BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044I06

Length=807
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAQ18901.1|  chromomethylase                                        345   5e-115   Nicotiana sylvestris
ref|XP_004252840.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    353   7e-111   
ref|NP_001289523.1|  DNA (cytosine-5)-methyltransferase CMT3-like       347   6e-109   Nicotiana sylvestris
emb|CDN40870.1|  chromomethylase                                        347   7e-109   Nicotiana sylvestris
gb|AGH70220.1|  chromomethylase 3                                       345   4e-108   Nicotiana benthamiana
ref|XP_009590684.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    345   5e-108   Nicotiana tomentosiformis
ref|XP_011089105.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    341   6e-107   Sesamum indicum [beniseed]
ref|XP_007208072.1|  hypothetical protein PRUPE_ppa001672mg             337   4e-106   
ref|XP_008226363.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    335   2e-104   Prunus mume [ume]
ref|XP_010316153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    330   9e-104   
gb|EYU39242.1|  hypothetical protein MIMGU_mgv1a001319mg                332   1e-103   Erythranthe guttata [common monkey flower]
gb|ACX83573.1|  DNA chromomethylase                                     325   3e-103   Hieracium piloselloides
ref|XP_004228597.2|  PREDICTED: DNA (cytosine-5)-methyltransferas...    331   4e-103   Solanum lycopersicum
emb|CDP13153.1|  unnamed protein product                                330   2e-102   Coffea canephora [robusta coffee]
ref|XP_006354167.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    328   3e-102   Solanum tuberosum [potatoes]
ref|XP_004513046.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    328   4e-102   Cicer arietinum [garbanzo]
ref|XP_004513047.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    328   4e-102   Cicer arietinum [garbanzo]
gb|KDP44326.1|  hypothetical protein JCGZ_19193                         325   7e-102   Jatropha curcas
ref|NP_001275877.1|  DNA (cytosine-5)-methyltransferase CMT3-like       326   4e-101   Citrus sinensis [apfelsine]
ref|XP_006445885.1|  hypothetical protein CICLE_v10014232mg             325   7e-101   Citrus clementina [clementine]
gb|AFK45072.1|  unknown                                                 305   1e-100   Lotus japonicus
ref|XP_007014767.1|  Chromomethylase 3, putative isoform 2              319   4e-100   
emb|CAQ18903.1|  chromomethylase                                        319   1e-99    Nicotiana sylvestris
ref|XP_007014766.1|  Chromomethylase 1, putative isoform 1              322   4e-99    
ref|XP_007014768.1|  Chromomethylase 1, putative isoform 3              322   4e-99    
ref|XP_007152976.1|  hypothetical protein PHAVU_004G176100g             315   6e-99    Phaseolus vulgaris [French bean]
gb|KHN40382.1|  DNA (cytosine-5)-methyltransferase 1                    316   8e-99    Glycine soja [wild soybean]
gb|AEC12443.1|  chromomethylase 3                                       318   9e-99    Gossypium hirsutum [American cotton]
ref|XP_009781266.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    319   1e-98    Nicotiana sylvestris
ref|XP_011037978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    321   1e-98    Populus euphratica
gb|EPS58007.1|  chromomethylase                                         310   1e-98    Genlisea aurea
ref|XP_011037979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    320   2e-98    Populus euphratica
ref|XP_009781265.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    320   2e-98    Nicotiana sylvestris
ref|XP_009625628.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    318   2e-98    
ref|XP_009781264.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    319   2e-98    Nicotiana sylvestris
ref|XP_009625627.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    318   2e-98    Nicotiana tomentosiformis
gb|KJB07908.1|  hypothetical protein B456_001G052000                    319   2e-98    Gossypium raimondii
gb|AFK80345.1|  chromomethylase 3                                       315   3e-98    Nicotiana benthamiana
ref|XP_006572936.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    318   5e-98    Glycine max [soybeans]
ref|XP_009364101.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    318   1e-97    
ref|XP_008451103.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    316   2e-97    Cucumis melo [Oriental melon]
dbj|BAC53936.1|  chromomethylase-like protein                           313   2e-97    Nicotiana tabacum [American tobacco]
ref|XP_009376742.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    318   2e-97    
ref|XP_007152975.1|  hypothetical protein PHAVU_004G176100g             316   3e-97    Phaseolus vulgaris [French bean]
ref|XP_002299134.2|  hypothetical protein POPTR_0001s04700g             317   4e-97    
ref|XP_009364100.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    318   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_004170052.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    311   9e-97    
ref|XP_004149031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    312   4e-96    Cucumis sativus [cucumbers]
ref|XP_011462220.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    312   1e-95    Fragaria vesca subsp. vesca
emb|CBI16477.3|  unnamed protein product                                310   2e-95    Vitis vinifera
ref|XP_008390169.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    314   2e-95    
ref|NP_001280801.1|  DNA (cytosine-5)-methyltransferase CMT3            314   3e-95    Malus domestica [apple tree]
ref|XP_004288717.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    312   3e-95    Fragaria vesca subsp. vesca
ref|XP_010651344.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    311   4e-95    Vitis vinifera
ref|XP_010673524.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    307   5e-94    Beta vulgaris subsp. vulgaris [field beet]
gb|KCW85898.1|  hypothetical protein EUGRSUZ_B02615                     298   1e-92    Eucalyptus grandis [rose gum]
ref|XP_010243382.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    303   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010243384.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    303   1e-92    Nelumbo nucifera [Indian lotus]
gb|ABW96889.1|  CMT-type DNA-methyltransferase                          304   1e-92    Elaeis guineensis
ref|XP_010936992.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    304   1e-92    Elaeis guineensis
ref|NP_001266791.1|  uncharacterized protein LOC101027213               288   3e-92    
ref|XP_009390334.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    302   4e-92    
ref|XP_007157973.1|  hypothetical protein PHAVU_002G113900g             301   7e-92    Phaseolus vulgaris [French bean]
ref|XP_003612312.1|  DNA (cytosine-5)-methyltransferase                 298   5e-91    Medicago truncatula
gb|KEH27609.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    298   5e-91    Medicago truncatula
ref|XP_009390335.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    299   5e-91    
ref|XP_010043881.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    299   5e-91    Eucalyptus grandis [rose gum]
ref|XP_006573534.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    297   1e-90    Glycine max [soybeans]
gb|KEH27061.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    297   2e-90    Medicago truncatula
ref|XP_009390332.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    297   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB46585.2|  DNA cytosine methyltransferase MET2a, putative, e...    282   1e-89    Oryza sativa Japonica Group [Japonica rice]
gb|KHN41840.1|  DNA (cytosine-5)-methyltransferase 1                    293   4e-89    Glycine soja [wild soybean]
ref|XP_006590741.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    293   4e-89    Glycine max [soybeans]
ref|XP_008797880.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    295   6e-89    Phoenix dactylifera
gb|KEH28933.1|  DNA (cytosine-5)-methyltransferase CMT1                 293   7e-89    Medicago truncatula
ref|NP_001064023.1|  Os10g0104900                                       281   9e-89    
ref|XP_003636958.1|  DNA (cytosine-5)-methyltransferase                 292   1e-88    
ref|XP_002530367.1|  protein with unknown function                      290   7e-88    Ricinus communis
gb|AFV99137.1|  CMT-type cytosine DNA-methyltransferase 3c              292   8e-88    Malus domestica [apple tree]
ref|XP_010533849.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    289   9e-88    Tarenaya hassleriana [spider flower]
ref|XP_010541913.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    290   1e-87    Tarenaya hassleriana [spider flower]
ref|NP_001266331.1|  uncharacterized protein LOC101027085               275   1e-87    
gb|KEH25929.1|  DNA (cytosine-5)-methyltransferase CMT1                 289   2e-87    Medicago truncatula
sp|Q8LPU5.1|CMT3_MAIZE  RecName: Full=DNA (cytosine-5)-methyltran...    289   5e-87    Zea mays [maize]
ref|XP_006854149.1|  hypothetical protein AMTR_s00048p00181490          291   1e-86    
ref|NP_001105167.1|  DNA (cytosine-5)-methyltransferase 3               288   1e-86    
gb|KEH27204.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    288   2e-86    Medicago truncatula
gb|KDP34481.1|  hypothetical protein JCGZ_12764                         286   2e-86    Jatropha curcas
dbj|BAF34637.1|  chromomethylase                                        285   2e-86    Brassica rapa
emb|CDY08836.1|  BnaA06g23880D                                          285   3e-86    Brassica napus [oilseed rape]
ref|XP_004512254.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    286   3e-86    
ref|XP_009150572.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    285   3e-86    Brassica rapa
ref|XP_004983483.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    286   6e-86    Setaria italica
ref|XP_006662134.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    284   1e-85    
ref|XP_006849583.1|  hypothetical protein AMTR_s00024p00193220          283   4e-85    
ref|XP_002275932.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    282   6e-85    Vitis vinifera
emb|CBI29991.3|  unnamed protein product                                282   7e-85    Vitis vinifera
ref|XP_010415636.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    281   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010470977.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    281   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010234610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    282   2e-84    Brachypodium distachyon [annual false brome]
ref|XP_010415637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    281   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010470978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    280   2e-84    Camelina sativa [gold-of-pleasure]
gb|EEC70797.1|  hypothetical protein OsI_02246                          281   5e-84    Oryza sativa Indica Group [Indian rice]
dbj|BAH37019.1|  chromomethylase OsMET2a                                281   5e-84    Oryza sativa Japonica Group [Japonica rice]
gb|EEE50451.1|  hypothetical protein OsJ_30466                          281   6e-84    Oryza sativa Japonica Group [Japonica rice]
gb|AIU80190.1|  chromomethylase                                         280   6e-84    Hevea brasiliensis [jebe]
gb|KFK30827.1|  hypothetical protein AALP_AA6G031000                    280   9e-84    Arabis alpina [alpine rockcress]
emb|CDX97957.1|  BnaA06g07080D                                          278   1e-83    
ref|XP_002448525.1|  hypothetical protein SORBIDRAFT_06g028430          280   1e-83    Sorghum bicolor [broomcorn]
ref|XP_009148471.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    277   2e-83    
pdb|4FT2|A  Chain A, Crystal Structure Of Zea Mays Zmet2 In Compl...    276   4e-83    synthetic construct
emb|CDY19364.1|  BnaC05g08730D                                          276   5e-83    Brassica napus [oilseed rape]
ref|XP_004987095.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    283   5e-83    
ref|XP_006417360.1|  hypothetical protein EUTSA_v10006850mg             276   5e-83    Eutrema salsugineum [saltwater cress]
gb|AFW59438.1|  DNA (cytosine-5)-methyltransferase 1                    277   2e-82    
ref|NP_001104978.1|  DNA (cytosine-5)-methyltransferase 1               277   2e-82    Zea mays [maize]
ref|XP_010666617.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    275   2e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002974335.1|  hypothetical protein SELMODRAFT_30570              274   2e-82    
gb|EMS51591.1|  DNA (cytosine-5)-methyltransferase 1                    274   2e-82    Triticum urartu
gb|KJB16173.1|  hypothetical protein B456_002G216500                    275   3e-82    Gossypium raimondii
emb|CDY14524.1|  BnaC03g49350D                                          274   4e-82    Brassica napus [oilseed rape]
ref|XP_010236739.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    275   7e-82    Brachypodium distachyon [annual false brome]
emb|CAJ01708.1|  chromomethylase 1                                      271   1e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24338.1|  DNA (cytosine-5)-methyltransferase 1                    273   1e-81    
ref|XP_002990857.1|  hypothetical protein SELMODRAFT_132507             275   1e-81    
emb|CAS84142.1|  chromomethylase                                        265   3e-81    Nicotiana tomentosiformis
ref|XP_002888734.1|  chromomethylase CMT3                               271   7e-81    Arabidopsis lyrata subsp. lyrata
pdb|4FSX|A  Chain A, Crystal Structure Of Se-Substituted Zea Mays...    270   8e-81    Zea mays [maize]
gb|KJB16174.1|  hypothetical protein B456_002G216500                    269   5e-80    Gossypium raimondii
gb|KJB16168.1|  hypothetical protein B456_002G216500                    269   6e-80    Gossypium raimondii
ref|XP_006390678.1|  hypothetical protein EUTSA_v10018159mg             266   2e-79    
ref|XP_007041239.1|  Chromomethylase 1, putative                        267   3e-79    
ref|XP_003615342.1|  DNA (cytosine-5)-methyltransferase                 266   4e-79    
gb|EEE58631.1|  hypothetical protein OsJ_09996                          268   8e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010230204.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    266   2e-78    Brachypodium distachyon [annual false brome]
ref|XP_006431407.1|  hypothetical protein CICLE_v10000251mg             264   5e-78    Citrus clementina [clementine]
dbj|BAF01425.1|  putative chromomethylase                               263   8e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AAK69756.1|AF383170_1  chromomethylase CMT3                          263   9e-78    Arabidopsis thaliana [mouse-ear cress]
ref|NP_177135.1|  DNA (cytosine-5)-methyltransferase CMT3               263   1e-77    Arabidopsis thaliana [mouse-ear cress]
gb|EEC74798.1|  hypothetical protein OsI_10599                          268   1e-77    Oryza sativa Indica Group [Indian rice]
gb|AAN60988.1|  Putative DNA cytosine methyltransferase MET2a           268   2e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009781267.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    262   2e-77    Nicotiana sylvestris
gb|AAK71870.1|  chromomethylase 3                                       262   3e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011459545.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    260   6e-77    Fragaria vesca subsp. vesca
ref|XP_006300392.1|  hypothetical protein CARUB_v10019778mg             261   7e-77    
ref|XP_006470820.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    259   2e-76    
ref|XP_010091206.1|  DNA (cytosine-5)-methyltransferase 1               258   6e-76    Morus notabilis
ref|XP_010449422.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    258   8e-75    Camelina sativa [gold-of-pleasure]
ref|XP_002870005.1|  chromomethylase 2                                  258   8e-75    Arabidopsis lyrata subsp. lyrata
ref|NP_193637.2|  chromomethylase 2                                     258   9e-75    Arabidopsis thaliana [mouse-ear cress]
gb|AAK69757.1|AF383171_1  chromomethylase CMT2                          257   1e-74    Arabidopsis thaliana [mouse-ear cress]
emb|CBI26560.3|  unnamed protein product                                253   4e-74    Vitis vinifera
ref|XP_010662139.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    254   4e-74    Vitis vinifera
gb|AHB20162.1|  DNA methyltransferase                                   252   4e-74    Populus x canadensis [Canadian poplar]
ref|XP_008790945.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    254   4e-74    Phoenix dactylifera
ref|XP_003615347.1|  DNA (cytosine-5)-methyltransferase                 236   4e-74    
gb|AGT16212.1|  methyltransferase                                       250   3e-73    Saccharum hybrid cultivar R570
ref|XP_006282433.1|  hypothetical protein CARUB_v10003999mg             254   3e-73    
emb|CAN77846.1|  hypothetical protein VITISV_020830                     236   5e-73    Vitis vinifera
gb|EMT16647.1|  DNA (cytosine-5)-methyltransferase 2                    246   8e-73    
ref|XP_001769709.1|  predicted protein                                  247   1e-72    
ref|XP_009378159.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    234   1e-72    
gb|KJB25191.1|  hypothetical protein B456_004G180300                    251   2e-72    Gossypium raimondii
gb|KJB25190.1|  hypothetical protein B456_004G180300                    251   2e-72    Gossypium raimondii
ref|XP_002889276.1|  hypothetical protein ARALYDRAFT_895912             249   2e-72    
ref|XP_008238301.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    247   2e-72    
ref|XP_007210636.1|  hypothetical protein PRUPE_ppa019831mg             250   2e-72    
emb|CDX78915.1|  BnaA01g09820D                                          249   7e-72    
ref|XP_007040779.1|  DNA-methyltransferase CMT2                         250   1e-71    
ref|XP_009132470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    248   1e-71    Brassica rapa
ref|XP_009132479.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    248   1e-71    Brassica rapa
ref|XP_010671153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    245   3e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010908353.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    246   3e-71    Elaeis guineensis
ref|XP_006300613.1|  hypothetical protein CARUB_v10019805mg             244   4e-71    
emb|CDX99400.1|  BnaC01g11520D                                          246   6e-71    
gb|EYU22416.1|  hypothetical protein MIMGU_mgv1a001955mg                243   7e-71    Erythranthe guttata [common monkey flower]
gb|KFK28331.1|  chromomethylase                                         243   1e-70    Arabis alpina [alpine rockcress]
ref|XP_008346523.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    239   2e-70    
ref|XP_010429915.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    242   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010429914.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    242   3e-70    Camelina sativa [gold-of-pleasure]
gb|KDP46676.1|  hypothetical protein JCGZ_12200                         237   3e-70    Jatropha curcas
gb|AHB18565.1|  DNA methyltransferase CMT3                              224   4e-70    Brassica oleracea var. botrytis [cauliflower]
ref|XP_011028080.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    244   5e-70    Populus euphratica
ref|XP_008373678.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    239   5e-70    
gb|AHB20163.1|  DNA methyltransferase                                   240   7e-70    Populus x canadensis [Canadian poplar]
ref|XP_010518849.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    241   1e-69    Tarenaya hassleriana [spider flower]
ref|XP_011465073.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    239   2e-69    Fragaria vesca subsp. vesca
emb|CDP11756.1|  unnamed protein product                                240   2e-69    Coffea canephora [robusta coffee]
ref|XP_011465072.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    241   3e-69    Fragaria vesca subsp. vesca
ref|XP_004509555.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    241   3e-69    Cicer arietinum [garbanzo]
ref|XP_002519960.1|  protein with unknown function                      238   4e-69    
ref|XP_011465070.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    241   6e-69    Fragaria vesca subsp. vesca
ref|XP_010518846.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    242   6e-69    Tarenaya hassleriana [spider flower]
tpg|DAA36033.1|  TPA: hypothetical protein ZEAMMB73_314017              238   1e-68    
ref|XP_006471441.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    239   2e-68    
gb|KFK28574.1|  chromomethylase 2                                       239   2e-68    Arabis alpina [alpine rockcress]
ref|XP_006414021.1|  hypothetical protein EUTSA_v10024250mg             240   2e-68    
ref|XP_011092593.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    240   3e-68    Sesamum indicum [beniseed]
ref|NP_565245.1|  chromomethylase 1                                     236   4e-68    Arabidopsis thaliana [mouse-ear cress]
gb|AAB95485.1|  chromomethylase                                         236   4e-68    Arabidopsis thaliana [mouse-ear cress]
gb|AAC02663.1|  chromomethylase                                         236   4e-68    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH37020.1|  chromomethylase OsMET2b                                234   7e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009378155.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    233   9e-68    
emb|CBI37413.3|  unnamed protein product                                233   2e-67    Vitis vinifera
gb|AAB95486.1|  chromomethylase                                         234   2e-67    Arabidopsis arenosa
gb|KHF98017.1|  DNA (cytosine-5)-methyltransferase CMT3 -like pro...    218   2e-67    Gossypium arboreum [tree cotton]
ref|XP_006599217.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    234   2e-67    
ref|XP_002886525.1|  predicted protein                                  233   3e-67    
gb|KHN10109.1|  DNA (cytosine-5)-methyltransferase CMT2                 234   6e-67    Glycine soja [wild soybean]
ref|XP_006599216.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    234   8e-67    
ref|XP_006599215.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    234   1e-66    Glycine max [soybeans]
gb|KDO42579.1|  hypothetical protein CISIN_1g0039741mg                  223   1e-66    Citrus sinensis [apfelsine]
ref|XP_010665041.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    235   2e-66    Vitis vinifera
ref|XP_010665031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    235   2e-66    Vitis vinifera
ref|XP_010665035.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    235   2e-66    Vitis vinifera
ref|XP_006432633.1|  hypothetical protein CICLE_v100004872mg            214   1e-65    
ref|XP_011075808.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    229   3e-65    Sesamum indicum [beniseed]
ref|XP_011075807.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    229   4e-65    Sesamum indicum [beniseed]
ref|XP_007156278.1|  hypothetical protein PHAVU_003G273100g             229   4e-65    Phaseolus vulgaris [French bean]
ref|XP_009392768.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    230   4e-65    
ref|XP_009392766.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    230   4e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008448611.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    229   4e-65    Cucumis melo [Oriental melon]
ref|XP_008448610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    230   1e-64    Cucumis melo [Oriental melon]
ref|XP_010677407.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    226   1e-64    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB25184.1|  hypothetical protein B456_004G180200                    228   1e-64    Gossypium raimondii
gb|KEH20304.1|  DNA (cytosine-5)-methyltransferase                      228   1e-64    Medicago truncatula
ref|XP_010677408.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    226   2e-64    
