSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQ  286
            D+ELPNEIPDN+YIKYF PD+ L+IP GH+ENLN+KSYL TIK+ VLENLR+IQHAP VQ
Sbjct  301  DTELPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHAPGVQ  360

Query  285  MQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
            MQEVPPDFYIPDFDED QNPDER+++HTQDKQIQR
Sbjct  361  MQEVPPDFYIPDFDEDGQNPDERMNRHTQDKQIQR  395



>ref|XP_007015905.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
 gb|EOY33524.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
Length=404

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENLNSKSY+ TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENLNSKSYISTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  208
              VLENLR IQHAP VQMQEVPPDF+IPDFDED QNPDER+D+
Sbjct  361  MQVLENLRCIQHAPGVQMQEVPPDFFIPDFDEDEQNPDERMDR  403



>emb|CAN75079.1| hypothetical protein VITISV_007579 [Vitis vinifera]
Length=393

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 148/172 (86%), Gaps = 12/172 (7%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVE Y PG IVLQCGADSLAGDRLGCFNLSIDG              LLVTGGGGY
Sbjct  216  IIAKVVEIYQPGVIVLQCGADSLAGDRLGCFNLSIDG------------ANLLVTGGGGY  263

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYFGP++SLKIP GHIENLNSKSYLGTIK
Sbjct  264  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFGPEHSLKIPNGHIENLNSKSYLGTIK  323

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQR  181
              VLENLR IQHAPSVQMQEVPPDFYIPDFDED QNPDER+DQHT+DKQIQR
Sbjct  324  QQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERVDQHTKDKQIQR  375



>ref|XP_002966032.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
 gb|EFJ33452.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
Length=432

 Score =   284 bits (726),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKVVE Y PGA+VLQCGADSLAGDRLGCFNLSI GHAECV FVKK  IPLLVTGGGGY
Sbjct  243  VISKVVEFYQPGAVVLQCGADSLAGDRLGCFNLSIQGHAECVNFVKKLGIPLLVTGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGG-HIENLNSKSYLGTI  340
            TKENVARCW  ETGVLLD+ELPNEIP NDYIKYF PDY+LK   G +++NLN+K+YL  I
Sbjct  303  TKENVARCWTVETGVLLDTELPNEIPSNDYIKYFKPDYTLKTNHGLNLDNLNTKAYLSAI  362

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyeg  160
            K  VLENLR+IQHAP VQM EVPPD Y PDFDE+  NPDERLDQHTQDK +QRD+E+Y+G
Sbjct  363  KMQVLENLRHIQHAPGVQMHEVPPDTYFPDFDEEDFNPDERLDQHTQDKSVQRDEEFYDG  422

Query  159  dndnDHSMD  133
            DNDNDH MD
Sbjct  423  DNDNDHDMD  431



>ref|XP_002971460.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
 gb|EFJ27209.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
Length=432

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKVVE Y PGA+VLQCGADSLAGDRLGCFNLSI GHAECV FVKK  IPLLVTGGGGY
Sbjct  243  VISKVVEFYQPGAVVLQCGADSLAGDRLGCFNLSIQGHAECVNFVKKLGIPLLVTGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGG-HIENLNSKSYLGTI  340
            TKENVARCW  ETGVLLD+ELPNEIP NDYIKYF PDY+LK   G +++NLN+K+YL  I
Sbjct  303  TKENVARCWTVETGVLLDTELPNEIPSNDYIKYFKPDYTLKTNHGLNLDNLNTKAYLSAI  362

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQRddeyyeg  160
            K  VLENLR+IQHAP VQM EVPPD Y PDFDE   NPDERLDQHTQDK +QRD+E+Y+G
Sbjct  363  KMQVLENLRHIQHAPGVQMHEVPPDTYFPDFDEGDFNPDERLDQHTQDKSVQRDEEFYDG  422

Query  159  dndnDHSMD  133
            DNDNDH MD
Sbjct  423  DNDNDHDMD  431



>gb|EYU36089.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=404

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E Y+PGAIVLQCGADSLAGDRLGCFNLSIDGHA CV+FVK+ N+PLLVTGGGGY
Sbjct  241  IILKVMECYVPGAIVLQCGADSLAGDRLGCFNLSIDGHAACVKFVKQLNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETG LLD ELPNEIP+N+YIKYF PDYSLK P GH+ENLNSKSYL TI+
Sbjct  301  TKENVARCWTVETGALLDVELPNEIPENEYIKYFAPDYSLKCPSGHMENLNSKSYLNTIR  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  208
              V ENL  IQHAP VQMQEVPPDFYIPDFDED  NPD+R+++
Sbjct  361  QQVCENLSAIQHAPGVQMQEVPPDFYIPDFDEDQHNPDQRVNR  403



>gb|KHN21123.1| Histone deacetylase 9 [Glycine soja]
Length=477

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 148/189 (78%), Gaps = 17/189 (9%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECV FVK+FN+PLLVTGGGGY
Sbjct  272  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVSFVKRFNLPLLVTGGGGY  331

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFG-------------PDYSL----KIP  388
            TKENVARCW  ETGVLLD+ELPNE P    + +F              P  S     ++ 
Sbjct  332  TKENVARCWTVETGVLLDTELPNEFPCGISLDFFSCAPQSGMMEKYVIPYVSFGSIERLQ  391

Query  387  GGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQ  208
               +ENLNSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFYIP+FDED QNPDER+DQ
Sbjct  392  HIIVENLNSKSYLSTIKMQVLENLRCIQHAPSVQMQEVPPDFYIPEFDEDEQNPDERIDQ  451

Query  207  HTQDKQIQR  181
            HTQDK IQR
Sbjct  452  HTQDKHIQR  460



>ref|XP_010692975.1| PREDICTED: histone deacetylase 17 isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=168

 Score =   254 bits (650),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  606  FNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDY  427
            F L   GHAECVRFVKKFN+PLLVTGGGGYTKENVARCW  ETGVLLD++LPNEIPDN+Y
Sbjct  10   FVLLFAGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLLDTDLPNEIPDNEY  69

Query  426  IKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF  247
            IKYFGPDYSL+IP GHIENLNSKSYL TIK  VLENLR IQHAPSVQMQEVPPDFY+PDF
Sbjct  70   IKYFGPDYSLRIPNGHIENLNSKSYLTTIKMQVLENLRCIQHAPSVQMQEVPPDFYVPDF  129

Query  246  DEDTQNPDERLDQHTQDKQIQRddeyyegdndnDHSMDD  130
            DED +NPDER++QHTQDK IQRDDEYY+GD DNDH+MDD
Sbjct  130  DED-ENPDERINQHTQDKLIQRDDEYYDGDQDNDHNMDD  167



>ref|NP_190035.1| histone deacetylase 17 [Arabidopsis thaliana]
 sp|Q9LXN8.1|HDA17_ARATH RecName: Full=Histone deacetylase 17 [Arabidopsis thaliana]
 emb|CAB88531.1| putative protein [Arabidopsis thaliana]
 gb|AEE77907.1| histone deacetylase 17 [Arabidopsis thaliana]
Length=158

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  609  CFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDND  430
             F++   GHAECV+FVKKFN+PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEI +ND
Sbjct  2    AFSMLFTGHAECVKFVKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEISEND  61

Query  429  YIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD  250
            YIKYF PD+SLKIPGGHIENLN+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPD
Sbjct  62   YIKYFAPDFSLKIPGGHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPD  121

Query  249  FDEDTQNPDERLDQHTQDKQIQR  181
            FDED QNPD R+DQ ++DKQIQR
Sbjct  122  FDEDEQNPDVRVDQRSRDKQIQR  144



>ref|XP_010425886.1| PREDICTED: histone deacetylase 17 isoform X2 [Camelina sativa]
Length=156

 Score =   248 bits (633),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  585  HAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPD  406
            HAECV+FVKKFN+PLLVTGGGGYTKENVARCW  ETG+LLD+ELPNEIP+NDYIKYF PD
Sbjct  8    HAECVKFVKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPD  67

Query  405  YSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNP  226
            +SLKIPGGHIENLN+KSY+ +IK  +LENLR+IQHAPSVQMQEVPPDFYIPDFDED QNP
Sbjct  68   FSLKIPGGHIENLNTKSYISSIKVQILENLRFIQHAPSVQMQEVPPDFYIPDFDEDEQNP  127

Query  225  DERLDQHTQDKQIQR  181
            D R+DQ ++DKQIQR
Sbjct  128  DVRVDQRSRDKQIQR  142



>gb|KCW50788.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=393

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--ENLNSKSYLGT  343
            TKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  ENLNSKSYL  
Sbjct  301  TKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLENLNSKSYLSA  360

Query  342  IKSHVLENLRYIQHAPSVQMQEV  274
            IK  VLENLR IQHAPSVQMQEV
Sbjct  361  IKVQVLENLRNIQHAPSVQMQEV  383



>gb|KCW50789.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=405

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 2/143 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGH+ECVRFVKKFN+PLLVTGGGGY
Sbjct  241  IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVRFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI--ENLNSKSYLGT  343
            TKENVARCW  ETGVLLD+ELPNEIP+N+Y KYF PDYSLKIP G+I  ENLNSKSYL  
Sbjct  301  TKENVARCWVVETGVLLDTELPNEIPENEYFKYFAPDYSLKIPRGNIVLENLNSKSYLSA  360

Query  342  IKSHVLENLRYIQHAPSVQMQEV  274
            IK  VLENLR IQHAPSVQMQEV
Sbjct  361  IKVQVLENLRNIQHAPSVQMQEV  383



>ref|XP_007015911.1| Histone deacetylase 9 isoform 8, partial [Theobroma cacao]
 gb|EOY33530.1| Histone deacetylase 9 isoform 8, partial [Theobroma cacao]
Length=394