ref|XP_010677406.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    228   2e-64    Beta vulgaris subsp. vulgaris [field beet]
gb|KGN55702.1|  hypothetical protein Csa_3G006640                       229   2e-64    Cucumis sativus [cucumbers]
ref|XP_004146191.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    229   3e-64    
ref|NP_001054957.2|  Os05g0224800                                       213   2e-63    
ref|XP_006655109.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    226   3e-63    Oryza brachyantha
ref|XP_010324482.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    224   3e-63    Solanum lycopersicum
gb|AEP33250.1|  CMT-type DNA-methyltransferase                          223   3e-63    Posidonia oceanica
ref|XP_006361281.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    224   3e-63    Solanum tuberosum [potatoes]
ref|XP_011465071.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    224   5e-63    Fragaria vesca subsp. vesca
ref|XP_009785637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    221   1e-62    Nicotiana sylvestris
ref|XP_009625195.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    218   2e-61    Nicotiana tomentosiformis
gb|EPS64010.1|  cytosine-specific methyltransferase                     210   2e-61    Genlisea aurea
gb|EYU23276.1|  hypothetical protein MIMGU_mgv1a002680mg                216   3e-61    Erythranthe guttata [common monkey flower]
gb|EMT30784.1|  DNA (cytosine-5)-methyltransferase 1                    216   4e-61    
gb|AAC02670.1|  chromomethylase                                         213   6e-60    Arabidopsis suecica
gb|AAC02662.1|  chromomethylase                                         213   6e-60    Arabidopsis thaliana [mouse-ear cress]
gb|EEE62800.1|  hypothetical protein OsJ_17603                          214   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439474.1|  hypothetical protein SORBIDRAFT_09g007390          215   2e-59    
ref|XP_010054093.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    214   3e-59    
ref|XP_010054090.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    214   3e-59    Eucalyptus grandis [rose gum]
gb|EEC78738.1|  hypothetical protein OsI_18945                          214   4e-59    Oryza sativa Indica Group [Indian rice]
gb|EMT27177.1|  DNA (cytosine-5)-methyltransferase 1                    209   5e-59    
ref|XP_010243148.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    212   2e-58    Nelumbo nucifera [Indian lotus]
gb|EYU45367.1|  hypothetical protein MIMGU_mgv1a020188mg                209   2e-58    Erythranthe guttata [common monkey flower]
emb|CAN68025.1|  hypothetical protein VITISV_014485                     195   4e-58    Vitis vinifera
ref|XP_004960649.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    211   4e-58    Setaria italica
gb|AFU50364.1|  CMT3                                                    195   8e-58    Nicotiana benthamiana
ref|XP_004960650.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    210   1e-57    Setaria italica
dbj|BAH37021.1|  chromomethylase OsMET2c                                206   2e-57    Oryza sativa Japonica Group [Japonica rice]
emb|CAJ01709.1|  chromomethylase 2                                      191   2e-56    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55852.1|  DNA (cytosine-5)-methyltransferase CMT2                 194   1e-54    Triticum urartu
gb|EMS48088.1|  DNA (cytosine-5)-methyltransferase 1                    197   3e-54    Triticum urartu
dbj|BAE99970.1|  chromomethylase                                        183   8e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373520.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    193   8e-52    
gb|EMT28418.1|  DNA (cytosine-5)-methyltransferase 1                    192   3e-51    
gb|AAL75760.1|  Putative chromomethylase                                174   9e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110416.1|  DNA (cytosine-5)-methyltransferase CMT2            185   7e-49    
gb|EMT20605.1|  DNA (cytosine-5)-methyltransferase 2                    172   1e-47    
ref|XP_009378160.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    159   1e-44    Pyrus x bretschneideri [bai li]
ref|XP_007014770.1|  Chromomethylase 1, putative isoform 5              154   9e-39    
gb|AGD99091.1|  chromomethyltransferase 3                               135   1e-36    Quercus suber [cork oak]
emb|CAA16759.1|  putative protein                                       143   2e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028081.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    142   6e-34    Populus euphratica
ref|XP_005642980.1|  S-adenosyl-L-methionine-dependent methyltran...    135   5e-33    Coccomyxa subellipsoidea C-169
ref|XP_010518848.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    137   2e-32    Tarenaya hassleriana [spider flower]
gb|KJB16171.1|  hypothetical protein B456_002G216500                    135   3e-32    Gossypium raimondii
gb|KHG22889.1|  DNA (cytosine-5)-methyltransferase 1                    130   7e-32    Gossypium arboreum [tree cotton]
gb|AAA98912.1|  theoretical protein with similarity to Swiss-Prot...    133   7e-32    Arabidopsis thaliana [mouse-ear cress]
gb|ACO38710.1|  chromomethylase-like protein                            119   2e-30    Populus balsamifera [balsam poplar]
gb|KJB16172.1|  hypothetical protein B456_002G216500                    129   4e-30    Gossypium raimondii
ref|XP_007014771.1|  Chromomethylase 1, putative isoform 6              128   2e-29    
ref|XP_007014769.1|  Chromomethylase 1, putative isoform 4              127   3e-29    
gb|KJB16175.1|  hypothetical protein B456_002G216500                    127   3e-29    
gb|KJB16170.1|  hypothetical protein B456_002G216500                    125   1e-28    
gb|KJB16169.1|  hypothetical protein B456_002G216500                    125   1e-28    
ref|XP_006385691.1|  hypothetical protein POPTR_0003s09930g             114   8e-28    
gb|KDO36547.1|  hypothetical protein CISIN_1g034052mg                   110   2e-26    
ref|XP_001758167.1|  predicted protein                                  112   6e-24    
ref|XP_003628609.1|  DNA (cytosine-5)-methyltransferase                 102   4e-23    
ref|XP_007152468.1|  hypothetical protein PHAVU_004G133200g             109   5e-23    
gb|KDP24228.1|  hypothetical protein JCGZ_25885                         107   3e-22    
ref|XP_002963688.1|  hypothetical protein SELMODRAFT_80009              107   4e-22    
ref|XP_002974777.1|  hypothetical protein SELMODRAFT_232368             107   4e-22    
ref|XP_006847211.1|  hypothetical protein AMTR_s00017p00254260          106   8e-22    
ref|XP_002466290.1|  hypothetical protein SORBIDRAFT_01g005082        99.8    1e-21    
ref|XP_008464733.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    105   2e-21    
ref|XP_004159609.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    103   2e-21    
ref|XP_009408799.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    104   3e-21    
ref|XP_004149137.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    104   4e-21    
gb|KGN49566.1|  hypothetical protein Csa_5G002610                       103   5e-21    
ref|XP_009140404.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    103   5e-21    
dbj|BAF34636.1|  DNA methyltransferase 1b                               103   6e-21    
emb|CDY25647.1|  BnaA04g13390D                                          103   6e-21    
ref|XP_010417708.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    103   7e-21    
emb|CDX89531.1|  BnaC04g35500D                                          103   7e-21    
gb|AAL75761.1|  Putative DNA cytosine methyltransferase MET2a           102   9e-21    
gb|EMS57761.1|  DNA (cytosine-5)-methyltransferase 1B                   103   1e-20    
gb|KHN19261.1|  DNA (cytosine-5)-methyltransferase 1                    102   1e-20    
gb|EPS62932.1|  cytosine-specific methyltransferase                     102   1e-20    
emb|CAN71866.1|  hypothetical protein VITISV_027340                   99.4    1e-20    
ref|XP_002325288.2|  DNA (cytosine-5)-methyltransferase AthI fami...    102   1e-20    
ref|XP_009398383.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   1e-20    
ref|XP_009398381.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   1e-20    
ref|XP_001695492.1|  cytosine-C5 specific DNA methyltransferase         102   1e-20    
ref|XP_002868317.1|  hypothetical protein ARALYDRAFT_355413             102   1e-20    
ref|XP_006395090.1|  hypothetical protein EUTSA_v10003514mg             102   2e-20    
gb|KCW54103.1|  hypothetical protein EUGRSUZ_I000872                  97.1    2e-20    
gb|KDP42494.1|  hypothetical protein JCGZ_00291                       99.4    2e-20    
ref|XP_010999718.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   2e-20    
ref|XP_010999717.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   2e-20    
ref|XP_010999720.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   2e-20    
ref|XP_010999719.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   2e-20    
ref|XP_010429957.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   2e-20    
ref|XP_002432160.1|  DNA methyltransferase, putative                    102   2e-20    
ref|XP_011092241.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   2e-20    
ref|XP_002518029.1|  DNA (cytosine-5)-methyltransferase, putative       101   2e-20    
ref|XP_011005572.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
ref|XP_011005571.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
ref|XP_010445976.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    100   3e-20    
ref|XP_010688470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
gb|EMT23445.1|  DNA (cytosine-5)-methyltransferase 1B                   101   3e-20    
ref|XP_010274981.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
ref|XP_010274979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
gb|KHN30945.1|  DNA (cytosine-5)-methyltransferase 1                    101   3e-20    
ref|XP_010688471.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
ref|XP_010228267.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20    
gb|AAC49931.1|  cytosine-5 DNA methyltransferase                        101   4e-20    
ref|XP_010442374.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   4e-20    
ref|XP_010228268.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   4e-20    
gb|ACL52956.1|  unknown                                               97.8    4e-20    
ref|XP_010440260.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   4e-20    
ref|XP_004958992.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    5e-20    
ref|XP_010549723.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    100   6e-20    
ref|XP_002305346.1|  DNA (cytosine-5)-methyltransferase AthI fami...    100   7e-20    
gb|AGW52134.1|  DNA (cytosine-5)-methyltransferase                      100   7e-20    
gb|ACX83570.1|  DNA methyltransferase                                   100   7e-20    
gb|ABF99362.1|  expressed protein                                     97.1    9e-20    
gb|ACX83569.1|  DNA methyltransferase                                   100   9e-20    
ref|NP_001051569.1|  Os03g0798300                                     97.1    1e-19    
ref|XP_002459440.1|  hypothetical protein SORBIDRAFT_02g004680        99.8    1e-19    
ref|XP_005774311.1|  hypothetical protein EMIHUDRAFT_458278           99.4    1e-19    
ref|XP_010553725.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.8    1e-19    
ref|XP_010553726.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.8    1e-19    
ref|XP_010482195.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.8    1e-19    
ref|NP_001059052.1|  Os07g0182900                                     97.1    1e-19    
gb|AAC39355.1|  Met1-type cytosine DNA-methyltransferase              99.4    2e-19    
gb|KEH37716.1|  DNA (cytosine-5)-methyltransferase                    99.4    2e-19    
ref|XP_007048602.1|  DNA-methyltransferase family protein             99.4    2e-19    
ref|XP_006285091.1|  hypothetical protein CARUB_v10006424mg           99.4    2e-19    
ref|XP_004512642.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.4    2e-19    
ref|XP_004955676.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.0    2e-19    
ref|XP_005851422.1|  hypothetical protein CHLNCDRAFT_137705           99.0    2e-19    
gb|AES75971.2|  DNA (cytosine-5)-methyltransferase                    99.0    2e-19    
ref|XP_003619753.1|  DNA (cytosine-5)-methyltransferase               98.6    3e-19    
ref|XP_006279892.1|  hypothetical protein CARUB_v10025739mg           98.6    3e-19    
emb|CDX76884.1|  BnaC08g34700D                                        98.2    3e-19    
gb|KDO58789.1|  hypothetical protein CISIN_1g0004072mg                95.5    4e-19    
gb|AAF14882.1|AF138283_1  cytosine-5 methyltransferase                98.2    4e-19    
ref|NP_193150.1|  DNA methyltransferase 2                             98.2    4e-19    
ref|XP_010030294.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    4e-19    
gb|AAG15406.1|  cytosine-5 DNA methyltransferase MET1                 97.4    4e-19    
gb|AAC39356.1|  Met2-type cytosine DNA-methyltransferase              98.2    4e-19    
ref|XP_006657508.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  98.2    4e-19    
ref|NP_001190725.1|  DNA methyltransferase 2                          98.2    4e-19    
gb|KJB75604.1|  hypothetical protein B456_012G048000                  98.2    4e-19    
gb|KJB75605.1|  hypothetical protein B456_012G048000                  97.8    5e-19    
gb|KJB75603.1|  hypothetical protein B456_012G048000                  97.8    5e-19    
ref|XP_002527854.1|  DNA (cytosine-5)-methyltransferase, putative     97.8    5e-19    
emb|CBI27717.3|  unnamed protein product                              97.8    6e-19    
gb|EIE49614.1|  DNA-cytosine methyltransferase                        94.4    6e-19    
ref|XP_002267284.3|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    6e-19    
ref|WP_034453241.1|  DNA methyltransferase                            94.4    7e-19    
ref|XP_008652107.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19    
ref|XP_008652103.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19    
tpg|DAA59801.1|  TPA: cytosine-specific methyltransferase             97.4    7e-19    
ref|XP_008651842.1|  PREDICTED: DNA methyl transferase1 isoform X2    97.4    7e-19    
ref|XP_008652102.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19    
ref|XP_008652100.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19    
ref|XP_008652108.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19    
ref|XP_008651840.1|  PREDICTED: DNA methyl transferase1 isoform X1    97.4    7e-19    
ref|XP_006470998.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.7    7e-19    
gb|AAC16389.1|  putative cytosine-5 DNA methyltransferase             97.4    7e-19    
ref|XP_008652098.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19    
tpg|DAA59799.1|  TPA: cytosine-specific methyltransferase             97.4    8e-19    
ref|XP_008651844.1|  PREDICTED: DNA methyl transferase1 isoform X4    97.4    8e-19    
ref|XP_008652109.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    8e-19    
gb|KCW54050.1|  hypothetical protein EUGRSUZ_I00036                   97.1    8e-19    
ref|XP_008652099.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.1    8e-19    
ref|NP_001289530.1|  DNA (cytosine-5)-methyltransferase 1B-like       97.1    9e-19    
ref|NP_192638.1|  DNA (cytosine-5-)-methyltransferase                 97.1    9e-19    
gb|AAL77415.1|  putative cytosine-5 DNA methyltransferase             97.1    9e-19    
sp|Q7Y1I7.1|DNM1A_ORYSJ  RecName: Full=DNA (cytosine-5)-methyltra...  97.1    9e-19    
ref|XP_008652110.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.1    9e-19    
ref|XP_008651843.1|  PREDICTED: DNA methyl transferase1 isoform X3    97.1    9e-19    
ref|XP_008651845.1|  PREDICTED: DNA methyl transferase1 isoform X5    97.1    9e-19    
ref|XP_010027506.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.1    9e-19    
gb|EEC76339.1|  hypothetical protein OsI_13909                        97.1    9e-19    
ref|XP_002863965.1|  hypothetical protein ARALYDRAFT_331330           96.7    1e-18    
dbj|BAD30340.1|  putative DNA methyltransferase                       96.7    1e-18    
sp|B1Q3J6.1|DNM1B_ORYSJ  RecName: Full=DNA (cytosine-5)-methyltra...  96.7    1e-18    
ref|XP_002870372.1|  hypothetical protein ARALYDRAFT_355455           96.7    1e-18    
tpg|DAA01513.1|  TPA: putative cytosine-5 DNA methyltransferase       96.7    1e-18    
gb|EEC81621.1|  hypothetical protein OsI_25142                        96.7    1e-18    
dbj|BAG15930.1|  putative cytosine-5 DNA methyltransferase            96.7    1e-18    
gb|EEE66687.1|  hypothetical protein OsJ_23341                        96.7    1e-18    
gb|ACF83415.1|  unknown                                               90.5    1e-18    
gb|KHF99624.1|  DNA (cytosine-5)-methyltransferase 1B                 96.7    1e-18    
ref|XP_006296000.1|  hypothetical protein CARUB_v10025150mg           96.3    1e-18    
gb|EYU33310.1|  hypothetical protein MIMGU_mgv1a0001781mg             95.5    2e-18    
ref|XP_010095630.1|  DNA (cytosine-5)-methyltransferase 1             96.3    2e-18    
gb|KJB25192.1|  hypothetical protein B456_004G180300                  95.9    2e-18    
ref|XP_006339355.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  95.9    2e-18    
ref|NP_001234748.1|  DNA (cytosine-5)-methyltransferase               95.5    3e-18    
ref|XP_009627548.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  95.1    4e-18    
ref|NP_001275841.1|  DNA (cytosine-5)-methyltransferase 1-like        95.1    4e-18    
emb|CDO97647.1|  unnamed protein product                              94.7    4e-18    
gb|EMT25605.1|  DNA (cytosine-5)-methyltransferase 1A                 94.7    5e-18    
ref|XP_003693470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.3    5e-18    
ref|XP_008807008.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  94.7    5e-18    
ref|WP_040939192.1|  cytosine methyltransferase                       92.0    5e-18    
ref|XP_004986184.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  94.7    5e-18    
ref|XP_003605632.1|  DNA (cytosine-5)-methyltransferase               94.4    7e-18    
ref|NP_001105186.1|  DNA methyl transferase1                          94.4    7e-18    
emb|CDY49442.1|  BnaA09g42250D                                        94.4    7e-18    
ref|XP_006650735.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  94.4    8e-18    
dbj|BAA92852.1|  DNA (cytosine-5-)-methyltransferase                  93.6    1e-17    
ref|XP_005642969.1|  S-adenosyl-L-methionine-dependent methyltran...  92.0    1e-17    
ref|XP_009117317.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  93.6    1e-17    
dbj|BAF36443.1|  DNA methyltransferase type 1                         93.6    1e-17    
ref|XP_003398214.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  93.2    1e-17    
ref|NP_193097.1|  DNA (cytosine-5-)-methyltransferase family protein  93.2    2e-17    
gb|EMT32721.1|  DNA (cytosine-5)-methyltransferase 1A                 93.2    2e-17    
gb|KIY93940.1|  DNA (cytosine-5)-methyltransferase CMT3               91.3    2e-17    
ref|XP_006359979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.8    2e-17    
ref|XP_003702004.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.8    2e-17    
ref|XP_003489082.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.4    3e-17    
ref|WP_040929740.1|  cytosine methyltransferase                       89.7    3e-17    
gb|ACQ91178.1|  Met1-type cytosine DNA-methyltransferase              92.0    4e-17    
ref|XP_002949905.1|  maintenance DNA methyltransferase                92.0    4e-17    
ref|XP_002267200.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.0    4e-17    
gb|ABD64771.1|  Met1                                                  92.0    4e-17    
ref|XP_003559306.2|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.7    4e-17    
emb|CBI27718.3|  unnamed protein product                              91.7    4e-17    
ref|XP_004287724.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.7    4e-17    
gb|EFX80183.1|  hypothetical protein DAPPUDRAFT_346987                91.7    5e-17    
gb|KDQ16327.1|  hypothetical protein BOTBODRAFT_259970                89.0    6e-17    
ref|XP_011350631.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.3    6e-17    
ref|XP_011350635.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.3    6e-17    
dbj|BAF01962.1|  DNA (cytosine-5)-methyltransferase                   90.1    7e-17    
ref|WP_043150585.1|  DNA methyltransferase                            88.6    8e-17    
gb|KIM55034.1|  hypothetical protein SCLCIDRAFT_1221437               90.9    8e-17    
ref|XP_008805951.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  90.9    9e-17    
gb|ACB86652.1|  EagI methylase                                        88.6    9e-17    
gb|AAF06333.1|  DNA methyltransferase 1                               88.2    1e-16    
gb|ACQ91179.1|  Met1-type cytosine DNA-methyltransferase              90.1    2e-16    
gb|KFK37543.1|  dna methyltransferase 2                               90.1    2e-16    
ref|NP_445806.3|  DNA (cytosine-5)-methyltransferase 1                90.1    2e-16    
ref|XP_006562865.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  90.1    2e-16    
gb|EDL78341.1|  DNA (cytosine-5-)-methyltransferase 1, isoform CRA_c  90.1    2e-16    
ref|WP_041049479.1|  DNA methyltransferase                            87.4    2e-16    
ref|XP_010472460.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.7    2e-16    
ref|XP_002403217.1|  DNA (cytosine-5)-methyltransferase, putative     85.9    2e-16    
dbj|BAA37118.1|  DNA cytosine 5 methyltransferase                     89.7    2e-16    
gb|EDL78339.1|  DNA (cytosine-5-)-methyltransferase 1, isoform CRA_a  89.7    2e-16    
ref|NP_199727.1|  DNA (cytosine-5)-methyltransferase 1                89.7    2e-16    
emb|CDX85419.1|  BnaC07g27300D                                        89.4    2e-16    
ref|XP_008241935.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.7    2e-16    
ref|XP_011398388.1|  DNA (cytosine-5)-methyltransferase 1B            89.4    3e-16    
ref|XP_010936296.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.4    3e-16    
ref|WP_009724346.1|  hypothetical protein                             87.0    3e-16    
gb|ABW96888.1|  MET1-type DNA-methyltransferase                       89.4    3e-16    
ref|XP_006613898.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.4    3e-16    
ref|XP_006395050.1|  hypothetical protein EUTSA_v10005683mg           89.4    3e-16    
ref|XP_007488939.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.4    3e-16    
ref|WP_034388108.1|  DNA methyltransferase                            86.7    3e-16    
ref|WP_039408553.1|  cytosine methyltransferase                       86.7    4e-16    
ref|WP_016313953.1|  DNA (cytosine-5-)-methyltransferase              86.3    4e-16    
ref|WP_022695709.1|  DNA methyltransferase                            86.3    5e-16    
ref|XP_005654889.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    5e-16    
ref|XP_005654888.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    5e-16    
ref|XP_005654887.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    5e-16    
ref|XP_007203206.1|  hypothetical protein PRUPE_ppa000190mg           88.6    6e-16    
gb|EHB03719.1|  DNA (cytosine-5)-methyltransferase 1                  88.6    6e-16    
ref|XP_005654886.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.2    6e-16    
ref|XP_005654885.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.2    6e-16    
gb|KFK31662.1|  dna (cytosine-5)-methyltransferase                    88.2    6e-16    
ref|XP_010450186.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.2    6e-16    
ref|XP_002682263.1|  cytosine-5 DNA methyltransferase                 88.2    6e-16    
ref|XP_009029810.1|  hypothetical protein HELRODRAFT_116156           88.2    6e-16    
ref|XP_005031083.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...  88.2    7e-16    
ref|XP_004885978.1|  PREDICTED: DNA (cytosine-5)-methyltransferase 1  88.2    7e-16    
ref|XP_011257755.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.2    7e-16    
ref|XP_004865538.1|  PREDICTED: DNA (cytosine-5)-methyltransferase 1  88.2    7e-16    



>emb|CAQ18901.1| chromomethylase [Nicotiana sylvestris]
Length=308

 Score =   345 bits (884),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE+RD+M Y ++P S+FQ FIRLGRDG  G VL+DHRPLQLNDDDYQRVC IPK +G
Sbjct  91   VENNEQRDEMPYTNEPTSDFQHFIRLGRDGALGSVLYDHRPLQLNDDDYQRVCQIPKREG  150

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DNKV WDP+VERV L SGKPLVPDYAMSFVGG+S+KPF RLWWDETV
Sbjct  151  ANFRDLPGVRVRSDNKVEWDPDVERVKLPSGKPLVPDYAMSFVGGSSTKPFGRLWWDETV  210

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ I+HP Q+RVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  211  PTVVTRAEPHNQTIIHPQQNRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  270

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLA+A KG S  +P   LPE +
Sbjct  271  RALGYSLAMAMKGSSDGKPLMSLPENF  297



>ref|XP_004252840.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Solanum lycopersicum]
Length=933

 Score =   353 bits (905),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE RD+M Y D+P S+FQ FIR+GRDGL G VL+DHRPLQLN+DD+QRVC IPK KG
Sbjct  714  VENNEPRDEMPYTDEPKSDFQHFIRMGRDGLLGSVLYDHRPLQLNEDDHQRVCQIPKRKG  773

Query  627  ANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DNKV WDP+VERV L SGKPLVPDYAMSFVGG+SSKPF RLWWDETV
Sbjct  774  ANFRDLPGVRVRPDNKVEWDPDVERVKLPSGKPLVPDYAMSFVGGSSSKPFGRLWWDETV  833

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ I+HPLQDRVLTIRENARLQGFPDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  834  PTVVTRAEPHNQTIVHPLQDRVLTIRENARLQGFPDYYKLIGPIKERYMQVGNAVAVPVA  893

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLA++ KGLSG  P F LP+ +
Sbjct  894  RALGYSLAMSIKGLSGETPLFTLPKNF  920



>ref|NP_001289523.1| DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana sylvestris]
 emb|CDN40871.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score =   347 bits (890),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE+RD+M Y ++P S+FQ FIRLGRDG  G VL+DHRPLQLNDDDYQRVC IPK KG
Sbjct  684  VENNEQRDEMPYTNEPTSDFQHFIRLGRDGALGSVLYDHRPLQLNDDDYQRVCQIPKRKG  743

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DNKV WDP+VERV L SGKPLVPDYAMSFVGG+S+KPF RLWWDETV
Sbjct  744  ANFRDLPGVRVRSDNKVEWDPDVERVKLPSGKPLVPDYAMSFVGGSSTKPFGRLWWDETV  803

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ I+HP Q+RVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  804  PTVVTRAEPHNQTIIHPQQNRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  863

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLA+A KG S  +P   LPE +
Sbjct  864  RALGYSLAMAMKGSSDGKPLMSLPENF  890



>emb|CDN40870.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score =   347 bits (890),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE+RD+M Y ++P S+FQ FIRLGRDG  G VL+DHRPLQLNDDDYQRVC IPK KG
Sbjct  684  VENNEQRDEMPYTNEPTSDFQHFIRLGRDGALGSVLYDHRPLQLNDDDYQRVCQIPKRKG  743

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DNKV WDP+VERV L SGKPLVPDYAMSFVGG+S+KPF RLWWDETV
Sbjct  744  ANFRDLPGVRVRSDNKVEWDPDVERVKLPSGKPLVPDYAMSFVGGSSTKPFGRLWWDETV  803

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ I+HP Q+RVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  804  PTVVTRAEPHNQTIIHPQQNRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  863

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLA+A KG S  +P   LPE +
Sbjct  864  RALGYSLAMAMKGSSDGKPLMSLPENF  890



>gb|AGH70220.1| chromomethylase 3, partial [Nicotiana benthamiana]
Length=901

 Score =   345 bits (885),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE+RD+M Y ++P S+FQ FIRLGRDG  G VL+DHRPLQLNDDDYQRVC IPK KG
Sbjct  684  VENNEQRDEMIYTNEPKSDFQHFIRLGRDGALGSVLYDHRPLQLNDDDYQRVCQIPKRKG  743

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DNKV WDP+VERV L SGKPLVPDYAMSFVGG+S+KPF RLWWDETV
Sbjct  744  ANFRDLPGVRVRSDNKVEWDPDVERVKLPSGKPLVPDYAMSFVGGSSTKPFGRLWWDETV  803

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ I+HP Q+RVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  804  PTVVTRAEPHNQTIIHPHQNRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  863

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLA+A KG S  +P   LP+ +
Sbjct  864  RALGYSLAMAMKGSSEGKPLMSLPDNF  890



>ref|XP_009590684.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana 
tomentosiformis]
Length=903

 Score =   345 bits (884),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 166/207 (80%), Positives = 181/207 (87%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE+RD+M Y ++P S+FQ FIRLGRDG  G VL+DHRPLQLNDDDYQRVC IPK KG
Sbjct  686  VENNEQRDEMIYTNEPKSDFQHFIRLGRDGALGSVLYDHRPLQLNDDDYQRVCQIPKRKG  745

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DNKV WDP+VERV L SGKPLVPDYAMSFVGG+S+KPF RLWWDETV
Sbjct  746  ANFRDLPGVRVRSDNKVEWDPDVERVKLPSGKPLVPDYAMSFVGGSSTKPFGRLWWDETV  805

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ I+HP Q+RVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  806  PTVVTRAEPHNQTIIHPHQNRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  865

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLA+A KG S  +P   LP+ +
Sbjct  866  RALGYSLAMAMKGSSEGKPLMSLPDNF  892



>ref|XP_011089105.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Sesamum indicum]
Length=859

 Score =   341 bits (874),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/217 (78%), Positives = 182/217 (84%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            VENNE+RD+M Y  +P +EFQ+FIRL RD +PG +          L DHRPL LN DDY+
Sbjct  629  VENNEERDEMPYDSEPQTEFQRFIRLRRDEMPGCLKVNSEVSEHCLFDHRPLLLNQDDYE  688

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGVRV  DNKV WDP+VER+ L+SGKPLVPDYAMSFVGG+SSKP
Sbjct  689  RVCQIPKRKGANFRDLPGVRVRADNKVEWDPDVERIRLTSGKPLVPDYAMSFVGGSSSKP  748

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKL GPIKERYIQ
Sbjct  749  FGRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLVGPIKERYIQ  808

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALGYSLALA +GLSG  P   LPE Y
Sbjct  809  VGNAVAVPVARALGYSLALALRGLSGDGPLLTLPEDY  845



>ref|XP_007208072.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
 gb|EMJ09271.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
Length=782

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 187/228 (82%), Gaps = 9/228 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            VEN+E RD+M Y   P +EFQ+FIRL ++ L G          L+DHRPL+LN DDY RV
Sbjct  552  VENSENRDEMPYAGPPQTEFQRFIRLSKEYLLGSSKDESLHKTLYDHRPLELNADDYARV  611

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C IPK KGANFRDLPGVRV VDNKV WDP+VERVYL SGKPLVPDYAMSFV G+SSKPF 
Sbjct  612  CEIPKRKGANFRDLPGVRVRVDNKVEWDPDVERVYLKSGKPLVPDYAMSFVKGSSSKPFA  671

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQAILHP+QDRVL+IRENARLQGFPDYYKLCGP+KERYIQVG
Sbjct  672  RLWWDETVPTVVTRAEPHNQAILHPVQDRVLSIRENARLQGFPDYYKLCGPVKERYIQVG  731

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            NAVAVPVARALGY+L LA KG +G++P F LPE +  I   +  +++E
Sbjct  732  NAVAVPVARALGYALGLALKGSAGVDPVFPLPEKFPNIQCQIHSASSE  779



>ref|XP_008226363.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Prunus mume]
Length=869

 Score =   335 bits (858),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 186/228 (82%), Gaps = 9/228 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            VEN+E RD+M +   P +EFQ+FIRL ++ L G          L+DHRPL+LN DDY RV
Sbjct  639  VENSENRDEMPFAGPPQTEFQRFIRLSKEYLLGSSKDESLHKTLYDHRPLELNADDYARV  698

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C IPK KGANFRDLPGVRV  DNKV WDP+VERVYL SGKPLVPDYAMSFV G+SSKPF 
Sbjct  699  CEIPKRKGANFRDLPGVRVRADNKVEWDPDVERVYLKSGKPLVPDYAMSFVKGSSSKPFA  758

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQAILHP+QDRVL+IRENARLQGFPDYYKLCGP+KERYIQVG
Sbjct  759  RLWWDETVPTVVTRAEPHNQAILHPVQDRVLSIRENARLQGFPDYYKLCGPVKERYIQVG  818