 Score =   249 bits (636),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+PLLVTGGGGY
Sbjct  179  IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY  238

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENLNSKSY+ TIK
Sbjct  239  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENLNSKSYISTIK  298

Query  336  SHVLENLRYIQHAPSVQMQEV  274
              VLENLR IQHAP VQMQEV
Sbjct  299  MQVLENLRCIQHAPGVQMQEV  319



>ref|XP_007015906.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 ref|XP_007015909.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 gb|EOY33525.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 gb|EOY33528.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
Length=456

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVE Y PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVR VKKFN+PLLVTGGGGY
Sbjct  241  IISKVVEMYQPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRIVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIP+N+YIKYF P+  L IP GHIENLNSKSY+ TIK
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPENEYIKYFAPECLLNIPNGHIENLNSKSYISTIK  360

Query  336  SHVLENLRYIQHAPSVQMQEV  274
              VLENLR IQHAP VQMQEV
Sbjct  361  MQVLENLRCIQHAPGVQMQEV  381



>ref|NP_190052.1| histone deacetylase 10 [Arabidopsis thaliana]
 sp|Q9M1N8.1|HDA10_ARATH RecName: Full=Putative histone deacetylase 10 [Arabidopsis thaliana]
 emb|CAB72468.1| putative protein [Arabidopsis thaliana]
 gb|AEE77927.1| histone deacetylase 10 [Arabidopsis thaliana]
Length=142

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 114/143 (80%), Gaps = 16/143 (11%)
 Frame = -2

Query  609  CFNLSIDGHAECVRFVKKFNIPLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDND  430
             F++   GHAEC                GGYTKENVARCW  ETG+LLD+ELPNEIP+ND
Sbjct  2    AFSMLFTGHAEC----------------GGYTKENVARCWTVETGILLDTELPNEIPEND  45

Query  429  YIKYFGPDYSLKIPGGHIENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPD  250
            YIKYF PD+SLKIPGGHIENLN+KSY+ +IK  +LENLRYIQHAPSVQMQEVPPDFYIPD
Sbjct  46   YIKYFAPDFSLKIPGGHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPD  105

Query  249  FDEDTQNPDERLDQHTQDKQIQR  181
            FDED QNPD R+DQ ++DKQIQR
Sbjct  106  FDEDEQNPDVRVDQRSRDKQIQR  128



>ref|XP_003060152.1| histone deacetylase [Micromonas pusilla CCMP1545]
 gb|EEH56104.1| histone deacetylase [Micromonas pusilla CCMP1545]
Length=430

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%), Gaps = 3/173 (2%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D G  A +  ++ KV++ Y PGA+VLQCGADSLA DRLGCFNL++DGHA+CV+F+K+FN+
Sbjct  232  DAGFRAIFKSVMQKVMDVYQPGAVVLQCGADSLAADRLGCFNLTLDGHADCVKFMKRFNV  291

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPD--YSLKI-PGGHI  376
            PLLVTGGGGYTK NVARCW YET  LLD  L  +IP++D+   +  D  Y +K+ P  +I
Sbjct  292  PLLVTGGGGYTKSNVARCWTYETAALLDKTLSTDIPEHDFYYEYYADVGYKMKVQPTNYI  351

Query  375  ENLNSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  217
            ENLN+K+YL  +K  V+ENLR ++HAP V M EVPPD  IP+FDED  NPDER
Sbjct  352  ENLNTKTYLQDVKQQVMENLRALEHAPGVGMHEVPPDSMIPEFDEDELNPDER  404



>ref|XP_002504208.1| histone deacetylase [Micromonas sp. RCC299]
 gb|ACO65466.1| histone deacetylase [Micromonas sp. RCC299]
Length=430

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 4/176 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++ KV++ Y PGAIVLQCGADSLA DRLGCFNLS+DGHA+CV+F+KKF +PLLVTGGGGY
Sbjct  242  VMQKVMDVYRPGAIVLQCGADSLAADRLGCFNLSLDGHADCVKFMKKFGVPLLVTGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDND-YIKYFG-PDYSLKI-PGGHIENLNSKSYLG  346
            TK NV+RCW  ET VLLD +LP +IP++D Y +Y+   DY LK+ P  +IENLN+K+Y+ 
Sbjct  302  TKSNVSRCWTNETAVLLDRKLPKDIPEHDFYYEYYADQDYKLKVEPTNYIENLNNKTYVH  361

Query  345  TIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERL-DQHTQDKQIQR  181
             +K  V+ENLR I+HAP V M EVPPD  IP+FDED  N DER   Q   DK + R
Sbjct  362  EVKKEVMENLRAIEHAPGVAMHEVPPDSMIPEFDEDDLNYDERYGGQFGLDKIVDR  417



>ref|XP_005652289.1| class I RPD3 type histone deacetylase protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27745.1| class I RPD3 type histone deacetylase protein [Coccomyxa subellipsoidea 
C-169]
Length=428

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I++KV+E + PGA+VLQCGADSLA DRLGCFNLS++GHAE VRF+KKFN+P+LVTGGGGY
Sbjct  241  IMAKVMEVFSPGAVVLQCGADSLAADRLGCFNLSLEGHAEAVRFMKKFNVPMLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKI-PGGHIENLNSKSYLGTI  340
            TK NV+RCW  ET VL+D  + +++P NDY +Y+ PDY L + P  H++N N+K  +  I
Sbjct  301  TKNNVSRCWTAETAVLVDQNIADDLPPNDYYEYYAPDYRLHVTPHRHMDNNNAKPDIERI  360

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFD-EDTQNPDERLDQHTQDKQIQR  181
            K  VLENLR + H PSVQM E PPD Y+P++D E+ +N D RL ++  D  + R
Sbjct  361  KREVLENLRELAHTPSVQMHEAPPDTYVPEYDIEEEENADVRLGKYACDHLVVR  414



>gb|EMS54283.1| putative histone deacetylase 19 [Triticum urartu]
Length=529

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 130/171 (76%), Gaps = 3/171 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+P+L+ GGGGY
Sbjct  192  IMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPVLLLGGGGY  251

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN N+  +L  I+
Sbjct  252  TIRNVARCWCYETGVALGHELTDKMPLNEYYEYFGPDYTLHVAPSNMENKNTHRHLDEIR  311

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQ  184
            S +LENL  ++HAPSVQ QE PP+   P+ DED +NPDER   H  D  ++
Sbjct  312  SRLLENLTKLRHAPSVQFQERPPEAEQPEQDEDQENPDER---HHADSDVE  359



>ref|XP_010227570.1| PREDICTED: probable histone deacetylase 19 isoform X2 [Brachypodium 
distachyon]
Length=499

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 130/171 (76%), Gaps = 3/171 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+P+L+ GGGGY
Sbjct  256  IMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPVLLLGGGGY  315

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN N+   L  I+
Sbjct  316  TIRNVARCWCYETGVALGHELTDKMPLNEYYEYFGPDYTLHVAPSNMENKNTNRQLDEIR  375

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQ  184
            S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER   H  D  ++
Sbjct  376  SRLLDNLTKLRHAPSVQFQERPPEAELPEQDEDQENPDER---HHADSDVE  423



>ref|XP_010028889.1| PREDICTED: histone deacetylase 19 isoform X1 [Eucalyptus grandis]
 gb|KCW55716.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
 gb|KCW55717.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
 gb|KCW55718.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
 gb|KCW55719.1| hypothetical protein EUGRSUZ_I01553 [Eucalyptus grandis]
Length=499

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+P+L+ GGGGY
Sbjct  252  IIGKVMEVFKPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRYMRSFNVPVLLLGGGGY  311

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN NS+  L  I+
Sbjct  312  TIRNVARCWCYETGVALGLEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSRQLLEEIR  371

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            S +LENL  +QHAPSV  QE PPD  +P+ DED ++PDER D
Sbjct  372  SKLLENLSKLQHAPSVPFQERPPDTELPEADEDQEDPDERWD  413



>ref|XP_010028890.1| PREDICTED: histone deacetylase 19 isoform X2 [Eucalyptus grandis]
Length=458

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+P+L+ GGGGY
Sbjct  252  IIGKVMEVFKPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRYMRSFNVPVLLLGGGGY  311

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN NS+  L  I+
Sbjct  312  TIRNVARCWCYETGVALGLEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSRQLLEEIR  371

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            S +LENL  +QHAPSV  QE PPD  +P+ DED ++PDER D
Sbjct  372  SKLLENLSKLQHAPSVPFQERPPDTELPEADEDQEDPDERWD  413



>ref|XP_003563706.1| PREDICTED: probable histone deacetylase 19 isoform X1 [Brachypodium 
distachyon]
Length=521

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 130/171 (76%), Gaps = 3/171 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+P+L+ GGGGY
Sbjct  256  IMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPVLLLGGGGY  315

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN N+   L  I+
Sbjct  316  TIRNVARCWCYETGVALGHELTDKMPLNEYYEYFGPDYTLHVAPSNMENKNTNRQLDEIR  375

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQIQ  184
            S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER   H  D  ++
Sbjct  376  SRLLDNLTKLRHAPSVQFQERPPEAELPEQDEDQENPDER---HHADSDVE  423



>ref|XP_001162233.1| PREDICTED: histone deacetylase 1 isoform X3 [Pan troglodytes]
Length=453

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQMQ +P D  IP+   DED ++PD+R+   + DK+I
Sbjct  335  QRLFENLRMLPHAPGVQMQAIPED-AIPEESGDEDKEDPDKRISICSSDKRI  385



>ref|XP_009451191.1| PREDICTED: histone deacetylase 1 isoform X2 [Pan troglodytes]
Length=476