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            NAVAVPVARALGY+L LA KG +G++P F LPE +  I   +  +++E
Sbjct  819  NAVAVPVARALGYALGLALKGSAGVDPVFPLPEKFPNIQCQIHSASSE  866



>ref|XP_010316153.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X2 [Solanum 
lycopersicum]
Length=744

 Score =   330 bits (845),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE RD+M Y+D+P S FQ+FIR  RDG  G VL+DHRPLQLN+DDYQRV  IPK KG
Sbjct  522  VENNEPRDEMPYIDEPKSVFQRFIRSRRDGTLGTVLYDHRPLQLNEDDYQRVTQIPKQKG  581

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DN V WDP++ERV L SGKPLVPDYAM+FV GTS KPF RLWWDE V
Sbjct  582  ANFRDLPGVRVRADNVVEWDPDMERVKLPSGKPLVPDYAMTFVRGTSQKPFGRLWWDEIV  641

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
             TVVTRAEPHNQAILHP+QDRVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  642  STVVTRAEPHNQAILHPVQDRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  701

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA KGLS  +P   LP  +
Sbjct  702  RALGYSLALALKGLSRDQPLLTLPPNF  728



>gb|EYU39242.1| hypothetical protein MIMGU_mgv1a001319mg [Erythranthe guttata]
Length=841

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 181/217 (83%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVL----------HDHRPLQLNDDDYQ  658
            V+N+E RD+  Y  +P SEFQ+FIRL RD +PG +L          +DHRPLQLN DDY+
Sbjct  611  VDNDESRDERPYDLQPQSEFQRFIRLRRDEMPGSLLFNLEVVKHDLYDHRPLQLNQDDYE  670

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGVRV  DNKV WDP+VER  ++SGKPLVPDYAM+FV GTSSKP
Sbjct  671  RVCRIPKKKGANFRDLPGVRVRADNKVEWDPDVEREKVTSGKPLVPDYAMTFVRGTSSKP  730

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWD+TVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKL GPIKERYIQ
Sbjct  731  FGRLWWDQTVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLLGPIKERYIQ  790

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALG+SLALA +GLSG EP   LPE Y
Sbjct  791  VGNAVAVPVARALGFSLALALRGLSGNEPLLTLPEDY  827



>gb|ACX83573.1| DNA chromomethylase [Hieracium piloselloides]
Length=607

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 176/214 (82%), Gaps = 11/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            V N+E RD+M Y +KP +EFQ+FI L +  +PG V          L+DHRPL+LNDDDYQ
Sbjct  375  VPNDEARDEMPYGEKPKTEFQKFISLKKTDMPGFVGSGQDASDHLLYDHRPLKLNDDDYQ  434

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDL GVRV  DN V WDP+V+RVY+ SGKPLVPDYAM+FVGG S KP
Sbjct  435  RVCQIPKKKGANFRDLKGVRVKADNHVEWDPDVDRVYIPSGKPLVPDYAMTFVGGRSEKP  494

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWD+TVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKL GPIKERYIQ
Sbjct  495  FGRLWWDDTVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLLGPIKERYIQ  554

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            VGNAVAVPVARALGYSLA++  G +G EP F LP
Sbjct  555  VGNAVAVPVARALGYSLAMSCNGNAGTEPVFSLP  588



>ref|XP_004228597.2| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X1 [Solanum 
lycopersicum]
Length=855

 Score =   331 bits (848),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE RD+M Y+D+P S FQ+FIR  RDG  G VL+DHRPLQLN+DDYQRV  IPK KG
Sbjct  633  VENNEPRDEMPYIDEPKSVFQRFIRSRRDGTLGTVLYDHRPLQLNEDDYQRVTQIPKQKG  692

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DN V WDP++ERV L SGKPLVPDYAM+FV GTS KPF RLWWDE V
Sbjct  693  ANFRDLPGVRVRADNVVEWDPDMERVKLPSGKPLVPDYAMTFVRGTSQKPFGRLWWDEIV  752

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
             TVVTRAEPHNQAILHP+QDRVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  753  STVVTRAEPHNQAILHPVQDRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  812

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA KGLS  +P   LP  +
Sbjct  813  RALGYSLALALKGLSRDQPLLTLPPNF  839



>emb|CDP13153.1| unnamed protein product [Coffea canephora]
Length=887

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 177/217 (82%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            VEN+E RD+M Y     +EFQ FIRL +D +PG +          L+DHRPLQLN DDY 
Sbjct  659  VENDEPRDEMPYGGASKTEFQNFIRLRKDEMPGSLGFGLEVAPHLLYDHRPLQLNRDDYS  718

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGVRV  DNKV WDP++ERVYL SGKPLVPDYAM+FVGG+S KP
Sbjct  719  RVCQIPKKKGANFRDLPGVRVRADNKVEWDPDIERVYLPSGKPLVPDYAMTFVGGSSCKP  778

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYYKL GPIKERYIQ
Sbjct  779  FGRLWWDETVPTVVTRAEPHNQTILHPKQDRVLTIRENARLQGFPDYYKLFGPIKERYIQ  838

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALG+SLALA KGLSG EP   LP+ +
Sbjct  839  VGNAVAVPVARALGFSLALALKGLSGDEPVLQLPKSF  875



>ref|XP_006354167.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Solanum 
tuberosum]
Length=854

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VENNE R++M Y D+P S+FQ+FIR  RDG  G VL+DHRPLQLN+DDYQRV  IPK KG
Sbjct  631  VENNEPRNEMPYTDEPKSDFQRFIRSRRDGTLGTVLYDHRPLQLNEDDYQRVSQIPKRKG  690

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  DN V WDP+VERV L+SGKPLVPDYAM+FV GTS KPF RLWWDE V
Sbjct  691  ANFRDLPGVRVRADNVVEWDPDVERVKLTSGKPLVPDYAMTFVRGTSQKPFGRLWWDEIV  750

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
             TVVTRAEPHNQAILHP+QDRVLTIRENARLQGFPDYYKL GPIKERYIQVGNAVAVPVA
Sbjct  751  STVVTRAEPHNQAILHPVQDRVLTIRENARLQGFPDYYKLTGPIKERYIQVGNAVAVPVA  810

Query  270  RALGYSLALAFKGLSGME-PTFGLPEGY  190
            RALGYSLALA KGLS  + P   LP  +
Sbjct  811  RALGYSLALALKGLSSRDLPLLTLPPNF  838



>ref|XP_004513046.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Cicer arietinum]
Length=864

 Score =   328 bits (842),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 183/229 (80%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            +ENNE+RDDMEY   P +EFQQFIRL ++ + GI         +LHDHR L+LN DDYQR
Sbjct  633  IENNERRDDMEYDKPPQTEFQQFIRLSKNEMLGISTEKKSSNSLLHDHRSLELNVDDYQR  692

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGA FRDLPGVRV  DNKV WDP V+RVYL SGKPLVPDYAMSFV G SSKPF
Sbjct  693  VCRIPKKKGACFRDLPGVRVRPDNKVEWDPKVKRVYLDSGKPLVPDYAMSFVHGGSSKPF  752

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAI+HP+QDRVL+IRENARLQGFPD+YKLCGP+KERYIQV
Sbjct  753  ARLWWDETVPTVVTRAEPHNQAIMHPMQDRVLSIRENARLQGFPDFYKLCGPVKERYIQV  812

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGYSL LAF+G     P + LP+ +  I   +   ++E
Sbjct  813  GNAVAVPVARALGYSLGLAFQGAVVEGPLYKLPDKFPMIRDRVSSVSSE  861



>ref|XP_004513047.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Cicer arietinum]
Length=863

 Score =   328 bits (842),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 183/229 (80%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            +ENNE+RDDMEY   P +EFQQFIRL ++ + GI         +LHDHR L+LN DDYQR
Sbjct  632  IENNERRDDMEYDKPPQTEFQQFIRLSKNEMLGISTEKKSSNSLLHDHRSLELNVDDYQR  691

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGA FRDLPGVRV  DNKV WDP V+RVYL SGKPLVPDYAMSFV G SSKPF
Sbjct  692  VCRIPKKKGACFRDLPGVRVRPDNKVEWDPKVKRVYLDSGKPLVPDYAMSFVHGGSSKPF  751

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAI+HP+QDRVL+IRENARLQGFPD+YKLCGP+KERYIQV
Sbjct  752  ARLWWDETVPTVVTRAEPHNQAIMHPMQDRVLSIRENARLQGFPDFYKLCGPVKERYIQV  811

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGYSL LAF+G     P + LP+ +  I   +   ++E
Sbjct  812  GNAVAVPVARALGYSLGLAFQGAVVEGPLYKLPDKFPMIRDRVSSVSSE  860



>gb|KDP44326.1| hypothetical protein JCGZ_19193 [Jatropha curcas]
Length=752

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 187/229 (82%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            +ENNE RD+M Y + P ++FQ+ IRL +D L            +L+DHRPL+LN+DDYQR
Sbjct  521  IENNEHRDEMPYGNDPITDFQRQIRLRKDELLDSSLKSKSSENLLYDHRPLELNNDDYQR  580

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             C IPK KGANFRDLPGVRV  DNKV WDP+V+RVYL SGKPLVPDYAM+FV G+SSKPF
Sbjct  581  ACRIPKKKGANFRDLPGVRVRPDNKVEWDPSVKRVYLKSGKPLVPDYAMTFVNGSSSKPF  640

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP+QDRVL++RENARLQGFPDYYKLCGPIKERYIQV
Sbjct  641  ARLWWDETVPTVVTRAEPHNQAILHPVQDRVLSVRENARLQGFPDYYKLCGPIKERYIQV  700

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPV+RALGY+L LAF+G +G +P F LP+ +  +   +  +++E
Sbjct  701  GNAVAVPVSRALGYALGLAFQGSAGNDPLFTLPKKFPNLTEQVSSASSE  749



>ref|NP_001275877.1| DNA (cytosine-5)-methyltransferase CMT3-like [Citrus sinensis]
 gb|AGU16982.1| CMT-type DNA-methyltransferase [Citrus sinensis]
Length=869

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 182/229 (79%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+N E RD++ Y  +P +EFQ FIRL +D + G          +L+DHRPL+LN DDYQR
Sbjct  639  VDNYESRDEIPYDREPETEFQCFIRLRKDEMMGSSSESKPREQMLYDHRPLELNKDDYQR  698

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGVRV  DNKV WDPNVER+YL SGKPLVP+YAMSF+ GTSSKPF
Sbjct  699  VCRVPKKKGANFRDFPGVRVRPDNKVEWDPNVERIYLESGKPLVPNYAMSFIDGTSSKPF  758

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP+QDRVLT+RENARLQGFPDYYKLCGPIKERYIQV
Sbjct  759  ARLWWDETVPTVVTRAEPHNQAILHPVQDRVLTVRENARLQGFPDYYKLCGPIKERYIQV  818

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPV+RALGY+L L  +G +  EP F LP G+  I   +   ++E
Sbjct  819  GNAVAVPVSRALGYALGLTMQGSTTNEPLFTLPRGFPNILDQVAPVSSE  867



>ref|XP_006445885.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
 gb|ESR59125.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
Length=869

 Score =   325 bits (833),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 178/219 (81%), Gaps = 10/219 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+N E RD++ Y  +P +EFQ FIRL +D + G          +L+DHRPL+LN DDYQR
Sbjct  639  VDNYESRDEIPYDREPETEFQCFIRLRKDEMMGSSSESKPREQMLYDHRPLELNKDDYQR  698

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGVRV  DNKV WDPNVER+YL SGKPLVP+YAMSF+ GTSSKPF
Sbjct  699  VCRVPKKKGANFRDFPGVRVRPDNKVEWDPNVERIYLESGKPLVPNYAMSFIDGTSSKPF  758

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP+QDRVLT+RENARLQGFPDYYKLCGPIKERYIQV
Sbjct  759  ARLWWDETVPTVVTRAEPHNQAILHPVQDRVLTVRENARLQGFPDYYKLCGPIKERYIQV  818

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEI  181
            GNAVAVPV+RALGY+L L  +G +  EP F LP G+  I
Sbjct  819  GNAVAVPVSRALGYALGLTMQGSTTNEPLFTLPRGFPNI  857



>gb|AFK45072.1| unknown [Lotus japonicus]
Length=219

 Score =   305 bits (782),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 169/206 (82%), Gaps = 9/206 (4%)
 Frame = -1

Query  780  MEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRVCHIPKAKGA  625
            M+Y + P +EFQ+FIRL ++ + GI         LHDHR L+LN DDYQRVC IPK KGA
Sbjct  1    MQYDEPPQTEFQKFIRLTKNEMLGISNQKRLKSTLHDHRSLELNVDDYQRVCRIPKKKGA  60

Query  624  NFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETVP  448
             FRDLPGVRV  DNKV WDP+V+R YL S KPLVP+YAMSFVGG SSKPF RLWWDETVP
Sbjct  61   CFRDLPGVRVGPDNKVEWDPDVQREYLESKKPLVPNYAMSFVGGKSSKPFARLWWDETVP  120

Query  447  TVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVAR  268
            TVVTRAEPHNQAI+HP QDRVL+IRENARLQGFPDYYKLCGP+K RYIQVGNAVAVPVAR
Sbjct  121  TVVTRAEPHNQAIIHPEQDRVLSIRENARLQGFPDYYKLCGPVKARYIQVGNAVAVPVAR  180

Query  267  ALGYSLALAFKGLSGMEPTFGLPEGY  190
            ALGY+L LAF+G++G  P   LP G+
Sbjct  181  ALGYTLGLAFQGVAGDGPLLNLPGGF  206



>ref|XP_007014767.1| Chromomethylase 3, putative isoform 2 [Theobroma cacao]
 gb|EOY32386.1| Chromomethylase 3, putative isoform 2 [Theobroma cacao]
Length=708

 Score =   319 bits (818),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 182/229 (79%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N E +D+M+Y   P +EFQ+FIRL ++ +PG          +L+DHRPL+LN DDYQR
Sbjct  477  VGNYEHQDEMDYDKDPQTEFQRFIRLRKEEMPGSSPKAKPAKHLLYDHRPLELNVDDYQR  536

Query  654  VCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGV V D NKV WDP+VERVYL SGKPLVPDYAMSF+GG+SSKPF
Sbjct  537  VCQIPKKKGANFRDLPGVLVRDDNKVEWDPSVERVYLKSGKPLVPDYAMSFIGGSSSKPF  596

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVL++RENARLQGFPDYYKL GP+KERYIQV
Sbjct  597  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLSVRENARLQGFPDYYKLFGPVKERYIQV  656

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LA++G+   EP   LP  +  I   +   ++E
Sbjct  657  GNAVAVPVARALGYALGLAYQGVPSDEPLMKLPPKFPNIIERISSESSE  705



>emb|CAQ18903.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18904.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18905.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18906.1| chromomethylase [Nicotiana sylvestris]
Length=741

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E +D+M Y+D+P S FQ FIR  RDG  G VL+DHRPL+LN+DDY+RVC IPK KG
Sbjct  521  VENDEPKDEMPYIDEPKSAFQHFIRSRRDGTLGSVLYDHRPLRLNEDDYERVCQIPKRKG  580

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  581  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  640

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQG PDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  641  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGLPDYYKLTGPIKERYMQVGNAVAVPVA  700

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA +GLSG +P   LP  +
Sbjct  701  RALGYSLALAMEGLSGEKPLLSLPPNF  727



>ref|XP_007014766.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
 gb|EOY32385.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
Length=930

 Score =   322 bits (825),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 182/229 (79%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N E +D+M+Y   P +EFQ+FIRL ++ +PG          +L+DHRPL+LN DDYQR
Sbjct  699  VGNYEHQDEMDYDKDPQTEFQRFIRLRKEEMPGSSPKAKPAKHLLYDHRPLELNVDDYQR  758

Query  654  VCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGV V D NKV WDP+VERVYL SGKPLVPDYAMSF+GG+SSKPF
Sbjct  759  VCQIPKKKGANFRDLPGVLVRDDNKVEWDPSVERVYLKSGKPLVPDYAMSFIGGSSSKPF  818

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVL++RENARLQGFPDYYKL GP+KERYIQV
Sbjct  819  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLSVRENARLQGFPDYYKLFGPVKERYIQV  878

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LA++G+   EP   LP  +  I   +   ++E
Sbjct  879  GNAVAVPVARALGYALGLAYQGVPSDEPLMKLPPKFPNIIERISSESSE  927



>ref|XP_007014768.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
 gb|EOY32387.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
Length=931

 Score =   322 bits (824),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 182/229 (79%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N E +D+M+Y   P +EFQ+FIRL ++ +PG          +L+DHRPL+LN DDYQR
Sbjct  700  VGNYEHQDEMDYDKDPQTEFQRFIRLRKEEMPGSSPKAKPAKHLLYDHRPLELNVDDYQR  759

Query  654  VCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGV V D NKV WDP+VERVYL SGKPLVPDYAMSF+GG+SSKPF
Sbjct  760  VCQIPKKKGANFRDLPGVLVRDDNKVEWDPSVERVYLKSGKPLVPDYAMSFIGGSSSKPF  819

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVL++RENARLQGFPDYYKL GP+KERYIQV
Sbjct  820  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLSVRENARLQGFPDYYKLFGPVKERYIQV  879

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LA++G+   EP   LP  +  I   +   ++E
Sbjct  880  GNAVAVPVARALGYALGLAYQGVPSDEPLMKLPPKFPNIIERISSESSE  928