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQMQ +P D  IP+   DED ++PD+R+   + DK+I
Sbjct  364  QRLFENLRMLPHAPGVQMQAIPEDA-IPEESGDEDKEDPDKRISICSSDKRI  414



>gb|AFK48350.1| unknown [Lotus japonicus]
Length=297

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+PLL+ GGGGY
Sbjct  51   LVGKVMEVFKPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRYMRSFNVPLLLVGGGGY  110

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN NS   L  ++
Sbjct  111  TIRNVARCWCYETGVALGIEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSHHLLEEVR  170

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            S +LENL  +QHAPS Q QE PPD+ + + DED  + DER D
Sbjct  171  SKLLENLSKLQHAPSAQFQERPPDYDLGEADEDHDDGDERWD  212



>ref|XP_519834.2| PREDICTED: histone deacetylase 1 isoform X1 [Pan troglodytes]
Length=482

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQMQ +P D  IP+   DED ++PD+R+   + DK+I
Sbjct  364  QRLFENLRMLPHAPGVQMQAIPEDA-IPEESGDEDKEDPDKRISICSSDKRI  414



>ref|XP_009389921.1| PREDICTED: probable histone deacetylase 19 [Musa acuminata subsp. 
malaccensis]
Length=516

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVR+++ FN+PLL+ GGGGY
Sbjct  253  IMGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIRGHAECVRYMRSFNVPLLLVGGGGY  312

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN NS+  L  I+
Sbjct  313  TIRNVARCWCYETGVALGIEVDDKMPQHEYYEYFGPDYTLHVAPSNMENKNSRQQLDEIR  372

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            + +L+NL  ++HAPSVQ QE PPD   P+ DED ++PDER D
Sbjct  373  ARLLDNLSKLRHAPSVQFQERPPDTEFPEPDEDQEDPDERHD  414



>ref|XP_010881163.1| PREDICTED: histone deacetylase 2 [Esox lucius]
Length=489

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 128/172 (74%), Gaps = 3/172 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +++KV+E Y P A+VLQCGADSL+GDRLGCFNL+I GHA+CV ++K FN+P+L+ GGGGY
Sbjct  246  VMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIRGHAKCVEYIKSFNLPMLMLGGGGY  305

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+P+E+P NDY +YFGPD+ L I   ++ N N+  Y+  IK
Sbjct  306  TIRNVARCWTYETAVALDTEIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYMDKIK  365

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPD--FDEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQM  +P D  +PD   DEDT++PD+R+     DK+I
Sbjct  366  QRLFENLRMLPHAPGVQMHAIPEDA-VPDDIADEDTEDPDKRVSIRASDKRI  416



>ref|XP_008809711.1| PREDICTED: probable histone deacetylase 19 [Phoenix dactylifera]
Length=515

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+P+L+ GGGGY
Sbjct  252  IIGKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPVLLLGGGGY  311

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++Y +YFGPDY+L +   ++EN N++  L  I+
Sbjct  312  TIRNVARCWCYETGVALGIEIDDKMPQHEYYEYFGPDYTLHVAPSNMENKNTRQQLDEIR  371

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            + +L+NL  ++HAPSVQ QE PPD   P+ DED ++PDER D
Sbjct  372  AKLLDNLSKLRHAPSVQFQERPPDAEFPEPDEDLEDPDERHD  413



>ref|XP_011099710.1| PREDICTED: histone deacetylase 19 isoform X2 [Sesamum indicum]
 ref|XP_011099711.1| PREDICTED: histone deacetylase 19 isoform X2 [Sesamum indicum]
Length=464

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVRF++ FN+PLL+ GGGGY
Sbjct  215  IISKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRFMRSFNVPLLLVGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++YI+YFGP+Y+L +   ++EN NS+  L  I+
Sbjct  275  TIRNVARCWCYETGVALGIEVDDKMPQHEYIEYFGPEYTLHVAPSNMENKNSRELLEHIR  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  217
              +L+NL  +QHAPSVQ QE PPD    + DED  N DER
Sbjct  335  VKLLDNLSKLQHAPSVQFQERPPDTQFLEADEDEDNKDER  374



>ref|XP_006158173.1| PREDICTED: histone deacetylase 1 [Tupaia chinensis]
Length=481

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            + SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VTSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQMQ +P D    +  ED  +PD+R+   + DK+I
Sbjct  364  QRLFENLRMLPHAPGVQMQAIPEDAVPEESGEDEDDPDKRISICSSDKRI  413



>gb|KDO51346.1| hypothetical protein CISIN_1g0130382mg, partial [Citrus sinensis]
Length=162

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKVVETY PGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFN+PLLVTGGGGY
Sbjct  32   IISKVVETYAPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGY  91

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHI  376
            TKENVARCW  ETG+LLD+ELPNEIP+N+YIKYF P+ SL+IP GHI
Sbjct  92   TKENVARCWTVETGILLDTELPNEIPENEYIKYFAPECSLRIPNGHI  138



>ref|XP_011260199.1| PREDICTED: histone deacetylase Rpd3 [Camponotus floridanus]
Length=460

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 127/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+P L+ GGGGY
Sbjct  241  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKRYNLPFLMVGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  301  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYLEKIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPD-FD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D  I D F+ E+  N DERL QH  DK+IQ
Sbjct  361  TRLFENLRMLPHAPGVQVQAIPEDGAIVDVFEPEEKMNLDERLSQHDLDKRIQ  413



>ref|XP_011099707.1| PREDICTED: histone deacetylase 19 isoform X1 [Sesamum indicum]
 ref|XP_011099708.1| PREDICTED: histone deacetylase 19 isoform X1 [Sesamum indicum]
 ref|XP_011099709.1| PREDICTED: histone deacetylase 19 isoform X1 [Sesamum indicum]
Length=501

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVRF++ FN+PLL+ GGGGY
Sbjct  252  IISKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRFMRSFNVPLLLVGGGGY  311

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P ++YI+YFGP+Y+L +   ++EN NS+  L  I+
Sbjct  312  TIRNVARCWCYETGVALGIEVDDKMPQHEYIEYFGPEYTLHVAPSNMENKNSRELLEHIR  371

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  217
              +L+NL  +QHAPSVQ QE PPD    + DED  N DER
Sbjct  372  VKLLDNLSKLQHAPSVQFQERPPDTQFLEADEDEDNKDER  411



>gb|ELW48624.1| Histone deacetylase 1 [Tupaia chinensis]
Length=509

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 124/170 (73%), Gaps = 0/170 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            + SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  272  VTSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  331

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  332  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  391

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQMQ +P D    +  ED  +PD+R+   + DK+I
Sbjct  392  QRLFENLRMLPHAPGVQMQAIPEDAVPEESGEDEDDPDKRISICSSDKRI  441



>ref|XP_004225492.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 1-like [Ciona 
intestinalis]
Length=569

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I+KV+E Y P A+VLQCGADSL GDRLGCFNL++ GHA+C+ +VKKFN+P+L+ GGGGY
Sbjct  245  VITKVMEYYQPSAVVLQCGADSLXGDRLGCFNLTVKGHAKCLEYVKKFNVPILMLGGGGY  304

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V L  E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  I+
Sbjct  305  TIRNVARCWTYETAVALGQEIPNELPYNDYFEYFGPDFKLHISPSNMSNQNTMEYLQKIR  364

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ-NPDERLDQHTQDKQIQR  181
              + ENLR + HAP VQMQ++PPD  +   D++   +PD++      DK+IQR
Sbjct  365  QRLFENLRMLPHAPGVQMQDIPPDAVVSGSDDEAMDDPDKKTSIRASDKRIQR  417



>ref|XP_010008493.1| PREDICTED: histone deacetylase 1, partial [Nestor notabilis]
 gb|KFQ41826.1| Histone deacetylase 1, partial [Nestor notabilis]
Length=268

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    A +  +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+
Sbjct  22   DESYEAIFKPVISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNL  81

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P+L+ GGGGYT  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N 
Sbjct  82   PMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQ  141

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD  265
            N+  YL  IK  + ENLR + HAP VQMQ +P D
Sbjct  142  NTNEYLEKIKQRLFENLRMLPHAPGVQMQPIPED  175



>ref|XP_002424887.1| histone deacetylase RPD3, putative [Pediculus humanus corporis]
 gb|EEB12149.1| histone deacetylase RPD3, putative [Pediculus humanus corporis]
Length=340

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 126/178 (71%), Gaps = 1/178 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+ +
Sbjct  134  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYGM  193

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P L+ GGGGYT  NV+RCW YET V L +E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  194  PFLMVGGGGYTIRNVSRCWTYETSVALGTEIANELPYNDYFEYFGPDFKLHISPSNMANQ  253

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQD  196
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D  +  + DED  NPDERL Q  +D
Sbjct  254  NTPEYLEKIKTRLFENLRMLPHAPGVQVQAIPEDGVHESEEDEDKVNPDERLPQSEKD  311



>ref|XP_008482135.1| PREDICTED: histone deacetylase Rpd3-like [Diaphorina citri]
Length=420

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = -2

Query  705  YL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGG  526
            ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+P L+ GG
Sbjct  151  FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKRYNLPFLMVGG  210

Query  525  GGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLG  346
            GGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL 
Sbjct  211  GGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLE  270

Query  345  TIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF---DEDTQNPDERLDQHTQDKQI  187
             IK+ + ENLR + HAP VQ+Q +P D    D    DED ++PDER  Q  +DK+I
Sbjct  271  KIKTRLFENLRMLPHAPGVQVQAIPEDGIRDDSAGEDEDKESPDERNPQSVRDKRI  326



>ref|XP_003690250.1| PREDICTED: histone deacetylase Rpd3-like, partial [Apis florea]
Length=486

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  238  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  297