>ref|XP_007152976.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24970.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=658

 Score =   315 bits (807),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 181/231 (78%), Gaps = 12/231 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+N+E+RD+MEY     +EFQQFIR  +  + GI         +L+DHRPL+LN DDYQR
Sbjct  419  VQNSERRDEMEYCKPAETEFQQFIRSSKSEMLGIQSRIKSSKALLYDHRPLELNADDYQR  478

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IP+ KG  FRDLPGVRV  DNKV WDP++ERVYL SGKPLVPDYAMSFV GTSSKPF
Sbjct  479  VCRIPQKKGGCFRDLPGVRVGNDNKVEWDPDMERVYLDSGKPLVPDYAMSFVNGTSSKPF  538

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVLTIRENARLQGFPD+YKL GP+KERYIQV
Sbjct  539  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLTIRENARLQGFPDFYKLSGPVKERYIQV  598

Query  297  GNAVAVPVARALGYSLALAFKGLSGME--PTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LAF+G +     P + LP+ +  I   +   ++E
Sbjct  599  GNAVAVPVARALGYTLGLAFQGSTSSTDGPLYKLPDKFPMIRERVSSVSSE  649



>gb|KHN40382.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=705

 Score =   316 bits (809),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 183/231 (79%), Gaps = 12/231 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+NNE+RD+++Y     +EFQ+FIRL +  +  +         +L+DHRPL+LN DDYQR
Sbjct  472  VQNNERRDEIKYDKAAQTEFQRFIRLSKHEMLELQSRTKSSKSLLYDHRPLELNADDYQR  531

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KG  FRDLPGVRV  DNKV WDP+VERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  532  VCRIPKKKGGCFRDLPGVRVGADNKVEWDPDVERVYLDSGKPLVPDYAMTFVNGTSSKPF  591

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVLTIRENARLQGFPD+YKLCGP+KERYIQV
Sbjct  592  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLTIRENARLQGFPDFYKLCGPVKERYIQV  651

Query  297  GNAVAVPVARALGYSLALAFKGLSGM--EPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LAF+G +    +P + LP+ +  I   +   ++E
Sbjct  652  GNAVAVPVARALGYTLGLAFEGSTSTSDDPLYKLPDKFPMIRDRVSSVSSE  702



>gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum]
Length=824

 Score =   318 bits (816),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 183/231 (79%), Gaps = 12/231 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E +D+M+Y  +P +EFQ+FIRL R+ +PG           +L+DHRPLQLN DDYQ
Sbjct  591  VGNYEDKDEMDYEKEPKTEFQRFIRLRREEMPGFSSLNAKPTKHLLYDHRPLQLNTDDYQ  650

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC +PK KGANFRD PGV V   NKV WDPNVERVYL SGKPLVPDYAMSFVGG+SSKP
Sbjct  651  RVCRVPKRKGANFRDFPGVIVNSGNKVEWDPNVERVYLESGKPLVPDYAMSFVGGSSSKP  710

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQAILHP+QDRVL+IRENARLQGFPDYYKL GP+KERYIQ
Sbjct  711  FARLWWDETVPTVVTRAEPHNQAILHPVQDRVLSIRENARLQGFPDYYKLFGPVKERYIQ  770

Query  300  VGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGYGEIAATLVESAAE  151
            VGNAVAVPV+RALGY+L LA++G +S  EP   LP  +  I+      +++
Sbjct  771  VGNAVAVPVSRALGYALGLAYQGVVSNDEPLTKLPPRFPNISEKASSDSSQ  821



>ref|XP_009781266.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X3 [Nicotiana sylvestris]
Length=871

 Score =   319 bits (818),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E +D+M Y+D+P S FQ FIR  RDG  G VL+DHRPL+LN+DDY+RVC IPK KG
Sbjct  651  VENDEPKDEMPYIDEPKSAFQHFIRSRRDGTLGSVLYDHRPLRLNEDDYERVCQIPKRKG  710

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  711  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  770

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQG PDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  771  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGLPDYYKLTGPIKERYMQVGNAVAVPVA  830

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA +GLSG +P   LP  +
Sbjct  831  RALGYSLALAMEGLSGEKPLLSLPPNF  857



>ref|XP_011037978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X1 
[Populus euphratica]
Length=966

 Score =   321 bits (823),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP-GIVLHDHRPLQLNDDDYQRVCHIPKAK  631
            V N+EKRD+M Y   P +EFQ+ IRL + GL    +L DHRPL+LNDDDYQRVC IPK K
Sbjct  744  VANDEKRDEMPYGVSPKTEFQRMIRLKKMGLELNDLLFDHRPLELNDDDYQRVCQIPKRK  803

Query  630  GANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDET  454
            G NFRDLPGVRV  D KV WDP V R YLSSGKPLVPDYAM+FV G+SSKPF RLWWDET
Sbjct  804  GGNFRDLPGVRVRPDKKVEWDPEVPRQYLSSGKPLVPDYAMTFVNGSSSKPFARLWWDET  863

Query  453  VPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPV  274
            VPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGFPDYY+L GPIKERYIQVGNAVAVPV
Sbjct  864  VPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDYYQLWGPIKERYIQVGNAVAVPV  923

Query  273  ARALGYSLALAFKGLSGMEPTFGLPEGYGEIA  178
            ARALGY+L  AF+G +G +P F LP+ +  I 
Sbjct  924  ARALGYALGRAFQGFAGDDPVFSLPKKFPRIT  955



>gb|EPS58007.1| chromomethylase, partial [Genlisea aurea]
Length=515

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 177/217 (82%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            V+N+E+RD+M Y  +P ++FQ FIRL ++ +PG +          L+DHRPL LN+DDY+
Sbjct  295  VDNDEERDEMRYGCEPKTQFQHFIRLRKEEMPGSMNFSRVSSVSTLYDHRPLCLNNDDYE  354

Query  657  RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK K  NFRDLPGVRV  DN+V WDP+VERV L+SGKPLVPDYAM+FVGGTS KP
Sbjct  355  RVCRIPKKKATNFRDLPGVRVRPDNRVEWDPDVERVKLTSGKPLVPDYAMTFVGGTSQKP  414

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE VPTVVTRAEPHNQAILHP Q+RVLTIRENARLQGFPD+YKL GP+KERYIQ
Sbjct  415  FGRLWWDEIVPTVVTRAEPHNQAILHPDQNRVLTIRENARLQGFPDHYKLVGPVKERYIQ  474

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALGY+LA A +GLSG  P   LPE +
Sbjct  475  VGNAVAVPVARALGYALASAARGLSGDGPLLTLPEDF  511



>ref|XP_011037979.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X2 
[Populus euphratica]
Length=951

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 174/212 (82%), Gaps = 2/212 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP-GIVLHDHRPLQLNDDDYQRVCHIPKAK  631
            V N+EKRD+M Y   P +EFQ+ IRL + GL    +L DHRPL+LNDDDYQRVC IPK K
Sbjct  729  VANDEKRDEMPYGVSPKTEFQRMIRLKKMGLELNDLLFDHRPLELNDDDYQRVCQIPKRK  788

Query  630  GANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDET  454
            G NFRDLPGVRV  D KV WDP V R YLSSGKPLVPDYAM+FV G+SSKPF RLWWDET
Sbjct  789  GGNFRDLPGVRVRPDKKVEWDPEVPRQYLSSGKPLVPDYAMTFVNGSSSKPFARLWWDET  848

Query  453  VPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPV  274
            VPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGFPDYY+L GPIKERYIQVGNAVAVPV
Sbjct  849  VPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDYYQLWGPIKERYIQVGNAVAVPV  908

Query  273  ARALGYSLALAFKGLSGMEPTFGLPEGYGEIA  178
            ARALGY+L  AF+G +G +P F LP+ +  I 
Sbjct  909  ARALGYALGRAFQGFAGDDPVFSLPKKFPRIT  940



>ref|XP_009781265.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Nicotiana sylvestris]
Length=907

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E +D+M Y+D+P S FQ FIR  RDG  G VL+DHRPL+LN+DDY+RVC IPK KG
Sbjct  687  VENDEPKDEMPYIDEPKSAFQHFIRSRRDGTLGSVLYDHRPLRLNEDDYERVCQIPKRKG  746

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  747  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  806

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQG PDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  807  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGLPDYYKLTGPIKERYMQVGNAVAVPVA  866

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA +GLSG +P   LP  +
Sbjct  867  RALGYSLALAMEGLSGEKPLLSLPPNF  893



>ref|XP_009625628.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=820

 Score =   318 bits (814),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E  D+M Y+D+P S FQ FIR  R+G  G VL+DHRPL+LN+DDYQRVC IPK KG
Sbjct  600  VENDEPTDEMPYIDEPKSAFQHFIRSRRNGTLGSVLYDHRPLRLNEDDYQRVCQIPKRKG  659

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  660  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  719

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  720  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGFPDYYKLTGPIKERYMQVGNAVAVPVA  779

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA +GLS  +P   LP  +
Sbjct  780  RALGYSLALALEGLSEEKPLLSLPHNF  806



>ref|XP_009781264.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana sylvestris]
Length=913

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E +D+M Y+D+P S FQ FIR  RDG  G VL+DHRPL+LN+DDY+RVC IPK KG
Sbjct  693  VENDEPKDEMPYIDEPKSAFQHFIRSRRDGTLGSVLYDHRPLRLNEDDYERVCQIPKRKG  752

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  753  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  812

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQG PDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  813  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGLPDYYKLTGPIKERYMQVGNAVAVPVA  872

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA +GLSG +P   LP  +
Sbjct  873  RALGYSLALAMEGLSGEKPLLSLPPNF  899



>ref|XP_009625627.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=856

 Score =   318 bits (815),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E  D+M Y+D+P S FQ FIR  R+G  G VL+DHRPL+LN+DDYQRVC IPK KG
Sbjct  636  VENDEPTDEMPYIDEPKSAFQHFIRSRRNGTLGSVLYDHRPLRLNEDDYQRVCQIPKRKG  695

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  696  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  755

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  756  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGFPDYYKLTGPIKERYMQVGNAVAVPVA  815

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            RALGYSLALA +GLS  +P   LP  +
Sbjct  816  RALGYSLALALEGLSEEKPLLSLPHNF  842



>gb|KJB07908.1| hypothetical protein B456_001G052000 [Gossypium raimondii]
Length=905

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 182/231 (79%), Gaps = 12/231 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E +D+M+Y   P +EFQ+FIRL R+ +PG           +L+DHRPLQLN DDYQ
Sbjct  672  VGNYEDKDEMDYDKDPKTEFQRFIRLRREEMPGFSSLNAKPTKHLLYDHRPLQLNTDDYQ  731

Query  657  RVCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC +PK KGANFRD PGV V   NKV WDPNVERVYL SGKPLVPDYAMSFVGG+SSKP
Sbjct  732  RVCRVPKRKGANFRDFPGVIVNSGNKVEWDPNVERVYLESGKPLVPDYAMSFVGGSSSKP  791

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQAILHP+QDRVL+IRENARLQGFPDYYKL GP+KERYIQ
Sbjct  792  FARLWWDETVPTVVTRAEPHNQAILHPVQDRVLSIRENARLQGFPDYYKLFGPVKERYIQ  851

Query  300  VGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGYGEIAATLVESAAE  151
            VGNAVAVPV+RALGY+L LA++G +S  EP   LP  +  I+      +++
Sbjct  852  VGNAVAVPVSRALGYALGLAYQGVVSNDEPLTKLPPRFPNISEKASSDSSQ  902



>gb|AFK80345.1| chromomethylase 3 [Nicotiana benthamiana]
Length=740

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E RD+M Y+D+P S FQ FIR  RDG  G VL+DHRPL+LN+DDY+RVC IPK KG
Sbjct  520  VENDEPRDEMPYIDEPKSAFQHFIRSRRDGALGSVLYDHRPLRLNEDDYERVCQIPKRKG  579

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  580  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  639

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  640  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGFPDYYKLTGPIKERYMQVGNAVAVPVA  699

Query  270  RALGYSLALAFKGLSG  223
            RALGYSLALA +GLSG
Sbjct  700  RALGYSLALALEGLSG  715



>ref|XP_006572936.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine 
max]
Length=875

 Score =   318 bits (814),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 183/231 (79%), Gaps = 12/231 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+NNE+RD+++Y     +EFQ+FIRL +  +  +         +L+DHRPL+LN DDYQR
Sbjct  642  VQNNERRDEIKYDKAAQTEFQRFIRLSKHEMLELQSRTKSSKSLLYDHRPLELNADDYQR  701

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KG  FRDLPGVRV  DNKV WDP+VERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  702  VCRIPKKKGGCFRDLPGVRVGADNKVEWDPDVERVYLDSGKPLVPDYAMTFVNGTSSKPF  761

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVLTIRENARLQGFPD+YKLCGP+KERYIQV
Sbjct  762  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLTIRENARLQGFPDFYKLCGPVKERYIQV  821

Query  297  GNAVAVPVARALGYSLALAFKGLSGM--EPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LAF+G +    +P + LP+ +  I   +   ++E
Sbjct  822  GNAVAVPVARALGYTLGLAFEGSTSTSDDPLYKLPDKFPMIRDRVSSVSSE  872



>ref|XP_009364101.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Pyrus x bretschneideri]
Length=945

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 180/228 (79%), Gaps = 9/228 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            VENNE+R++M Y   P +EFQ+ IRL ++ L G         VL+DHRPLQLN DDY RV
Sbjct  715  VENNEERNEMPYGGPPKTEFQRLIRLSKEYLMGTSRDKSLQKVLYDHRPLQLNPDDYARV  774

Query  651  CHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C +PK KGA FRD PGVRV  DNKV WDP V RVYL+SGKPLVPDYAMSFV G+SSKPF 
Sbjct  775  CEVPKRKGACFRDFPGVRVRGDNKVEWDPEVPRVYLASGKPLVPDYAMSFVKGSSSKPFA  834

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGFPD+Y+L GP+KERY+QVG
Sbjct  835  RLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDFYRLSGPVKERYMQVG  894

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            NAVAVPVARALGY+L LA +  +G +P F LPE +  I   +  +++E
Sbjct  895  NAVAVPVARALGYALGLALRRSAGADPVFILPESFPNIQDQVHSASSE  942



>ref|XP_008451103.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Cucumis melo]
Length=859

 Score =   316 bits (809),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 180/229 (79%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRD--------GLPGI-VLHDHRPLQLNDDDYQR  655
            VEN+E+RD+M Y + P +EFQ  IR  R+          P +  L+DHRPL+LN DDYQR
Sbjct  628  VENDERRDEMPYDEPPKTEFQHLIRSPREERFDSSTMSKPAMHPLYDHRPLELNTDDYQR  687

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGVRV  D +V WDP+V+RVYL SGKPLVPDYAMSFV G+SSKPF
Sbjct  688  VCQIPKRKGANFRDLPGVRVRPDKRVEWDPDVKRVYLESGKPLVPDYAMSFVNGSSSKPF  747

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAI HP QDRV+TIRENARLQGFPDYYKL GP+KERYIQV
Sbjct  748  ARLWWDETVPTVVTRAEPHNQAITHPEQDRVMTIRENARLQGFPDYYKLFGPVKERYIQV  807

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGYSL +AF+GL+G  P   LP+ +  I      +++E
Sbjct  808  GNAVAVPVARALGYSLGMAFQGLAGDAPVCSLPKKFPNILKRHSSASSE  856



>dbj|BAC53936.1| chromomethylase-like protein [Nicotiana tabacum]
Length=741

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 173/207 (84%), Gaps = 1/207 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VE++E  D+M Y+D+P S FQ FIR  R+G  G VL+DHRPL+LN+DDYQRVC IPK KG
Sbjct  521  VEHDEPTDEMPYIDEPKSAFQHFIRSRRNGTLGSVLYDHRPLRLNEDDYQRVCQIPKRKG  580

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  581  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  640

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYYKL GPIKERY+QVGNAVAVPVA
Sbjct  641  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGFPDYYKLTGPIKERYMQVGNAVAVPVA  700

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGY  190
            R LGYSLALA +GLS  +P   LP  +
Sbjct  701  RVLGYSLALALEGLSEEKPLLSLPPNF  727



>ref|XP_009376742.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Pyrus 
x bretschneideri]
Length=989

 Score =   318 bits (815),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 180/228 (79%), Gaps = 9/228 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            V NNE+RD+M Y   P +EFQ+ IRL ++ L G         VL+DHRPLQLN DDY RV
Sbjct  759  VANNEERDEMRYGVAPKTEFQRLIRLSKEYLMGTSKDNSIQNVLYDHRPLQLNADDYARV  818

Query  651  CHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C +PK KGA FRDLPGVRV  DNKV WDP V RVYL+SGKPL+PDYAMSFV G+SSKPF 
Sbjct  819  CEVPKRKGACFRDLPGVRVRGDNKVEWDPEVARVYLASGKPLIPDYAMSFVNGSSSKPFA  878

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGFPD+YKL GPIKERY+QVG
Sbjct  879  RLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDFYKLSGPIKERYMQVG  938

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            NAVAVPVARALGY+L LA KG +G +P F LP  +  +   +  +++E
Sbjct  939  NAVAVPVARALGYALGLALKGSAGADPLFILPANFPSLQDQVHSASSE  986



>ref|XP_007152975.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24969.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=877