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  298  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  357

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK+IQ
Sbjct  358  TRLFENLRMLPHAPGVQVQSIPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQ  410



>ref|XP_394976.4| PREDICTED: histone deacetylase Rpd3 isoform 1 [Apis mellifera]
 ref|XP_006617807.1| PREDICTED: histone deacetylase Rpd3-like [Apis dorsata]
Length=492

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK+IQ
Sbjct  364  TRLFENLRMLPHAPGVQVQSIPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQ  416



>ref|XP_004358601.1| histone deacetylase family protein [Dictyostelium fasciculatum]
 gb|EGG20751.1| histone deacetylase family protein [Dictyostelium fasciculatum]
Length=491

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I  V+++Y P A+VLQCGADSL GDRLGCFNLS+ GHA+CV F+K FN+PL++ GGGGY
Sbjct  261  VIQSVMDSYRPEAVVLQCGADSLTGDRLGCFNLSLKGHAQCVEFMKSFNLPLVILGGGGY  320

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T +NVARCW YET +L+D ELP+E+P NDY++Y+GPDY L I   ++EN NSK YL  +K
Sbjct  321  TIKNVARCWTYETSILVDHELPDELPYNDYLEYYGPDYRLHITPNNMENQNSKDYLEKLK  380

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
              +LENLR++QHAPS+   E+PPD Y    DED ++PD R+ +  +D+++
Sbjct  381  IQILENLRHLQHAPSIAHTEIPPDSYSYSDDEDDEDPDVRISESDRDRRV  430



>ref|XP_003707550.1| PREDICTED: histone deacetylase Rpd3-like [Megachile rotundata]
Length=492

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK+IQ
Sbjct  364  TRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQ  416



>ref|NP_001161325.1| Rpd3 histone deacetylase [Nasonia vitripennis]
Length=492

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQ-NPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + D + NPDERL Q   DK++Q
Sbjct  364  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEADEKVNPDERLPQRDIDKRLQ  416



>ref|XP_003485786.1| PREDICTED: histone deacetylase Rpd3-like [Bombus impatiens]
Length=492

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK+IQ
Sbjct  364  TRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQ  416



>ref|XP_005984211.1| PREDICTED: histone deacetylase 2-like [Pantholops hodgsonii]
Length=479

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+E Y P A+VLQCGADSL+GDRLG FNL++ GHA+CV  VK FN+P+L+ GGGGY
Sbjct  236  IISKVMEMYQPSAVVLQCGADSLSGDRLGWFNLTVKGHAKCVEVVKTFNLPILMLGGGGY  295

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD E+PNE+P NDY +YFGPD+ L I   ++ N N+  Y+  IK
Sbjct  296  TIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIK  355

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
              + ENLR + HAP VQMQ +P D    D  DED ++PD+R+     DK+I
Sbjct  356  QRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRI  406



>gb|KDR17587.1| Histone deacetylase Rpd3, partial [Zootermopsis nevadensis]
Length=426

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+ +P L+ GGGGY
Sbjct  235  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYGLPFLMVGGGGY  294

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L +E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  295  TIRNVSRCWTYETSVALGTEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  354

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D     + DED  NPDERL Q   DK+I
Sbjct  355  TRLFENLRMLPHAPGVQVQAIPEDAVNDSEDDEDKGNPDERLTQAALDKRI  405



>ref|XP_011181414.1| PREDICTED: histone deacetylase Rpd3 isoform X2 [Bactrocera cucurbitae]
Length=457

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  205  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  264

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  265  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  324

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  190
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  325  NTSEYLEKIKNRLFENLRMLPHAPGVQIQTIPEDAINDESEDEDKVNKDERITQSDKDKR  384

Query  189  I  187
            I
Sbjct  385  I  385



>ref|XP_011154868.1| PREDICTED: histone deacetylase Rpd3 [Harpegnathos saltator]
 gb|EFN89982.1| Histone deacetylase Rpd3 [Harpegnathos saltator]
Length=498

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + ED  NPDERL Q   DK+IQ
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEDKINPDERLPQRDLDKRIQ  421



>ref|XP_010934971.1| PREDICTED: histone deacetylase 19-like isoform X1 [Elaeis guineensis]
Length=507

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+SKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVR+++ FN+PLL+ GGGGY
Sbjct  254  IVSKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRYMRSFNVPLLLVGGGGY  313

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P N+Y  YF PDY+L     ++EN NS+  L  I+
Sbjct  314  TIRNVARCWCYETGVALGIEIDDKVPPNEYQGYFAPDYTLHFAASNMENKNSRQSLDDIR  373

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  217
            + +L+N+  +QHAPSVQ QE P D   P+ DED Q+ +ER
Sbjct  374  TRILDNVSKLQHAPSVQFQERPLDTEFPEEDEDQQDENER  413



>ref|XP_010935047.1| PREDICTED: histone deacetylase 19-like isoform X2 [Elaeis guineensis]
Length=506

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+SKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GHAECVR+++ FN+PLL+ GGGGY
Sbjct  254  IVSKVMEVFRPGAVVLQCGADSLSGDRLGCFNLSVKGHAECVRYMRSFNVPLLLVGGGGY  313

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++P N+Y  YF PDY+L     ++EN NS+  L  I+
Sbjct  314  TIRNVARCWCYETGVALGIEIDDKVPPNEYQGYFAPDYTLHFAASNMENKNSRQSLDDIR  373

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDER  217
            + +L+N+  +QHAPSVQ QE P D   P+ DED Q+ +ER
Sbjct  374  TRILDNVSKLQHAPSVQFQERPLDTEFPEEDEDQQDENER  413



>ref|XP_011494484.1| PREDICTED: histone deacetylase Rpd3 [Ceratosolen solmsi marchali]
Length=492

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L S++ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGSDIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK+IQ
Sbjct  364  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDERLPQRDIDKRIQ  416



>ref|XP_002983212.1| hypothetical protein SELMODRAFT_234196 [Selaginella moellendorffii]
 gb|EFJ15554.1| hypothetical protein SELMODRAFT_234196 [Selaginella moellendorffii]
Length=408

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+E Y PGAIVLQCGADSL+GDRLGCFNLS+ GHAECVRFV+ FN+PLL+ GGGGY
Sbjct  254  VISKVMEVYQPGAIVLQCGADSLSGDRLGCFNLSVKGHAECVRFVRSFNVPLLLVGGGGY  313

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV +  EL N++P NDY +YFGP+Y+L +P  + EN NS  YL +++
Sbjct  314  TVRNVARCWCYETGVAVGVELENQMPYNDYYEYFGPEYTLLVPASNKENANSPEYLDSLR  373

Query  336  SHVLENLRYIQHAPSVQMQEVPPDF  262
              +LEN+  +QHAPSV   E PPD 
Sbjct  374  QQLLENISKLQHAPSVPFYERPPDM  398



>ref|XP_011204627.1| PREDICTED: histone deacetylase Rpd3 [Bactrocera dorsalis]
Length=484

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  190
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQSIPEDAINDESEDEDKVNKDERITQSDKDKR  411

Query  189  I  187
            I
Sbjct  412  I  412



>ref|XP_011311168.1| PREDICTED: histone deacetylase Rpd3 [Fopius arisanus]
Length=491

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 123/173 (71%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMGNQNTVEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D    D  E  +  NPDERL Q   DK+IQ
Sbjct  364  TRLFENLRMLPHAPGVQVQAIPEDGATVDDSEAEEKVNPDERLPQRDLDKRIQ  416



>ref|XP_011181413.1| PREDICTED: histone deacetylase Rpd3 isoform X1 [Bactrocera cucurbitae]
Length=484

 Score =   207 bits (528),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  190
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQTIPEDAINDESEDEDKVNKDERITQSDKDKR  411

Query  189  I  187
            I
Sbjct  412  I  412



>ref|XP_011158304.1| PREDICTED: histone deacetylase Rpd3-like [Solenopsis invicta]
Length=497

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + ED  NPD+RL Q   DK++Q
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEDKTNPDDRLPQRDLDKRMQ  421



>ref|XP_011334448.1| PREDICTED: histone deacetylase Rpd3-like [Cerapachys biroi]
 gb|EZA57151.1| Histone deacetylase Rpd3 [Cerapachys biroi]
Length=497

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D  + +  E  +  NPDERL Q   DK+IQ
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKINPDERLPQRDLDKRIQ  421



>ref|XP_004519082.1| PREDICTED: histone deacetylase Rpd3-like [Ceratitis capitata]
Length=484

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  232  DEAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNL  291

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P L+ GGGGYT  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  292  PFLMVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQ  351

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQ  190
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D    +  DED  N DER+ Q  +DK+
Sbjct  352  NTSEYLEKIKNRLFENLRMLPHAPGVQIQSIPEDAINDESEDEDKVNKDERIPQSDKDKR  411

Query  189  I  187
            I
Sbjct  412  I  412



>ref|XP_009202183.1| PREDICTED: histone deacetylase 1 [Papio anubis]
 ref|XP_009202188.1| PREDICTED: histone deacetylase 1 [Papio anubis]
Length=289

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  51   VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  110

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  111  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  170

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  171  QRLFENLRMLPHAPGVQMQAIPED  194



>gb|EFN65822.1| Histone deacetylase Rpd3 [Camponotus floridanus]
Length=494

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK++Q
Sbjct  364  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDKRMQ  416



>ref|XP_011260173.1| PREDICTED: histone deacetylase Rpd3-like [Camponotus floridanus]
Length=499

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLEKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK++Q
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKVNPDDRLPQRDLDKRMQ  421



>ref|XP_006537073.1| PREDICTED: histone deacetylase 1 isoform X1 [Mus musculus]
 ref|XP_011238873.1| PREDICTED: histone deacetylase 1 isoform X1 [Mus musculus]
Length=289

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  51   VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  110

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  111  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  170

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  171  QRLFENLRMLPHAPGVQMQAIPED  194



>gb|KFP83316.1| Histone deacetylase 1, partial [Acanthisitta chloris]
Length=360

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  142  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  201

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  202  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  261

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  262  QRLFENLRMLPHAPGVQMQPIPED  285



>ref|XP_011061203.1| PREDICTED: histone deacetylase Rpd3 isoform X2 [Acromyrmex echinatior]
Length=449

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK++Q
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDKRMQ  421



>ref|XP_011061204.1| PREDICTED: histone deacetylase Rpd3 isoform X3 [Acromyrmex echinatior]
Length=448

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK++Q
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDKRMQ  421



>ref|XP_011061205.1| PREDICTED: histone deacetylase Rpd3 isoform X4 [Acromyrmex echinatior]
Length=447

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK++Q
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDKRMQ  421



>gb|KFP50838.1| Histone deacetylase 1, partial [Cathartes aura]
Length=363

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  152  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  211

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  212  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  271

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  272  QRLFENLRMLPHAPGVQMQPIPED  295



>dbj|BAG61272.1| unnamed protein product [Homo sapiens]
Length=289

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  51   VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  110

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  111  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLLISPSNMTNQNTNEYLEKIK  170

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  171  QRLFENLRMLPHAPGVQMQAIPED  194



>ref|XP_002114310.1| hypothetical protein TRIADDRAFT_64072 [Trichoplax adhaerens]
 gb|EDV23400.1| hypothetical protein TRIADDRAFT_64072 [Trichoplax adhaerens]
Length=565

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+E Y P  IVLQCGADSLAGDRLGCFNLS+ GH+ CV F+KKFN+P+++ GGGGY
Sbjct  215  VISKVMEMYQPSVIVLQCGADSLAGDRLGCFNLSLKGHSACVEFMKKFNLPIVLLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCWA ET   L  E+PNE+P NDY +YFGPD+ L I   ++ N N+  Y+  IK
Sbjct  275  TIRNVARCWAQETSAALGVEIPNELPYNDYFEYFGPDFKLNISPTNMTNQNTPDYIDRIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQMQ +P D    + DE+  +PD R+  H +DK+I
Sbjct  335  TRLFENLRMLPHAPGVQMQPIPSDVQY-ESDEEENDPDTRISMHDKDKRI  383



>ref|XP_004329860.1| PREDICTED: histone deacetylase 1-like [Tursiops truncatus]
Length=289

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  51   VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  110

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  111  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  170

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  171  QRLFENLRMLPHAPGVQMQAIPED  194



>ref|XP_011334447.1| PREDICTED: histone deacetylase Rpd3-like [Cerapachys biroi]
 gb|EZA57149.1| Histone deacetylase Rpd3 [Cerapachys biroi]
Length=493

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  243  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW +ET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  303  TIRNVSRCWTHETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYLEKIK  362

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFD--EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D  + D    E+  NPDERL Q   DK+IQ
Sbjct  363  TRLFENLRMLPHAPGVQVQAIPEDGAVIDDSEVEEKINPDERLPQRDLDKRIQ  415



>gb|KHJ79031.1| hypothetical protein OESDEN_21332, partial [Oesophagostomum dentatum]
Length=257

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 124/174 (71%), Gaps = 3/174 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I KV+E++ P AIVLQCGADSL GDRLGCFNL++ GH +CV F+KKF IPL++ GGGGY
Sbjct  37   VIQKVMESFQPCAIVLQCGADSLVGDRLGCFNLTLKGHGKCVAFLKKFGIPLMLVGGGGY  96

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V +D+E+ NE+P NDY +YFGPD+ L I   ++ N N++ YL    
Sbjct  97   TIRNVSRCWTYETSVAVDTEIANELPYNDYFEYFGPDFKLHIEKSNMTNQNTQDYLEKTM  156

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPD--FDEDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + +APSVQMQ +PPD  Y+P+    ED  NPD R      D+ I+
Sbjct  157  TRLFENLRELPYAPSVQMQPIPPDSIYVPEKSLLEDHSNPDMRNPSAIYDRAIE  210



>gb|ETN61439.1| histone deacetylase [Anopheles darlingi]
Length=491

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+I
Sbjct  362  NRLFENLRMLPHAPGVQVQAIPEDAVNEESEDEDKVDKDERLPQQDKDKRI  412



>ref|XP_002060037.1| GJ15512 [Drosophila virilis]
 gb|EDW58248.1| GJ15512 [Drosophila virilis]
Length=527

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTAEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            S + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+I
Sbjct  362  SRLFENLRMLPHAPGVQIQAIPEDAINDESEDEDKVDKDERLPQSDKDKRI  412



>ref|XP_009076065.1| PREDICTED: histone deacetylase 1, partial [Acanthisitta chloris]
Length=386

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  150  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  209

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  210  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  269

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  270  QRLFENLRMLPHAPGVQMQPIPED  293



>dbj|GAN08679.1| histone deacetylase 1/2 [Mucor ambiguus]
Length=750

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I KV+E Y P A+VLQCG DSL+GD+LGCFNLS+ GHA CV+FVKKFN+P LV GGGGY
Sbjct  242  VIEKVMEWYRPAAVVLQCGGDSLSGDKLGCFNLSMKGHANCVKFVKKFNLPTLVLGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVAR WAYETGV++  E+  ++P NDY +YFGPDY L +   ++EN+N+  YL  IK
Sbjct  302  TMRNVARTWAYETGVVVGEEMGPDMPYNDYYEYFGPDYKLDVRPSNMENMNTPDYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            + V ENL     APSVQMQEVP D  + + DED Q+PD R+ Q+  D++I
Sbjct  362  TEVFENLSRTLFAPSVQMQEVPRDHDMSE-DEDEQDPDNRMGQNYWDRRI  410



>ref|XP_008554767.1| PREDICTED: histone deacetylase Rpd3 [Microplitis demolitor]
Length=490

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  244  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMGNQNTIEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK+IQ
Sbjct  364  TRLFENLRMLPHAPGVQVQAIPEDGATIEDSEAEEKVNPDERLPQRDIDKRIQ  416



>ref|XP_001848775.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
 gb|EDS29016.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
Length=489

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+I
Sbjct  362  NRLFENLRMLPHAPGVQVQAIPEDAVNDESEDEDKVDKDERLPQTDKDKRI  412



>gb|KFO76881.1| Histone deacetylase 1, partial [Cuculus canorus]
Length=380

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  152  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  211

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  212  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  271

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  272  QRLFENLRMLPHAPGVQMQPIPED  295



>ref|XP_002961351.1| hypothetical protein SELMODRAFT_74186 [Selaginella moellendorffii]
 gb|EFJ38890.1| hypothetical protein SELMODRAFT_74186 [Selaginella moellendorffii]
Length=488

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+E Y PGAIVLQCGADSL+GDRLGCFNLS+ GHAECVRFV+ FN+PLL+ GGGGY
Sbjct  254  VISKVMEVYQPGAIVLQCGADSLSGDRLGCFNLSVKGHAECVRFVRSFNVPLLLVGGGGY  313

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV +  EL N++P NDY +YFGP+Y+L +P  + EN NS  YL +++
Sbjct  314  TVRNVARCWCYETGVAVGVELENQMPYNDYYEYFGPEYTLLVPASNKENANSPEYLDSLR  373

Query  336  SHVLENLRYIQHAPSVQMQEVPPDF  262
              +LEN+  +QHAPSV   E PPD 
Sbjct  374  QQLLENISKLQHAPSVPFYERPPDM  398



>gb|EPB86954.1| histone deacetylase 1/2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=740

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I KV+E Y P A+VLQCG DSL+GD+LGCFNLS+ GHA CV+FVKKFN+P LV GGGGY
Sbjct  242  VIEKVMEWYRPAAVVLQCGGDSLSGDKLGCFNLSMKGHANCVKFVKKFNLPTLVLGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVAR WAYETGV++  E+  ++P NDY +YFGPDY L +   ++EN+N+  YL  IK
Sbjct  302  TMRNVARTWAYETGVVVGEEMGPDMPYNDYYEYFGPDYKLDVRPSNMENMNTPDYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQI  187
            + V ENL     APSVQMQEVP D  + + DED Q+PD R+ Q+  D++I
Sbjct  362  TQVFENLSRTLFAPSVQMQEVPRDHDMSE-DEDEQDPDNRMGQNYWDRRI  410



>gb|EUB61434.1| Histone deacetylase [Echinococcus granulosus]
Length=520

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  260  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  319

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  320  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  379

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE----DTQNPDERLDQHTQDKQIQR  181
            + + ENLR + HAPSVQM +VPPD    +  E    + ++PD+R+     DK + R
Sbjct  380  NKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHR  435



>ref|XP_011061202.1| PREDICTED: histone deacetylase Rpd3 isoform X1 [Acromyrmex echinatior]
 gb|EGI61327.1| Histone deacetylase Rpd3 [Acromyrmex echinatior]
Length=497

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  249  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGGGGY  308

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  309  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLDKIK  368

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  NPD+RL Q   DK++Q
Sbjct  369  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEAEEKTNPDDRLPQRELDKRMQ  421



>gb|AHW42410.1| hdac1 [Echinococcus multilocularis]
 emb|CDS43279.1| histone deacetylase 1 [Echinococcus multilocularis]
Length=502

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  242  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  302  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE----DTQNPDERLDQHTQDKQIQR  181
            + + ENLR + HAPSVQM +VPPD    +  E    + ++PD+R+     DK + R
Sbjct  362  NKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHR  417