 Score =   316 bits (809),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 181/231 (78%), Gaps = 12/231 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+N+E+RD+MEY     +EFQQFIR  +  + GI         +L+DHRPL+LN DDYQR
Sbjct  638  VQNSERRDEMEYCKPAETEFQQFIRSSKSEMLGIQSRIKSSKALLYDHRPLELNADDYQR  697

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IP+ KG  FRDLPGVRV  DNKV WDP++ERVYL SGKPLVPDYAMSFV GTSSKPF
Sbjct  698  VCRIPQKKGGCFRDLPGVRVGNDNKVEWDPDMERVYLDSGKPLVPDYAMSFVNGTSSKPF  757

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAILHP QDRVLTIRENARLQGFPD+YKL GP+KERYIQV
Sbjct  758  ARLWWDETVPTVVTRAEPHNQAILHPEQDRVLTIRENARLQGFPDFYKLSGPVKERYIQV  817

Query  297  GNAVAVPVARALGYSLALAFKGLSGME--PTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGY+L LAF+G +     P + LP+ +  I   +   ++E
Sbjct  818  GNAVAVPVARALGYTLGLAFQGSTSSTDGPLYKLPDKFPMIRERVSSVSSE  868



>ref|XP_002299134.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
 gb|EEE83939.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
Length=970

 Score =   317 bits (813),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 173/212 (82%), Gaps = 5/212 (2%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP-GIVLHDHRPLQLNDDDYQRVCHIPKAK  631
            V N+EKRD+M Y + P +EFQ+ IRL + GL    +L DHRPL+LNDDDY   C IPK K
Sbjct  751  VANDEKRDEMPYGESPKTEFQRMIRLKKMGLELNDLLFDHRPLELNDDDY---CQIPKRK  807

Query  630  GANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDET  454
            G NFRDLPGVRV  D KV WDP V R YLSSGKPLVPDYAM+FV G+SSKPF RLWWDET
Sbjct  808  GGNFRDLPGVRVRPDKKVEWDPEVPRQYLSSGKPLVPDYAMTFVNGSSSKPFARLWWDET  867

Query  453  VPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPV  274
            VPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGFPDYY+LCGPIKERYIQVGNAVAVPV
Sbjct  868  VPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDYYQLCGPIKERYIQVGNAVAVPV  927

Query  273  ARALGYSLALAFKGLSGMEPTFGLPEGYGEIA  178
            ARALGY+L  AF+G +G +P F LP+ +  I 
Sbjct  928  ARALGYALGRAFQGFAGDDPVFSLPKKFPRIT  959



>ref|XP_009364100.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Pyrus x bretschneideri]
Length=1023

 Score =   318 bits (815),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 180/228 (79%), Gaps = 9/228 (4%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
             VENNE+R++M Y   P +EFQ+ IRL ++ L G         VL+DHRPLQLN DDY RV
Sbjct  793   VENNEERNEMPYGGPPKTEFQRLIRLSKEYLMGTSRDKSLQKVLYDHRPLQLNPDDYARV  852

Query  651   CHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C +PK KGA FRD PGVRV  DNKV WDP V RVYL+SGKPLVPDYAMSFV G+SSKPF 
Sbjct  853   CEVPKRKGACFRDFPGVRVRGDNKVEWDPEVPRVYLASGKPLVPDYAMSFVKGSSSKPFA  912

Query  474   RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
             RLWWDETVPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGFPD+Y+L GP+KERY+QVG
Sbjct  913   RLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFPDFYRLSGPVKERYMQVG  972

Query  294   NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
             NAVAVPVARALGY+L LA +  +G +P F LPE +  I   +  +++E
Sbjct  973   NAVAVPVARALGYALGLALRRSAGADPVFILPESFPNIQDQVHSASSE  1020



>ref|XP_004170052.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like, partial 
[Cucumis sativus]
Length=753

 Score =   311 bits (798),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 177/229 (77%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV---------LHDHRPLQLNDDDYQR  655
            VEN+E+RD+M Y + P +EFQ  IR  R+ +             L+DHRPL+LN DDYQR
Sbjct  522  VENDERRDEMPYHEPPKTEFQHLIRSPREEMFDTSTMSKPATHPLYDHRPLELNTDDYQR  581

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDL GVRV  D +V WDP+V+RVYL SGKPLVPDYAMSFV G+SSKPF
Sbjct  582  VCQIPKRKGANFRDLSGVRVRPDKRVEWDPDVKRVYLESGKPLVPDYAMSFVNGSSSKPF  641

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAI HP QDRV+TIRENARLQGFPDYYKL GP+KERYIQV
Sbjct  642  ARLWWDETVPTVVTRAEPHNQAITHPEQDRVMTIRENARLQGFPDYYKLFGPVKERYIQV  701

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGYSL +AF+GL+G  P   LP+ +  I       ++E
Sbjct  702  GNAVAVPVARALGYSLGMAFQGLAGDTPVCSLPKRFPNILKRRSSKSSE  750



>ref|XP_004149031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Cucumis 
sativus]
 gb|KGN66422.1| hypothetical protein Csa_1G604080 [Cucumis sativus]
Length=855

 Score =   312 bits (800),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 177/229 (77%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV---------LHDHRPLQLNDDDYQR  655
            VEN+E+RD+M Y + P +EFQ  IR  R+ +             L+DHRPL+LN DDYQR
Sbjct  624  VENDERRDEMPYHEPPKTEFQHLIRSPREEMFDTSTMSKPATHPLYDHRPLELNTDDYQR  683

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDL GVRV  D +V WDP+V+RVYL SGKPLVPDYAMSFV G+SSKPF
Sbjct  684  VCQIPKRKGANFRDLSGVRVRPDKRVEWDPDVKRVYLESGKPLVPDYAMSFVNGSSSKPF  743

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQAI HP QDRV+TIRENARLQGFPDYYKL GP+KERYIQV
Sbjct  744  ARLWWDETVPTVVTRAEPHNQAITHPEQDRVMTIRENARLQGFPDYYKLFGPVKERYIQV  803

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAE  151
            GNAVAVPVARALGYSL +AF+GL+G  P   LP+ +  I       ++E
Sbjct  804  GNAVAVPVARALGYSLGMAFQGLAGDTPVCSLPKRFPNILKRRSSKSSE  852



>ref|XP_011462220.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=923

 Score =   312 bits (800),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 10/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP---------GIVLHDHRPLQLNDDDYQR  655
            VEN E RD+M Y   P +EFQ+FIRL +DGL            +L+DHRPL+LN DD++R
Sbjct  693  VENGEIRDEMPYGKLPQTEFQKFIRLSKDGLLENSKKNLSLNEILYDHRPLKLNVDDHER  752

Query  654  VCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VCH+PK KGANFR+LPGV V D N V+WDP +ERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  753  VCHVPKEKGANFRNLPGVLVGDYNIVYWDPTIERVYLESGKPLVPDYAMTFVRGTSSKPF  812

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
            RRLWWDE V TVVTRAEPHNQA+LHP+QDRVL++RENARLQGFPDYYKL GPIKERY+QV
Sbjct  813  RRLWWDEIVSTVVTRAEPHNQAVLHPVQDRVLSVRENARLQGFPDYYKLFGPIKERYMQV  872

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPE  196
            GNAVAVPV+RALGY+L LA+KGL+G +P   LP+
Sbjct  873  GNAVAVPVSRALGYTLGLAYKGLAGDDPLTELPK  906



>emb|CBI16477.3| unnamed protein product [Vitis vinifera]
Length=821

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 171/214 (80%), Gaps = 11/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            V N+E RD+M Y   P +EFQ+FIRL ++ + G            L+DHRPL+LN DDYQ
Sbjct  590  VTNDEARDEMPYGKAPQTEFQRFIRLRKNEMLGTSPSESNPSGNKLYDHRPLELNADDYQ  649

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DNKV WDPNVER+YL SGKPLVPDYAMSFVGG+SSKP
Sbjct  650  RVCQIPKTKGANFRDLPGVLVGADNKVEWDPNVERIYLPSGKPLVPDYAMSFVGGSSSKP  709

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQ ILHP QDRVL+IRENARLQGFPDYY+L GP+KERYIQ
Sbjct  710  FGRLWWDETVPTVVTRAEPHNQVILHPEQDRVLSIRENARLQGFPDYYQLRGPVKERYIQ  769

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            VGNAVAVPVARALGY+L LA +G     P F LP
Sbjct  770  VGNAVAVPVARALGYALGLAAQGSVSDGPMFILP  803



>ref|XP_008390169.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
Length=1077

 Score =   314 bits (804),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 173/215 (80%), Gaps = 9/215 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            V NNE+RD+M Y   P +EFQ+ IRL ++ L G         VL+DHRPLQLN DDY RV
Sbjct  717  VANNEERDEMPYGVAPKTEFQRLIRLSKEYLMGTSKDNSIQNVLYDHRPLQLNPDDYARV  776

Query  651  CHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C +PK KGA FRDLPGVRV  DNKV WDP V RVYL+SGKPL+PDYAMSFV G+SSKPF 
Sbjct  777  CEVPKRKGACFRDLPGVRVRGDNKVEWDPEVPRVYLASGKPLIPDYAMSFVNGSSSKPFA  836

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGF D+YKL GPIKERY+QVG
Sbjct  837  RLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFXDFYKLSGPIKERYMQVG  896

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            NAVAVPVARALGY+L LA KG +G +P F LP  +
Sbjct  897  NAVAVPVARALGYALGLALKGSAGADPLFXLPANF  931



>ref|NP_001280801.1| DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
 gb|AFV99136.1| CMT-type cytosine DNA-methyltransferase 3b [Malus domestica]
Length=1096

 Score =   314 bits (804),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 173/215 (80%), Gaps = 9/215 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            V NNE+RD+M Y   P +EFQ+ IRL ++ L G         VL+DHRPLQLN DDY RV
Sbjct  736  VANNEERDEMPYGVAPKTEFQRLIRLSKEYLMGTSKDNSIQNVLYDHRPLQLNPDDYARV  795

Query  651  CHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C +PK KGA FRDLPGVRV  DNKV WDP V RVYL+SGKPL+PDYAMSFV G+SSKPF 
Sbjct  796  CEVPKRKGACFRDLPGVRVRGDNKVEWDPEVPRVYLASGKPLIPDYAMSFVNGSSSKPFA  855

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQAI+HP QDRVLTIRENARLQGF D+YKL GPIKERY+QVG
Sbjct  856  RLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIRENARLQGFXDFYKLSGPIKERYMQVG  915

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            NAVAVPVARALGY+L LA KG +G +P F LP  +
Sbjct  916  NAVAVPVARALGYALGLALKGSAGADPLFXLPANF  950



>ref|XP_004288717.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=965

 Score =   312 bits (799),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 177/214 (83%), Gaps = 10/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP---------GIVLHDHRPLQLNDDDYQR  655
            VEN E RD+M Y   P +EFQ+FIRL +DGL            +L+DHRPL+LN DD++R
Sbjct  735  VENGEIRDEMPYGKLPQTEFQKFIRLSKDGLLENSKKNLSLNEILYDHRPLKLNVDDHER  794

Query  654  VCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VCH+PK KGANFR+LPGV V D N V+WDP +ERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  795  VCHVPKEKGANFRNLPGVLVGDYNIVYWDPTIERVYLESGKPLVPDYAMTFVRGTSSKPF  854

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
            RRLWWDE V TVVTRAEPHNQA+LHP+QDRVL++RENARLQGFPDYYKL GPIKERY+QV
Sbjct  855  RRLWWDEIVSTVVTRAEPHNQAVLHPVQDRVLSVRENARLQGFPDYYKLFGPIKERYMQV  914

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPE  196
            GNAVAVPV+RALGY+L LA+KGL+G +P   LP+
Sbjct  915  GNAVAVPVSRALGYTLGLAYKGLAGDDPLTELPK  948



>ref|XP_010651344.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Vitis vinifera]
Length=965

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 171/214 (80%), Gaps = 11/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            V N+E RD+M Y   P +EFQ+FIRL ++ + G            L+DHRPL+LN DDYQ
Sbjct  734  VTNDEARDEMPYGKAPQTEFQRFIRLRKNEMLGTSPSESNPSGNKLYDHRPLELNADDYQ  793

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DNKV WDPNVER+YL SGKPLVPDYAMSFVGG+SSKP
Sbjct  794  RVCQIPKTKGANFRDLPGVLVGADNKVEWDPNVERIYLPSGKPLVPDYAMSFVGGSSSKP  853

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQ ILHP QDRVL+IRENARLQGFPDYY+L GP+KERYIQ
Sbjct  854  FGRLWWDETVPTVVTRAEPHNQVILHPEQDRVLSIRENARLQGFPDYYQLRGPVKERYIQ  913

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            VGNAVAVPVARALGY+L LA +G     P F LP
Sbjct  914  VGNAVAVPVARALGYALGLAAQGSVSDGPMFILP  947



>ref|XP_010673524.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Beta vulgaris 
subsp. vulgaris]
Length=868

 Score =   307 bits (786),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 176/219 (80%), Gaps = 10/219 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV--------LHDHRPLQLNDDDYQRV  652
            V N+E+RD+++Y   P +EF++ IR+ +D + G +        L+DHRPL+LN DD+QRV
Sbjct  637  VTNSERRDEIQYSCSPNTEFERLIRMTKDAMSGSIVGPELLTTLYDHRPLELNIDDFQRV  696

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C IPK KGANFRDLPGVRV  DNKV WDP+V+RV L SGKPLVPDYAM+FVGG+SSKPF 
Sbjct  697  CQIPKKKGANFRDLPGVRVRSDNKVEWDPDVKRVLLPSGKPLVPDYAMTFVGGSSSKPFG  756

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQ + HPLQDRVLTIRENARLQGFPDYY+L GP+KERYIQVG
Sbjct  757  RLWWDETVPTVVTRAEPHNQVVCHPLQDRVLTIRENARLQGFPDYYQLKGPVKERYIQVG  816

Query  294  NAVAVPVARALGYSLALAFKGLSGM-EPTFGLPEGYGEI  181
            NAVAVPVARALGY+LA+A +G     EP   LP  +  I
Sbjct  817  NAVAVPVARALGYALAMACQGSCTYDEPLLTLPSKFPNI  855



>gb|KCW85898.1| hypothetical protein EUGRSUZ_B02615 [Eucalyptus grandis]
Length=655

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 168/214 (79%), Gaps = 10/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V  +  RD+M Y   P ++FQ+FIR     + GI         +L DHRPL+LN DDY+R
Sbjct  424  VGTHHGRDEMPYEKGPQTDFQRFIRSSAKEMMGITDNSVDSGRLLFDHRPLELNSDDYER  483

Query  654  VCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGVRV  DNKV WDP+V RVYL SGKPLVPDYAM+FV G+SSKPF
Sbjct  484  VCRIPKKKGANFRDLPGVRVRPDNKVEWDPDVTRVYLDSGKPLVPDYAMTFVNGSSSKPF  543

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             R+WWDETVPTVVTRAEPHNQAILHP QDRV T+RENARLQGFPDYYKL GPIKERYIQV
Sbjct  544  ARVWWDETVPTVVTRAEPHNQAILHPEQDRVFTVRENARLQGFPDYYKLTGPIKERYIQV  603

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPE  196
            GNAVAVPVARALG +LA AF+  +  +P F LP+
Sbjct  604  GNAVAVPVARALGCALAQAFQKSANEDPLFRLPD  637



>ref|XP_010243382.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Nelumbo nucifera]
Length=839

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 170/217 (78%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            V N E RD+M Y   P ++FQ++IRL R+ L             +L DH PLQLN+DDYQ
Sbjct  605  VTNFESRDEMPYSKAPKTDFQKYIRLSRNELGVFASRCQSSQKAMLFDHCPLQLNEDDYQ  664

Query  657  RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V WD +VERV+L SGKPLVPDYAMSFV GTS+KP
Sbjct  665  RVCRIPKKKGANFRDLPGVLVRPDNVVEWDKSVERVFLPSGKPLVPDYAMSFVRGTSTKP  724

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGF D+YKLCGP+KERYIQ
Sbjct  725  FGRLWWDETVPTVVTRAEPHNQIILHPEQDRVLTIRENARLQGFLDFYKLCGPVKERYIQ  784

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALGY+L LA++G+   EP   LP+ +
Sbjct  785  VGNAVAVPVARALGYALGLAYRGICDEEPLLVLPQKF  821



>ref|XP_010243384.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nelumbo nucifera]
Length=838

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 170/217 (78%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            V N E RD+M Y   P ++FQ++IRL R+ L             +L DH PLQLN+DDYQ
Sbjct  604  VTNFESRDEMPYSKAPKTDFQKYIRLSRNELGVFASRCQSSQKAMLFDHCPLQLNEDDYQ  663

Query  657  RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V WD +VERV+L SGKPLVPDYAMSFV GTS+KP
Sbjct  664  RVCRIPKKKGANFRDLPGVLVRPDNVVEWDKSVERVFLPSGKPLVPDYAMSFVRGTSTKP  723

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGF D+YKLCGP+KERYIQ
Sbjct  724  FGRLWWDETVPTVVTRAEPHNQIILHPEQDRVLTIRENARLQGFLDFYKLCGPVKERYIQ  783

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALGY+L LA++G+   EP   LP+ +
Sbjct  784  VGNAVAVPVARALGYALGLAYRGICDEEPLLVLPQKF  820



>gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis]
Length=925

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 169/218 (78%), Gaps = 12/218 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL-----------PGIVLHDHRPLQLNDDDY  661
            V NNE RD+M Y   P +EFQ FIRL R+ L              +L DHRPLQLN+DDY
Sbjct  689  VGNNEMRDEMPYGRPPRTEFQHFIRLTREELVNSASGAGRLSQKAILFDHRPLQLNEDDY  748

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPGV+V  DN V WDP +ERV L SGKPLVPDYAMSF+ G S K
Sbjct  749  LRVCRIPKKKGANFRDLPGVKVGPDNVVEWDPEIERVLLPSGKPLVPDYAMSFIKGKSLK  808

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQA+LHP QDRVL+IRENARLQGFPD+Y+L GP+KERYI
Sbjct  809  PFGRLWWDETVPTVVTRAEPHNQALLHPEQDRVLSIRENARLQGFPDFYRLRGPVKERYI  868

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            QVGNAVAVPVARALGYS+ LAF+G    +P F LP+ +
Sbjct  869  QVGNAVAVPVARALGYSMGLAFQGKCSEQPVFTLPQKF  906



>ref|XP_010936992.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Elaeis 
guineensis]
Length=925

 Score =   304 bits (779),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 169/218 (78%), Gaps = 12/218 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL-----------PGIVLHDHRPLQLNDDDY  661
            V NNE RD+M Y   P +EFQ FIRL R+ L              +L DHRPLQLN+DDY
Sbjct  689  VGNNEMRDEMPYGRPPRTEFQHFIRLTREELVNSASGAGRLSQKAILFDHRPLQLNEDDY  748

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPGV+V  DN V WDP +ERV L SGKPLVPDYAMSF+ G S K
Sbjct  749  LRVCRIPKKKGANFRDLPGVKVGPDNVVEWDPEIERVLLPSGKPLVPDYAMSFIKGKSLK  808

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQA+LHP QDRVL+IRENARLQGFPD+Y+L GP+KERYI
Sbjct  809  PFGRLWWDETVPTVVTRAEPHNQALLHPEQDRVLSIRENARLQGFPDFYRLRGPVKERYI  868

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            QVGNAVAVPVARALGYS+ LAF+G    +P F LP+ +
Sbjct  869  QVGNAVAVPVARALGYSMGLAFQGKCSEQPVFTLPQKF  906



>ref|NP_001266791.1| uncharacterized protein LOC101027213 [Zea mays]
 gb|ACN35047.1| unknown [Zea mays]
Length=329

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 173/232 (75%), Gaps = 15/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN++  D MEY   P +EFQ++IRLGR  +             G +L DH+PL+LN+DD
Sbjct  86   VENHQPNDVMEYGGSPKTEFQRYIRLGRKDMLDWSFGEEAGPDEGKLL-DHQPLRLNNDD  144

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GV+V  +N V WDP VERVYLSSGKPLVPDYAMSF+ G S 
Sbjct  145  YERVKQIPVKKGANFRDLKGVKVGANNVVEWDPEVERVYLSSGKPLVPDYAMSFIKGKSL  204

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  205  KPFGRLWWDETVPTVVTRAEPHNQVILHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  264

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAA  154
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +  T V++ A
Sbjct  265  IQVGNAVAVPVARALGYCLGQAYLGESDGSQPLYQLPASFTSVGRTAVQANA  316



>ref|XP_009390334.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=875

 Score =   302 bits (773),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 162/210 (77%), Gaps = 1/210 (0%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            V N E RD++ Y     +EFQQFIRL R       L DH PLQLNDDDYQRVC IPK KG
Sbjct  651  VTNYEDRDEIPYGKAAKTEFQQFIRLPRSATDMHQLFDHNPLQLNDDDYQRVCQIPKRKG  710

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGV V  DN V WDPNVERV L SGKPLVPDYAMSF+ G S KPF RLWWDETV
Sbjct  711  ANFRDLPGVVVGPDNIVEWDPNVERVILPSGKPLVPDYAMSFIKGKSLKPFGRLWWDETV  770

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVL++RENARLQGFPD+YKL GP+KERYIQVGNAVAVPVA
Sbjct  771  PTVVTRAEPHNQVILHPEQDRVLSVRENARLQGFPDFYKLQGPVKERYIQVGNAVAVPVA  830

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGYGEI  181
            RALGY+L  A KG    EP F LP  +  I
Sbjct  831  RALGYALCQALKGQCSAEPLFILPRKFPTI  860



>ref|XP_007157973.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
 gb|ESW29967.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
Length=838

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 167/217 (77%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG-----------IVLHDHRPLQLNDDDY  661
            V N EK+D+M Y  K  +EFQ++IRL +  + G            +L+DHRPL+LN DDY
Sbjct  602  VTNYEKQDEMNYGTKARTEFQKYIRLKKSEMVGGNMGTAQSMASRILYDHRPLELNKDDY  661

Query  660  QRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IP+ KGANFRDLPGV V DNKV WDP++ERV L SGKPLVPDYAM+FV GTSSKP
Sbjct  662  DRVCRIPQKKGANFRDLPGVLVKDNKVEWDPSIERVKLDSGKPLVPDYAMTFVRGTSSKP  721

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE VPTVVTRAEPHNQ ILHP Q+RVLTIRENARLQGFPD YKLCGPIKERY Q
Sbjct  722  FGRLWWDEIVPTVVTRAEPHNQVILHPAQNRVLTIRENARLQGFPDCYKLCGPIKERYTQ  781

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVA A+GY+  LA +GLS  +P   LP  Y
Sbjct  782  VGNAVAVPVALAMGYTFGLACQGLSDDKPLATLPFKY  818



>ref|XP_003612312.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES95270.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 167/216 (77%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            VEN++  D+  Y   P ++FQ++IRL R  +          P  +L+DHRPL+LN DDY+
Sbjct  604  VENDDSDDERSYGTTPRTDFQKYIRLQRSEMVNYSADSQSAPSGMLYDHRPLKLNTDDYE  663

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVCHIPK KGANFRDL GV V +NKV WDP+VERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  664  RVCHIPKKKGANFRDLKGVLVKENKVEWDPSVERVYLKSGKPLVPDYAMTFVRGTSSKPF  723

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQ +LHP QDRVL+IRENARLQGFPD YKLCGP+K+RY+QV
Sbjct  724  GRLWWDEIVSTVVTRAEPHNQVLLHPEQDRVLSIRENARLQGFPDCYKLCGPVKQRYMQV  783

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+L LA  GLS   P   LP  Y
Sbjct  784  GNAVAVPVALALGYTLGLAILGLSDDSPLTTLPFKY  819



>gb|KEH27609.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=830

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 167/216 (77%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            VEN++  D+  Y   P ++FQ++IRL R  +          P  +L+DHRPL+LN DDY+
Sbjct  599  VENDDSDDERSYGTTPRTDFQKYIRLQRSEMVNYSADSQSAPSGMLYDHRPLKLNTDDYE  658

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVCHIPK KGANFRDL GV V +NKV WDP+VERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  659  RVCHIPKKKGANFRDLKGVLVKENKVEWDPSVERVYLKSGKPLVPDYAMTFVRGTSSKPF  718

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQ +LHP QDRVL+IRENARLQGFPD YKLCGP+K+RY+QV
Sbjct  719  GRLWWDEIVSTVVTRAEPHNQVLLHPEQDRVLSIRENARLQGFPDCYKLCGPVKQRYMQV  778

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+L LA  GLS   P   LP  Y
Sbjct  779  GNAVAVPVALALGYTLGLAILGLSDDSPLTTLPFKY  814



>ref|XP_009390335.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 163/210 (78%), Gaps = 3/210 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            V N E RD++ Y     +EFQQFIRL R  +    L DH PLQLNDDDYQRVC IPK KG
Sbjct  651  VTNYEDRDEIPYGKAAKTEFQQFIRLPRSDMHQ--LFDHNPLQLNDDDYQRVCQIPKRKG  708

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGV V  DN V WDPNVERV L SGKPLVPDYAMSF+ G S KPF RLWWDETV
Sbjct  709  ANFRDLPGVVVGPDNIVEWDPNVERVILPSGKPLVPDYAMSFIKGKSLKPFGRLWWDETV  768

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTVVTRAEPHNQ ILHP QDRVL++RENARLQGFPD+YKL GP+KERYIQVGNAVAVPVA
Sbjct  769  PTVVTRAEPHNQVILHPEQDRVLSVRENARLQGFPDFYKLQGPVKERYIQVGNAVAVPVA  828

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGYGEI  181
            RALGY+L  A KG    EP F LP  +  I
Sbjct  829  RALGYALCQALKGQCSAEPLFILPRKFPTI  858



>ref|XP_010043881.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Eucalyptus 
grandis]
Length=874

 Score =   299 bits (766),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 166/208 (80%), Gaps = 10/208 (5%)
 Frame = -1

Query  789  RDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQRVCHIPK  637
            RD+M Y   P ++FQ+FIR     + GI         +L DHRPL+LN DDY+RVC IPK
Sbjct  649  RDEMPYEKGPQTDFQRFIRSSAKEMMGITDNSVDSGRLLFDHRPLELNSDDYERVCRIPK  708

Query  636  AKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWD  460
             KGANFRDLPGVRV  DNKV WDP+V RVYL SGKPLVPDYAM+FV G+SSKPF R+WWD
Sbjct  709  KKGANFRDLPGVRVRPDNKVEWDPDVTRVYLDSGKPLVPDYAMTFVNGSSSKPFARVWWD  768

Query  459  ETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAV  280
            ETVPTVVTRAEPHNQAILHP QDRV T+RENARLQGFPDYYKL GPIKERYIQVGNAVAV
Sbjct  769  ETVPTVVTRAEPHNQAILHPEQDRVFTVRENARLQGFPDYYKLTGPIKERYIQVGNAVAV  828

Query  279  PVARALGYSLALAFKGLSGMEPTFGLPE  196
            PVARALG +LA AF+  +  +P F LP+
Sbjct  829  PVARALGCALAQAFQKSANEDPLFRLPD  856



>ref|XP_006573534.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
 gb|KHN35974.1| DNA (cytosine-5)-methyltransferase 3 [Glycine soja]
Length=833

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 167/216 (77%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            V N+E +D+  Y     +EFQ++IRL ++ +          P  +L+DHRPLQLN DDY 
Sbjct  599  VTNDENQDERNYGAPARTEFQRYIRLKKNEMVGSMATAQSTPRRILYDHRPLQLNKDDYD  658

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVC IP+ KGANFRDLPGV V  NKV WDP+VERV L SGKPLVPDYAM+FV GTS+KPF
Sbjct  659  RVCQIPQKKGANFRDLPGVLVNGNKVEWDPSVERVMLDSGKPLVPDYAMTFVRGTSTKPF  718

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE VPTVVTRAEPHNQAILHP Q+RVLTIRENARLQGFPD YKLCGP+KERYIQV
Sbjct  719  GRLWWDEIVPTVVTRAEPHNQAILHPRQNRVLTIRENARLQGFPDCYKLCGPVKERYIQV  778

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+  LA +GLS  +P   LP  Y
Sbjct  779  GNAVAVPVALALGYTFGLACQGLSDDKPLTTLPFKY  814



>gb|KEH27061.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score =   297 bits (760),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 166/216 (77%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            VEN++  D+  Y   P ++FQ++IRL R  +          P  +L+DHRPL+LN DDY+
Sbjct  603  VENDDSDDERSYGTTPRTDFQKYIRLKRSEMANYSADYHSAPSGMLYDHRPLKLNTDDYE  662

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVCHIPK KGANFRDL GV V + KV WDP+VERVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  663  RVCHIPKKKGANFRDLKGVLVKEKKVEWDPSVERVYLKSGKPLVPDYAMTFVRGTSSKPF  722

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQ +LHP QDRVL+IRENARLQGFPD YKLCGP+K+RYIQV
Sbjct  723  GRLWWDEIVSTVVTRAEPHNQVLLHPEQDRVLSIRENARLQGFPDCYKLCGPVKQRYIQV  782

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+L LA  GLS   P   LP  Y
Sbjct  783  GNAVAVPVALALGYTLGLAILGLSDDSPLTILPFKY  818



>ref|XP_009390332.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=885

 Score =   297 bits (761),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 163/220 (74%), Gaps = 11/220 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQ  658
            V N E RD++ Y     +EFQQFIRL R  L              L DH PLQLNDDDYQ
Sbjct  651  VTNYEDRDEIPYGKAAKTEFQQFIRLPRSALMNYSPRVKATDMHQLFDHNPLQLNDDDYQ  710

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V WDPNVERV L SGKPLVPDYAMSF+ G S KP
Sbjct  711  RVCQIPKRKGANFRDLPGVVVGPDNIVEWDPNVERVILPSGKPLVPDYAMSFIKGKSLKP  770

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTVVTRAEPHNQ ILHP QDRVL++RENARLQGFPD+YKL GP+KERYIQ
Sbjct  771  FGRLWWDETVPTVVTRAEPHNQVILHPEQDRVLSVRENARLQGFPDFYKLQGPVKERYIQ  830

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEI  181
            VGNAVAVPVARALGY+L  A KG    EP F LP  +  I
Sbjct  831  VGNAVAVPVARALGYALCQALKGQCSAEPLFILPRKFPTI  870



>gb|ABB46585.2| DNA cytosine methyltransferase MET2a, putative, expressed [Oryza 
sativa Japonica Group]
Length=371

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 168/223 (75%), Gaps = 13/223 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N++  + MEY   P +EFQ++IRL           G+DG     L DH+PL+LN DD+
Sbjct  128  VNNHQPNEVMEYGSSPKTEFQRYIRLSRKEMLDSSFEGKDGPDLGKLLDHQPLKLNKDDH  187

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  +N V WDP+V RVYLSSGKPLVPDYAMSF+ G S K
Sbjct  188  ERVQQIPVKKGANFRDLKGVRVGANNIVEWDPDVPRVYLSSGKPLVPDYAMSFIKGRSLK  247

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYYK+ GPIKE+YI
Sbjct  248  PFGRLWWDETVPTVVTRAEPHNQIILHPNQARVLTVRENARLQGFPDYYKMFGPIKEKYI  307

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIA  178
            QVGNAVAVPVARALGYSL LA++  S G  P F LP+ + E+ 
Sbjct  308  QVGNAVAVPVARALGYSLGLAYQRESEGSSPLFVLPDSFTEVG  350



>gb|KHN41840.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=823

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            V N+E +D+  Y     +EFQ++IRL ++ +          P  +L+DHRPLQLN DDY+
Sbjct  588  VTNDENQDERNYEAPSETEFQKYIRLKKNEMVGSMASAQSAPDRILYDHRPLQLNKDDYE  647

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVC IP+ KGANFRDLPGV V  NKV WDP+V+RV L SGKPLVPDYAM+FV GTSSKPF
Sbjct  648  RVCQIPQKKGANFRDLPGVLVNGNKVQWDPSVQRVMLDSGKPLVPDYAMTFVRGTSSKPF  707

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQAILHP Q+RVLTIRENARLQGFPD YKLCGP+KERYIQV
Sbjct  708  GRLWWDEIVSTVVTRAEPHNQAILHPTQNRVLTIRENARLQGFPDCYKLCGPVKERYIQV  767

Query  297  GNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+  LA +G LS   P   LP  Y
Sbjct  768  GNAVAVPVALALGYTFGLACQGLLSDDNPLTTLPFKY  804



>ref|XP_006590741.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
Length=832

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            V N+E +D+  Y     +EFQ++IRL ++ +          P  +L+DHRPLQLN DDY+
Sbjct  597  VTNDENQDERNYEAPSETEFQKYIRLKKNEMVGSMASAQSAPDRILYDHRPLQLNKDDYE  656

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVC IP+ KGANFRDLPGV V  NKV WDP+V+RV L SGKPLVPDYAM+FV GTSSKPF
Sbjct  657  RVCQIPQKKGANFRDLPGVLVNGNKVQWDPSVQRVMLDSGKPLVPDYAMTFVRGTSSKPF  716

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQAILHP Q+RVLTIRENARLQGFPD YKLCGP+KERYIQV
Sbjct  717  GRLWWDEIVSTVVTRAEPHNQAILHPTQNRVLTIRENARLQGFPDCYKLCGPVKERYIQV  776

Query  297  GNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+  LA +G LS   P   LP  Y
Sbjct  777  GNAVAVPVALALGYTFGLACQGLLSDDNPLTTLPFKY  813



>ref|XP_008797880.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Phoenix 
dactylifera]
Length=928

 Score =   295 bits (754),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 170/232 (73%), Gaps = 12/232 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRD---------GLPG--IVLHDHRPLQLNDDDY  661
            V N+E RD+M Y   P + FQ FIRL R+         G P     L DHR LQLN+DDY
Sbjct  692  VGNDETRDEMPYGRPPRTVFQHFIRLTREELVNSASGAGRPSQKATLFDHRALQLNEDDY  751

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPGV+V  D  V WDP +ERV L SGKPLVPDYAM+F+ G S K
Sbjct  752  LRVCRIPKRKGANFRDLPGVKVGPDKAVEWDPEIERVLLPSGKPLVPDYAMTFIKGKSLK  811

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQA+LHP QDRVL+IRENARLQGFPD+Y+L GP+KERYI
Sbjct  812  PFGRLWWDETVPTVVTRAEPHNQAVLHPEQDRVLSIRENARLQGFPDFYRLRGPVKERYI  871