>ref|XP_001943175.3| PREDICTED: histone deacetylase Rpd3-like [Acyrthosiphon pisum]
Length=480

 Score =   206 bits (523),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 121/171 (71%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KV+ET+ P AIVLQCGADSL GDRLGCFNL+I GH +CV FVK++ +P+L+ GGGGY
Sbjct  241  IITKVMETFQPSAIVLQCGADSLTGDRLGCFNLTIKGHGKCVEFVKRYGVPILMVGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T +NV+RCW YET V L  E+ NE+P NDY +YF PD  L I    ++N NS  YL  IK
Sbjct  301  TTQNVSRCWTYETAVALGVEISNELPYNDYFEYFLPDSKLHISPSKMKNTNSTKYLEKIK  360

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D  +    DED  NPDER  Q   DKQI
Sbjct  361  NRIFENLRMLPHAPGVQVQAIPEDGIHSESEDEDIVNPDERNPQSITDKQI  411



>ref|XP_008869930.1| hypothetical protein H310_06587 [Aphanomyces invadans]
 gb|ETW00932.1| hypothetical protein H310_06587 [Aphanomyces invadans]
Length=438

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 1/170 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I KV+E++ PGAIVLQCGADSL GDRLGCFNL++ GH ECV+FVK F +P +V GGGGY
Sbjct  241  VIEKVIESFRPGAIVLQCGADSLTGDRLGCFNLTVQGHGECVKFVKSFGLPTMVLGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKI-PGGHIENLNSKSYLGTI  340
            T  NV+RCWAYET V LD  + N+IP N+Y +Y+ P + L + P   +EN NS++YL  I
Sbjct  301  TIRNVSRCWAYETAVCLDETVSNDIPFNEYFEYYAPSFKLHLDPNTDLENCNSRAYLEDI  360

Query  339  KSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDKQ  190
            K+ + E+LR +  APSVQM  +PPDF + + D+D  +PD+R+D     +Q
Sbjct  361  KAKIFEHLRMLNGAPSVQMSVMPPDFVLKEEDDDAIDPDQRVDHDGTKRQ  410



>ref|XP_001946674.2| PREDICTED: histone deacetylase Rpd3-like, partial [Acyrthosiphon 
pisum]
Length=461

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KV+ET+ P AIVLQCGADSL GDRLGCFNL+I GH +CV FVK + +P+L+ GGGGY
Sbjct  243  IITKVMETFQPSAIVLQCGADSLTGDRLGCFNLTIKGHGKCVEFVKLYGVPILMVGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T +NV+RCW YET V L  E+ NE+P NDY KYF PD  L I    ++N NS  YL  IK
Sbjct  303  TTQNVSRCWTYETAVALGVEISNELPYNDYFKYFLPDSKLHISPSKMKNTNSTKYLEKIK  362

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFDEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D  +    DED  NPDER  Q   DKQI
Sbjct  363  NRIFENLRMLPHAPGVQVQAIPEDGIHSESEDEDNVNPDERNPQSITDKQI  413



>ref|XP_010073968.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 1-like [Pterocles 
gutturalis]
Length=447

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  211  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  270

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  271  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  330

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  331  QRLFENLRMLPHAPGVQMQPIPED  354



>gb|EPQ15222.1| Histone deacetylase 1 [Myotis brandtii]
Length=392

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  154  VISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  213

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  214  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  273

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  274  QRLFENLRMLPHAPGVQMQAIPED  297



>ref|XP_004643035.1| PREDICTED: histone deacetylase 1 [Octodon degus]
Length=390

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  152  VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  211

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  212  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  271

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  272  QRLFENLRMLPHAPGVQMQAIPED  295



>gb|KFB51427.1| histone deacetylase Rpd3 [Anopheles sinensis]
Length=488

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+I
Sbjct  362  NRLFENLRMLPHAPGVQVQPIPEDAINDESEDEDKVDKDERLPQQDKDKRI  412



>ref|XP_316539.2| AGAP006511-PA [Anopheles gambiae str. PEST]
 gb|EAA11382.2| AGAP006511-PA [Anopheles gambiae str. PEST]
Length=470

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMSNQNTTEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+I
Sbjct  362  NRLFENLRMLPHAPGVQVQPIPEDAINDESEDEDKVDKDERLPQQDKDKRI  412



>ref|XP_009906717.1| PREDICTED: histone deacetylase 1 [Picoides pubescens]
Length=451

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>emb|CDS23263.1| histone deacetylase 1 [Echinococcus granulosus]
Length=516

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 128/176 (73%), Gaps = 4/176 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  242  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  302  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE----DTQNPDERLDQHTQDKQIQR  181
            + + ENLR + HAPSVQM +VPPD    +  E    + ++PD+R+     DK + R
Sbjct  362  NKLFENLRMLPHAPSVQMVDVPPDTIDVEEQEKEAIENEDPDKRISIMASDKAVHR  417



>ref|XP_009469103.1| PREDICTED: histone deacetylase 1 [Nipponia nippon]
Length=451

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_005509669.1| PREDICTED: histone deacetylase 1 [Columba livia]
 ref|XP_008944742.1| PREDICTED: histone deacetylase 1 [Merops nubicus]
Length=451

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009560131.1| PREDICTED: histone deacetylase 1 [Cuculus canorus]
Length=451

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_008491052.1| PREDICTED: histone deacetylase 1 [Calypte anna]
Length=451

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009968174.1| PREDICTED: histone deacetylase 1 [Tyto alba]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009330447.1| PREDICTED: histone deacetylase 1 [Pygoscelis adeliae]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_005142468.1| PREDICTED: histone deacetylase 1 [Melopsittacus undulatus]
 ref|XP_005239843.1| PREDICTED: histone deacetylase 1 [Falco peregrinus]
 ref|XP_005432818.1| PREDICTED: histone deacetylase 1 [Falco cherrug]
 ref|XP_009283043.1| PREDICTED: histone deacetylase 1 [Aptenodytes forsteri]
 ref|XP_009485613.1| PREDICTED: histone deacetylase 1 [Pelecanus crispus]
 ref|XP_009499265.1| PREDICTED: histone deacetylase 1 [Phalacrocorax carbo]
 ref|XP_009572738.1| PREDICTED: histone deacetylase 1 [Fulmarus glacialis]
 ref|XP_009646827.1| PREDICTED: histone deacetylase 1 [Egretta garzetta]
 ref|XP_009807682.1| PREDICTED: histone deacetylase 1 [Gavia stellata]
 ref|XP_009882830.1| PREDICTED: histone deacetylase 1 [Charadrius vociferus]
 ref|XP_009928476.1| PREDICTED: histone deacetylase 1 [Haliaeetus albicilla]
 ref|XP_009944423.1| PREDICTED: histone deacetylase 1 [Leptosomus discolor]
 ref|XP_009985789.1| PREDICTED: histone deacetylase 1 [Tauraco erythrolophus]
 ref|XP_009998860.1| PREDICTED: histone deacetylase 1 [Chaetura pelagica]
 ref|XP_010174338.1| PREDICTED: histone deacetylase 1 [Caprimulgus carolinensis]
 ref|XP_010118810.1| PREDICTED: histone deacetylase 1 [Chlamydotis macqueenii]
 ref|XP_010288082.1| PREDICTED: histone deacetylase 1 [Phaethon lepturus]
 ref|XP_010310727.1| PREDICTED: histone deacetylase 1 [Balearica regulorum gibbericeps]
 ref|XP_010574320.1| PREDICTED: histone deacetylase 1 [Haliaeetus leucocephalus]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_010721789.1| PREDICTED: histone deacetylase 1 [Meleagris gallopavo]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_010209083.1| PREDICTED: histone deacetylase 1 [Colius striatus]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_004358133.1| histone deacetylase family protein [Dictyostelium fasciculatum]
 gb|EGG19787.1| histone deacetylase family protein [Dictyostelium fasciculatum]
Length=295

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 7/166 (4%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I  V++ Y P A+VLQCGADSL  DRLGCFNL+  GHAECVRFVK FN+P LV GGGGY
Sbjct  118  VIQGVMDYYRPSAVVLQCGADSLRFDRLGCFNLTFKGHAECVRFVKSFNLPTLVLGGGGY  177

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLK-----IPGGHIENLNSKSY  352
            T  NVARCW YET VLLD+E+ NE+P NDYI+Y+ PD+ L      IP  + ENLN+K Y
Sbjct  178  TVRNVARCWTYETSVLLDTEISNELPFNDYIQYYAPDFQLHPDYSGIPFRY-ENLNTKQY  236

Query  351  LGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDER  217
            L  +K  +LENLR +Q APSVQ+Q++PPD    D  +ED  +PD+R
Sbjct  237  LENLKIKILENLRLLQWAPSVQIQDIPPDIMNLDLGNEDKLDPDKR  282



>ref|XP_009699610.1| PREDICTED: histone deacetylase 1 [Cariama cristata]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009679321.1| PREDICTED: histone deacetylase 1 [Struthio camelus australis]
 ref|XP_009866216.1| PREDICTED: histone deacetylase 1 [Apaloderma vittatum]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_007444029.1| PREDICTED: histone deacetylase 1-like, partial [Python bivittatus]
Length=283

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+ET+ P A+ LQCG+DSL+GDRLGCFNL+I GHA+CV F+K FN+P+L+ GGGGY
Sbjct  47   VMSKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFIKSFNLPMLMLGGGGY  106

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V L++E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  107  TIRNVARCWTYETAVALNTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  166

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  167  QRLFENLRMLPHAPGVQMQPIPED  190



>ref|XP_010129593.1| PREDICTED: histone deacetylase 1 [Buceros rhinoceros silvestris]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_008918838.1| PREDICTED: histone deacetylase 1 [Manacus vitellinus]
Length=451

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>gb|KFR03534.1| Histone deacetylase 1, partial [Nipponia nippon]
Length=441

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  230  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  289

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  290  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  349

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  350  QRLFENLRMLPHAPGVQMQPIPED  373



>ref|XP_005191575.1| PREDICTED: histone deacetylase Rpd3 [Musca domestica]
Length=485

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH  CV FVKK+N+P L+ GGGGY
Sbjct  243  IISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGRCVEFVKKYNLPFLMVGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  I+
Sbjct  303  TIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTTEYLEKIR  362

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D    +  DED  + DERL Q  +DK+I
Sbjct  363  NRLFENLRMLPHAPGVQIQAIPEDAINDESEDEDKVDKDERLTQADKDKRI  413



>ref|XP_011050777.1| PREDICTED: histone deacetylase Rpd3-like [Acromyrmex echinatior]
 gb|EGI67731.1| Histone deacetylase Rpd3 [Acromyrmex echinatior]
Length=495

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++N+P L+ GGGGY
Sbjct  243  IISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKRYNLPFLMVGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  303  TIRNVSRCWTYETSVALGCEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLDKIK  362

Query  336  SHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDKQIQ  184
            + + ENLR + HAP VQ+Q +P D   I D + E+  N DERL Q   DK+IQ
Sbjct  363  TRLFENLRMLPHAPGVQVQAIPEDGAVIEDSEIEEKMNLDERLPQRDLDKRIQ  415



>ref|XP_005058307.1| PREDICTED: histone deacetylase 1 isoform X2 [Ficedula albicollis]
Length=449

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>gb|KFR06102.1| Histone deacetylase 1, partial [Opisthocomus hoazin]
Length=405

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+ LQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  194  VISKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  253

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  254  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  313

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  314  QRLFENLRMLPHAPGVQMQPIPED  337



>ref|XP_003397521.1| PREDICTED: hypothetical protein LOC100642763 [Bombus terrestris]
Length=1431

 Score =   213 bits (542),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 130/183 (71%), Gaps = 2/183 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    + ++ IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+
Sbjct  234  DESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNL  293

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P L+ GGGGYT  NV+RCW YET V L SE+ NE+P NDY +YFGPD+ L I   ++ N 
Sbjct  294  PFLMVGGGGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQ  353

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPD-FYIPDFD-EDTQNPDERLDQHTQDK  193
            N+  YL  IK+ + ENLR + HAP VQ+Q +P D   I D + E+  NPDERL Q   DK
Sbjct  354  NTPEYLEKIKTRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDK  413

Query  192  QIQ  184
            +IQ
Sbjct  414  RIQ  416



>ref|XP_007669959.1| PREDICTED: histone deacetylase 1 [Ornithorhynchus anatinus]
Length=428

 Score =   204 bits (518),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  198  VMSKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  257

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  258  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  317

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  318  QRLFENLRMLPHAPGVQMQAIPED  341



>ref|XP_005427182.1| PREDICTED: histone deacetylase 1 [Geospiza fortis]
Length=450

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>gb|KFO60221.1| Histone deacetylase 1, partial [Corvus brachyrhynchos]
 gb|KFW78231.1| Histone deacetylase 1, partial [Manacus vitellinus]
Length=439

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|EOB00696.1| Histone deacetylase 1, partial [Anas platyrhynchos]
Length=446

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  218  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  277

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  278  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  337

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  338  QRLFENLRMLPHAPGVQMQPIPED  361



>gb|KFV75060.1| Histone deacetylase 1, partial [Picoides pubescens]
Length=439

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFV55204.1| Histone deacetylase 1, partial [Tyto alba]
Length=439

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFP28914.1| Histone deacetylase 1, partial [Colius striatus]
Length=439

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFM11275.1| Histone deacetylase 1, partial [Aptenodytes forsteri]
 gb|KFP36148.1| Histone deacetylase 1, partial [Chlamydotis macqueenii]
 gb|KFP58730.1| Histone deacetylase 1, partial [Cariama cristata]
 gb|KFP87340.1| Histone deacetylase 1, partial [Apaloderma vittatum]
 gb|KFP93147.1| Histone deacetylase 1, partial [Haliaeetus albicilla]
 gb|KFQ06137.1| Histone deacetylase 1, partial [Leptosomus discolor]
 gb|KFQ22896.1| Histone deacetylase 1, partial [Merops nubicus]
 gb|KFQ53700.1| Histone deacetylase 1, partial [Pelecanus crispus]
 gb|KFQ79739.1| Histone deacetylase 1, partial [Phoenicopterus ruber ruber]
 gb|KFV18789.1| Histone deacetylase 1, partial [Tauraco erythrolophus]
 gb|KFV41775.1| Histone deacetylase 1, partial [Gavia stellata]
 gb|KFV90773.1| Histone deacetylase 1, partial [Fulmarus glacialis]
 gb|KFW88736.1| Histone deacetylase 1, partial [Phalacrocorax carbo]
 gb|KFZ49051.1| Histone deacetylase 1, partial [Caprimulgus carolinensis]
 gb|KFZ69359.1| Histone deacetylase 1, partial [Podiceps cristatus]
 gb|KGL92857.1| Histone deacetylase 1, partial [Charadrius vociferus]
Length=439

 Score =   204 bits (518),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFV84480.1| Histone deacetylase 1, partial [Struthio camelus australis]
Length=446

 Score =   204 bits (519),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFP00125.1| Histone deacetylase 1, partial [Calypte anna]
Length=439

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFP10889.1| Histone deacetylase 1, partial [Egretta garzetta]
Length=443

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  232  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  291

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  292  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  351

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  352  QRLFENLRMLPHAPGVQMQPIPED  375



>gb|KGL79664.1| Histone deacetylase 1, partial [Tinamus guttatus]
Length=440

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  214  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  273

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  274  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  333

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  334  QRLFENLRMLPHAPGVQMQPIPED  357



>gb|KFU91820.1| Histone deacetylase 1, partial [Chaetura pelagica]
Length=447

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|ACN25329.1| unknown [Zea mays]
Length=439

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+PLL+ GGGGY
Sbjct  256  IMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPLLLLGGGGY  315

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN N++  L  IK
Sbjct  316  TIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPSNMENKNTRHQLDDIK  375

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER D
Sbjct  376  SKLLDNLSKLRHAPSVQFQERPPEAELPEQDEDKENPDERHD  417



>ref|XP_009030811.1| hypothetical protein HELRODRAFT_194553 [Helobdella robusta]
 gb|ESN91106.1| hypothetical protein HELRODRAFT_194553 [Helobdella robusta]
Length=628

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 123/171 (72%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCGADSL+GDRLGCFNLS+ GH +CV FV++FN+P L+ GGGGY
Sbjct  245  VMSKVMEMFQPSAVVLQCGADSLSGDRLGCFNLSLKGHGKCVEFVRRFNLPTLMVGGGGY  304

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET + L +E+ NE+P NDY +Y+GPD+ L I   ++ N N+  YL  IK
Sbjct  305  TIRNVARCWTYETSIALQTEIANELPYNDYFEYYGPDFKLHINPSNMTNQNTTEYLDKIK  364

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            S + ENLR + HAP VQM ++  D    +  DED QNPDER+     DK+I
Sbjct  365  SRLFENLRMLPHAPGVQMADIVDDALKEESDDEDKQNPDERISIRASDKRI  415



>ref|XP_008633314.1| PREDICTED: histone deacetylase 1 [Corvus brachyrhynchos]
Length=453

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>ref|XP_009929569.1| PREDICTED: histone deacetylase 1 [Opisthocomus hoazin]
Length=417

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+ LQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  181  VISKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  240

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  241  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  300

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  301  QRLFENLRMLPHAPGVQMQPIPED  324



>gb|KFQ67796.1| Histone deacetylase 1, partial [Phaethon lepturus]
Length=447

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|EFX81904.1| putative histone deacetylase HDAC3 protein [Daphnia pulex]
Length=434

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +I  V+E Y P AIVLQCGADSLA DRLGCFNLS  GH ECV+FVK FN+PLLV GGGGY
Sbjct  243  VIQYVMEFYQPTAIVLQCGADSLANDRLGCFNLSTKGHGECVKFVKDFNVPLLVLGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPG--GHIENLNSKSYLGT  343
            T  NVARCW YET +L+D  + NE+P N+Y +YF PD+SL  P      EN NSK YL T
Sbjct  303  TLRNVARCWTYETSLLVDEGISNELPYNEYFEYFAPDFSLH-PDVVTRQENANSKQYLET  361

Query  342  IKSHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ-NPDERLDQHTQDKQIQ  184
            I   + ENLR I+HAPSV MQ+VPPD  + +F+E  + +PD RL Q  +DK+I+
Sbjct  362  ITKTIHENLRMIEHAPSVMMQDVPPD--LLNFEEAEELDPDVRLHQQEEDKRIE  413



>gb|EMC82692.1| Histone deacetylase 1, partial [Columba livia]
Length=464

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>gb|KFW72873.1| Histone deacetylase 1, partial [Pygoscelis adeliae]
Length=453

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  228  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  287

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  288  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  347

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  348  QRLFENLRMLPHAPGVQMQPIPED  371



>emb|CDJ05997.1| histone deacetylase 1 [Echinococcus multilocularis]
Length=555

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+ET+ PGA VLQCGADSL+GDRLGCFNLS+ GH +CV F++ F IPLL+ GGGGY
Sbjct  242  VVSKVMETFRPGAAVLQCGADSLSGDRLGCFNLSLKGHGKCVEFLRSFPIPLLMLGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET + L++E+PN++P NDY +YFGPD+ L I   ++ NLN+  Y+  IK
Sbjct  302  TIRNVARCWTYETSIALNTEVPNDLPYNDYYEYFGPDFKLHISPSNMTNLNTPDYIERIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDE------DTQNPDERLDQHTQDKQIQR  181
            + + ENLR + HAPSVQM +VPPD    D +E      + ++PD+R+     DK + R
Sbjct  362  NKLFENLRMLPHAPSVQMVDVPPD--TIDVEEQEKEAIENEDPDKRISIMASDKAVHR  417



>ref|XP_002438614.1| hypothetical protein SORBIDRAFT_10g022820 [Sorghum bicolor]
 gb|EER89981.1| hypothetical protein SORBIDRAFT_10g022820 [Sorghum bicolor]
Length=518

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+PLL+ GGGGY
Sbjct  256  IMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPLLLLGGGGY  315

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN N++  L  IK
Sbjct  316  TIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPSNMENKNTRHQLDDIK  375

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER D
Sbjct  376  SKLLDNLSKLRHAPSVQFQERPPEAELPEQDEDKENPDERRD  417



>ref|XP_002194370.2| PREDICTED: histone deacetylase 1, partial [Taeniopygia guttata]
Length=466

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  364  QRLFENLRMLPHAPGVQMQPIPED  387



>gb|KDO16344.1| hypothetical protein SPRG_18127 [Saprolegnia parasitica CBS 223.65]
Length=188

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 117/172 (68%), Gaps = 2/172 (1%)
 Frame = -2

Query  726  DLGXXAWYL*IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNI  547
            D    A +  +ISKV+E + PGA+VLQCGADSL+GDRLGCFNLS+ GH +CV FVK FNI
Sbjct  3    DESFTAVFRDVISKVMEHFAPGAVVLQCGADSLSGDRLGCFNLSVKGHGDCVAFVKSFNI  62

Query  546  PLLVTGGGGYTKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENL  367
            P+LV GGGGYT  NV RCW YET V L  E+P+ +P NDY +YFGP+Y L +P  ++ENL
Sbjct  63   PMLVLGGGGYTLRNVPRCWCYETSVALGVEIPDAMPYNDYFEYFGPEYRLHMPVSNMENL  122

Query  366  NSKSYLGTIKSHVLENLRYIQHAPSVQMQEVPPDFYIP--DFDEDTQNPDER  217
            N+ SYL   K  + E LR I+  PSV  Q VP        + +ED  +PD R
Sbjct  123  NTPSYLNDTKQRLFEQLRQIEPVPSVPFQHVPAKMVDASDNVNEDMADPDAR  174



>ref|NP_989487.1| histone deacetylase 1 [Gallus gallus]
 sp|P56517.1|HDAC1_CHICK RecName: Full=Histone deacetylase 1; Short=HD1 [Gallus gallus]
 gb|AAB96923.1| histone deacetylase-1 [Gallus gallus]
 gb|AAC00504.1| erythrocyte histone deacetylase [Gallus gallus]
Length=480

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  364  QRLFENLRMLPHAPGVQMQPIPED  387



>ref|XP_008788392.1| PREDICTED: histone deacetylase 9 isoform X2 [Phoenix dactylifera]
Length=382

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 4/142 (3%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KVVETY+PG IVLQCGADSLAGDRLGCFNLSI+GH+ECV+FVKKFN+PLLVTGGGGY
Sbjct  241  IIAKVVETYLPGVIVLQCGADSLAGDRLGCFNLSIEGHSECVKFVKKFNLPLLVTGGGGY  300

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            TKENVARCW  ETGVLLD+ELPNEIPDN+YIKYF PDY+LK   G+I  +++KS    I 
Sbjct  301  TKENVARCWTVETGVLLDTELPNEIPDNEYIKYFSPDYTLKTQNGNIVYVSAKS----II  356

Query  336  SHVLENLRYIQHAPSVQMQEVP  271
              V++N   +    SV++ + P
Sbjct  357  HFVVKNESNLDKWTSVKLYDSP  378



>gb|AAB99850.1| histone deacetylase 1 [Gallus gallus]
Length=480

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  364  QRLFENLRMLPHAPGVQMQPIPED  387



>ref|XP_005058306.1| PREDICTED: histone deacetylase 1 isoform X1 [Ficedula albicollis]
Length=478

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQPIPED  358



>gb|AEP04145.1| histone deacetylase 19 [Musa acuminata AAA Group]
Length=222

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 124/168 (74%), Gaps = 1/168 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KV+E + P A+VLQCGADSL+GDRLGCFNLS+ GHAECVR+++ FN+PL++ GGGGY
Sbjct  50   IIAKVMEVFNPDAVVLQCGADSLSGDRLGCFNLSVKGHAECVRYLRSFNVPLMLLGGGGY  109

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  E+ +++PD++YI YF PDY++ +   ++EN NS+  L  IK
Sbjct  110  TIRNVARCWCYETGVALGVEVEDKVPDHEYIGYFAPDYNIHVATSNMENKNSRKSLDDIK  169

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLDQHTQDK  193
              +LE L  +QH P VQ QE P D  + + +ED ++ +E+ D H  D+
Sbjct  170  VKLLEYLSKLQHVPGVQFQERPTDMDLEEENEDQEDTNEKND-HNSDR  216



>ref|XP_009096801.1| PREDICTED: histone deacetylase 1 [Serinus canaria]
Length=475

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  364  QRLFENLRMLPHAPGVQMQPIPED  387



>ref|XP_001946324.2| PREDICTED: histone deacetylase Rpd3-like [Acyrthosiphon pisum]
Length=491

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 122/171 (71%), Gaps = 1/171 (1%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            II+KV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVK++ +P L+ GGGGY
Sbjct  243  IITKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKRYGLPFLMVGGGGY  302

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L +E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  303  TIRNVSRCWTYETAVALGAEIANELPYNDYFEYFGPDFKLHISPSNMTNTNATEYLEKIK  362

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDF-DEDTQNPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D    +  DED  NPDER  Q   DK+I
Sbjct  363  NRLFENLRMLPHAPGVQVQAIPEDGVRNESEDEDNVNPDERNPQSITDKRI  413



>ref|XP_010406403.1| PREDICTED: histone deacetylase 1, partial [Corvus cornix cornix]
Length=472

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  236  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  295

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  296  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  355

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  356  QRLFENLRMLPHAPGVQMQPIPED  379



>gb|ADO79635.1| histone deacetylase [Drosophila nasuta]
Length=518

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D  I D  ED +  + DERL Q  +DK+I
Sbjct  362  NRLFENLRMLPHAPGVQIQAIPEDA-INDESEDDEKVDKDERLPQSDKDKRI  412



>gb|ADO79632.1| histone deacetylase [Drosophila albomicans]
 gb|ADO79633.1| histone deacetylase [Drosophila nasuta]
 gb|ADO79634.1| histone deacetylase [Drosophila nasuta]
 gb|ADO79636.1| histone deacetylase [Drosophila nasuta]
 gb|ADO79637.1| histone deacetylase [Drosophila nasuta]
Length=518

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            IISKV+ET+ P A+VLQCGADSL GDRLGCFNL++ GH +CV FVKK+N+P L+ GGGGY
Sbjct  242  IISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGY  301

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NV+RCW YET V L  E+ NE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  302  TIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIK  361

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQ--NPDERLDQHTQDKQI  187
            + + ENLR + HAP VQ+Q +P D  I D  ED +  + DERL Q  +DK+I
Sbjct  362  NRLFENLRMLPHAPGVQIQAIPEDA-INDESEDDEKVDKDERLPQSDKDKRI  412



>gb|EPY87302.1| histone deacetylase 1 isoform 5-like protein [Camelus ferus]
Length=428

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            ++SKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  190  VMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  249

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  250  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  309

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  310  QRLFENLRMLPHAPGVQMQAIPED  333



>ref|XP_006777443.1| PREDICTED: histone deacetylase 1 [Myotis davidii]
Length=453

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+E + P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  215  VISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  274

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  275  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  334

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  335  QRLFENLRMLPHAPGVQMQAIPED  358



>ref|XP_005529817.1| PREDICTED: histone deacetylase 1 [Pseudopodoces humilis]
Length=482

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            +ISKV+ET+ P A+VLQCG+DSL+GDRLGCFNL+I GHA+CV FVK FN+P+L+ GGGGY
Sbjct  244  VISKVMETFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGY  303

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YET V LD+E+PNE+P NDY +YFGPD+ L I   ++ N N+  YL  IK
Sbjct  304  TIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIK  363

Query  336  SHVLENLRYIQHAPSVQMQEVPPD  265
              + ENLR + HAP VQMQ +P D
Sbjct  364  QRLFENLRMLPHAPGVQMQPIPED  387



>ref|XP_004966013.1| PREDICTED: probable histone deacetylase 19-like [Setaria italica]
Length=518

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = -2

Query  696  IISKVVETYIPGAIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNIPLLVTGGGGY  517
            I+ KV+E + PGA+VLQCGADSL+GDRLGCFNLSI GHAECVRF++ FN+PLL+ GGGGY
Sbjct  256  IMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFMRSFNVPLLLLGGGGY  315

Query  516  TKENVARCWAYETGVLLDSELPNEIPDNDYIKYFGPDYSLKIPGGHIENLNSKSYLGTIK  337
            T  NVARCW YETGV L  EL +++P N+Y +YFGPDY+L +   ++EN N++  L  I+
Sbjct  316  TIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPSNMENKNTRHQLDDIR  375

Query  336  SHVLENLRYIQHAPSVQMQEVPPDFYIPDFDEDTQNPDERLD  211
            S +L+NL  ++HAPSVQ QE PP+  +P+ DED +NPDER D
Sbjct  376  SKLLDNLSKLRHAPSVQFQERPPEAELPEQDEDKENPDERRD  417



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050