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAEV  148
            QVGNAVAVPVARALGYSL LAF+G    +P F LP+ +  +  +  E   E 
Sbjct  872  QVGNAVAVPVARALGYSLGLAFQGKCSQQPVFTLPQKFPRLDQSSSERRVEA  923



>gb|KEH28933.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 164/216 (76%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            VEN++  D+  Y   P ++FQ++IRL R  +          P  +L+DHRP  LN+DDY+
Sbjct  611  VENDDSDDEKSYGTTPRTDFQRYIRLKRSEMVNYTADSESAPSGLLYDHRPYLLNNDDYE  670

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVC IPK KGANFRDL GV V + KV WDP+VERVYL SGKPLVP+YAM FV GTSSKPF
Sbjct  671  RVCLIPKKKGANFRDLKGVLVKEKKVEWDPSVERVYLKSGKPLVPNYAMKFVRGTSSKPF  730

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQA++HP QDRVLTIRENARLQGFPD YKLCGPIKERYIQV
Sbjct  731  GRLWWDEIVSTVVTRAEPHNQALIHPKQDRVLTIRENARLQGFPDCYKLCGPIKERYIQV  790

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPV  ALGY+L LA +G SG  P   LP  Y
Sbjct  791  GNAVAVPVGLALGYTLGLALQGRSGDNPLTTLPFKY  826



>ref|NP_001064023.1| Os10g0104900 [Oryza sativa Japonica Group]
 dbj|BAF25937.1| Os10g0104900, partial [Oryza sativa Japonica Group]
Length=406

 Score =   281 bits (719),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 168/223 (75%), Gaps = 13/223 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N++  + MEY   P +EFQ++IRL           G+DG     L DH+PL+LN DD+
Sbjct  163  VNNHQPNEVMEYGSSPKTEFQRYIRLSRKEMLDSSFEGKDGPDLGKLLDHQPLKLNKDDH  222

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  +N V WDP+V RVYLSSGKPLVPDYAMSF+ G S K
Sbjct  223  ERVQQIPVKKGANFRDLKGVRVGANNIVEWDPDVPRVYLSSGKPLVPDYAMSFIKGRSLK  282

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYYK+ GPIKE+YI
Sbjct  283  PFGRLWWDETVPTVVTRAEPHNQIILHPNQARVLTVRENARLQGFPDYYKMFGPIKEKYI  342

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIA  178
            QVGNAVAVPVARALGYSL LA++  S G  P F LP+ + E+ 
Sbjct  343  QVGNAVAVPVARALGYSLGLAYQRESEGSSPLFVLPDSFTEVG  385



>ref|XP_003636958.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|KEH21528.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=827

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 165/216 (76%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            VEN+   D+  Y   P ++FQ++IRL R  +          P  +L+DHRPL+LN DDY+
Sbjct  595  VENDNSDDEKSYGTTPRTDFQKYIRLKRSEMVNYLADSQSAPSGMLYDHRPLKLNTDDYE  654

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVCHIPK KGANFRDL GV V +NKV WDP+ +RVYL SGKPLVPDYAM+FV GTSSKPF
Sbjct  655  RVCHIPKEKGANFRDLKGVLVKENKVEWDPSFKRVYLKSGKPLVPDYAMTFVRGTSSKPF  714

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQA+LHP QDRVL+IRENARLQGFPD YKLCGP+K+RY+QV
Sbjct  715  GRLWWDEIVSTVVTRAEPHNQALLHPDQDRVLSIRENARLQGFPDCYKLCGPVKQRYMQV  774

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+L LA  G S   P   LP  Y
Sbjct  775  GNAVAVPVALALGYTLGLAILGHSDDGPLTTLPFKY  810



>ref|XP_002530367.1| protein with unknown function [Ricinus communis]
 gb|EEF32028.1| protein with unknown function [Ricinus communis]
Length=845

 Score =   290 bits (742),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 165/217 (76%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N+E +D+ +Y   P S+FQ++IRL +  + G           +L+DHRPL+LNDDDYQ
Sbjct  621  VNNDESQDERKYGTTPQSDFQKYIRLKKSDVVGFATDKNASHPQMLYDHRPLKLNDDDYQ  680

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC +PK KGANFRD PGV V  DNKV WDP VERV L SGKPLVPDYAMSFV GTS KP
Sbjct  681  RVCRVPKKKGANFRDFPGVLVGTDNKVEWDPAVERVLLPSGKPLVPDYAMSFVRGTSCKP  740

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETV TVVTRAEPHNQ ++HP+QDRVL+IRENARLQGFPD Y+L GP+KERY Q
Sbjct  741  FGRLWWDETVATVVTRAEPHNQIVIHPMQDRVLSIRENARLQGFPDCYQLHGPVKERYTQ  800

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVA ALGYS  +A +G S  +P   LP  Y
Sbjct  801  VGNAVAVPVATALGYSFGIASQGFSDNKPLTTLPFKY  837



>gb|AFV99137.1| CMT-type cytosine DNA-methyltransferase 3c [Malus domestica]
Length=974

 Score =   292 bits (748),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 158/194 (81%), Gaps = 1/194 (1%)
 Frame = -1

Query  729  GRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERV  553
             +D     VL+DHRPLQLN DDY RVC +PK KGA FRD PGVRV  DNKV WDP V RV
Sbjct  778  SKDNSLQKVLYDHRPLQLNPDDYARVCEVPKRKGACFRDFPGVRVRGDNKVEWDPEVPRV  837

Query  552  YLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIR  373
            YL+SGKPLVPDYAMSFV G+SSKPF RLWWDETVPTVVTRAEPHNQAI+HP QDRVLTIR
Sbjct  838  YLASGKPLVPDYAMSFVKGSSSKPFARLWWDETVPTVVTRAEPHNQAIMHPEQDRVLTIR  897

Query  372  ENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEG  193
            ENARLQGFPD+Y+L GP+KERY+QVGNAVAVPVARALGY+L LA +  +G +P F LPE 
Sbjct  898  ENARLQGFPDFYRLSGPVKERYMQVGNAVAVPVARALGYALGLALRRSAGADPVFILPES  957

Query  192  YGEIAATLVESAAE  151
            +  I   +  +++E
Sbjct  958  FPNIQDQVHSASSE  971



>ref|XP_010533849.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Tarenaya 
hassleriana]
Length=799

 Score =   289 bits (739),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 169/224 (75%), Gaps = 11/224 (5%)
 Frame = -1

Query  801  NNEKRDDMEYVDK-PGSEFQQFIRLGRD----------GLPGIVLHDHRPLQLNDDDYQR  655
            N E +D  EY  K P +EFQ++IRL R                +L+DH+PLQLNDDD++R
Sbjct  570  NIENKDKKEYGTKSPVTEFQKYIRLDRAETIIHTENECTWQSQMLYDHQPLQLNDDDFER  629

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            VC IPK KGANFRDLPGV V +N+V WDP+VERVYL SGKPLVP+YAM+FV G S+KPF 
Sbjct  630  VCQIPKKKGANFRDLPGVLVENNRVKWDPSVERVYLKSGKPLVPEYAMTFVHGRSTKPFG  689

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ILHPLQDRVLT+RENARLQGFPD+YKLCG IKE+YIQVG
Sbjct  690  RLWWDEVVNTVVTRAEPHNQCILHPLQDRVLTVRENARLQGFPDFYKLCGSIKEKYIQVG  749

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVE  163
            NAVAVPV  ALGY+L +A +GL   +P   LP  Y +    +V+
Sbjct  750  NAVAVPVGTALGYALGMASQGLCDDQPVIQLPFKYPKCLKRVVK  793



>ref|XP_010541913.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Tarenaya 
hassleriana]
Length=874

 Score =   290 bits (742),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 170/217 (78%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N+EKRD++ Y  +P + FQ+ IRL +D + G          +L+DH PL LN DDYQR
Sbjct  642  VANSEKRDEIPYDKEPETPFQRHIRLSKDEMLGSSLKSKPTKRLLYDHHPLNLNMDDYQR  701

Query  654  VCHIPKAKGANFRDLPGVRVVDNK-VHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDL GVRV  NK V +DPNV RVYL SGKPLVPDYAMSF+ GTSSKPF
Sbjct  702  VCQIPKRKGANFRDLTGVRVGPNKKVEFDPNVPRVYLDSGKPLVPDYAMSFIDGTSSKPF  761

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQ I+HP QDRVLTIRENARLQGFPD+YKL GP KE+YIQV
Sbjct  762  GRLWWDETVPTVVTRAEPHNQVIIHPEQDRVLTIRENARLQGFPDFYKLFGPPKEKYIQV  821

Query  297  GNAVAVPVARALGYSLALAFKGL-SGMEPTFGLPEGY  190
            GNAVAVPVARALG +L  A++GL +G +P   LP G+
Sbjct  822  GNAVAVPVARALGLALGRAYQGLTTGDDPLLTLPLGF  858



>ref|NP_001266331.1| uncharacterized protein LOC101027085 [Zea mays]
 gb|ACF78281.1| unknown [Zea mays]
Length=322

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 167/231 (72%), Gaps = 15/231 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            V+N++  D MEY   P +EFQ++IRL R  +             G +L DH+PL+LN+DD
Sbjct  78   VQNHQPNDVMEYGGSPKTEFQRYIRLSRKDMLDWSFGEGAGPDEGKLL-DHQPLRLNNDD  136

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GVRV  +N V WDP +ERV LSSGKPLVPDYAMSF+ G S 
Sbjct  137  YERVQQIPVKKGANFRDLKGVRVGANNIVEWDPEIERVKLSSGKPLVPDYAMSFIKGKSL  196

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ I+HP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  197  KPFGRLWWDETVPTVVTRAEPHNQVIIHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  256

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESA  157
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +       A
Sbjct  257  IQVGNAVAVPVARALGYCLGQAYLGESEGSDPLYQLPPSFTSVGGRTAGQA  307



>gb|KEH25929.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 162/216 (75%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGR----------DGLPGIVLHDHRPLQLNDDDYQ  658
            ++N+E +D+  Y   P SEFQ++IRL R          +  P  +L+DH PL+LN DDY+
Sbjct  611  IKNDESQDERSYGASPRSEFQKYIRLKRSEMVNYSADYENTPSGMLYDHFPLELNKDDYE  670

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVCHIP  KG+NFRDL GV V  NKV WDP+VER  L SGKPLVPDYAMSFV GTSSKPF
Sbjct  671  RVCHIPHKKGSNFRDLKGVTVKGNKVEWDPSVERQLLKSGKPLVPDYAMSFVRGTSSKPF  730

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE V TVVTRAEPHNQ +LHP QDRVL+IRENAR+QGFPD YKLCGP KERY QV
Sbjct  731  GRLWWDEIVSTVVTRAEPHNQVLLHPEQDRVLSIRENARIQGFPDCYKLCGPTKERYTQV  790

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            GNAVAVPVA ALGY+L LA  GLS  +P   LP  Y
Sbjct  791  GNAVAVPVALALGYTLGLAILGLSDDKPLTTLPFKY  826



>sp|Q8LPU5.1|CMT3_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 3; AltName: 
Full=Chromomethylase 3; AltName: Full=DNA methyltransferase 
105 [Zea mays]
 gb|AAM28227.1| DNA methyltransferase 105 [Zea mays]
 tpg|DAA36032.1| TPA: DNA (cytosine-5)-methyltransferase 2 [Zea mays]
Length=915

 Score =   289 bits (740),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/232 (65%), Positives = 173/232 (75%), Gaps = 15/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN++  D MEY   P +EFQ++IRLGR  +             G +L DH+PL+LN+DD
Sbjct  672  VENHQPNDVMEYGGSPKTEFQRYIRLGRKDMLDWSFGEEAGPDEGKLL-DHQPLRLNNDD  730

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GV+V  +N V WDP VERVYLSSGKPLVPDYAMSF+ G S 
Sbjct  731  YERVKQIPVKKGANFRDLKGVKVGANNVVEWDPEVERVYLSSGKPLVPDYAMSFIKGKSL  790

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  791  KPFGRLWWDETVPTVVTRAEPHNQVILHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  850

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAA  154
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +  T V++ A
Sbjct  851  IQVGNAVAVPVARALGYCLGQAYLGESDGSQPLYQLPASFTSVGRTAVQANA  902



>ref|XP_006854149.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
 gb|ERN15616.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
Length=1183

 Score =   291 bits (745),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 167/219 (76%), Gaps = 13/219 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI------------VLHDHRPLQLNDDD  664
             V N E RD+M Y   P +EFQ++IR  +  + G             +L+DHRPL LN+DD
Sbjct  950   VTNFETRDEMPYGKPPQTEFQRYIRATKHEMMGTAPSSVKRSSHKPMLYDHRPLLLNEDD  1009

Query  663   YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
             +QRVC IPK KGANFRDLPGV V  DNKV WDP ++RV L SGKPLVPDYAMS + G SS
Sbjct  1010  HQRVCQIPKRKGANFRDLPGVVVGADNKVEWDPKIKRVLLPSGKPLVPDYAMSHLNGKSS  1069

Query  486   KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
             KPF RLWWDETVPTV+TRA PHNQAILHP+QDRVLT+RE+ RLQGFPDYYKLCG +++RY
Sbjct  1070  KPFARLWWDETVPTVLTRAPPHNQAILHPVQDRVLTVRESGRLQGFPDYYKLCGSVRDRY  1129

Query  306   IQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +QVGNAVAVPVA ALGY++ LA++GLS  +P   LP  +
Sbjct  1130  MQVGNAVAVPVAMALGYAMGLAYRGLSSNDPLITLPTDF  1168



>ref|NP_001105167.1| DNA (cytosine-5)-methyltransferase 3 [Zea mays]
 sp|Q9ARI6.1|CMT2_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 2; AltName: 
Full=Chromomethylase 2; AltName: Full=DNA cytosine methyltransferase 
MET5; AltName: Full=Zea methyltransferase5; Short=Zmet5 
[Zea mays]
 gb|AAK15805.1| chromomethylase [Zea mays]
Length=915

 Score =   288 bits (737),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 173/232 (75%), Gaps = 15/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN++  D MEY   P +EFQ++IRLGR  +             G +L DH+PL+LN+DD
Sbjct  672  VENHQPNDVMEYGGSPKTEFQRYIRLGRKDMLDWSFGEEAGPDEGKLL-DHQPLRLNNDD  730

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GV+V  +N V WDP VERVYLSSGKPLVPDYAMSF+ G S 
Sbjct  731  YERVKQIPVKKGANFRDLKGVKVGANNVVEWDPEVERVYLSSGKPLVPDYAMSFIKGKSL  790

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWD+TVPTVVTRAEPHNQ ILHP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  791  KPFGRLWWDQTVPTVVTRAEPHNQVILHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  850

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAA  154
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +  T V++ A
Sbjct  851  IQVGNAVAVPVARALGYCLGQAYLGESDGSQPLYQLPASFTSVGRTAVQANA  902



>gb|KEH27204.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=935

 Score =   288 bits (737),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 169/229 (74%), Gaps = 9/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL---------PGIVLHDHRPLQLNDDDYQR  655
            +EN+E RDDMEY   P +EFQ+FIRL ++ +         P  +LHDHR  ++N DDYQR
Sbjct  702  IENDENRDDMEYGGPPLTEFQKFIRLSQNEMLGGSIKKKSPKSLLHDHRSYEMNVDDYQR  761

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C IPK KGA FRDLP VR+ + KV  +P+VER  L SGKPLVP+YA+SFV GTS  PF 
Sbjct  762  ACRIPKRKGACFRDLPCVRMRNKKVELNPDVERELLPSGKPLVPNYAISFVRGTSPLPFA  821

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            R+WWDETVPTVVTR EPHNQ ILHP QDRVL++RENARLQGFPD+YKLCG +KERYIQVG
Sbjct  822  RIWWDETVPTVVTRPEPHNQKILHPEQDRVLSVRENARLQGFPDFYKLCGSVKERYIQVG  881

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVESAAEV  148
            NAVAVPV RALGY L LA +G S   P + LP+ +    A++  S  EV
Sbjct  882  NAVAVPVGRALGYCLGLASQGASTDGPLYTLPDHFPRKKASIAASDEEV  930



>gb|KDP34481.1| hypothetical protein JCGZ_12764 [Jatropha curcas]
Length=848

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 163/220 (74%), Gaps = 17/220 (8%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV------------LHDHRPLQLNDDD  664
            V N+E +D+ +Y     +EFQ++IRL R+ L G              L+DHRPL LN DD
Sbjct  613  VTNDESQDERKYGTTARTEFQRYIRLKRNDLVGYTTAAAQNVSCPRKLYDHRPLNLNIDD  672

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            YQRVC IPK KGANFRDLPGV V  DNKV WDP++ERV L SGKPLVPDYAMSFV GTS 
Sbjct  673  YQRVCRIPKKKGANFRDLPGVLVGSDNKVEWDPSIERVMLPSGKPLVPDYAMSFVRGTSQ  732

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDE V TVVTRAEPHNQ +LHP+QDRVLTIRENARLQGFPD Y+L GP+KERY
Sbjct  733  KPFGRLWWDEVVATVVTRAEPHNQVVLHPVQDRVLTIRENARLQGFPDCYQLYGPVKERY  792

Query  306  IQVGNAVAVPVARALGYSLALAFKGLSGMEP----TFGLP  199
            IQVGNAVAVPVA ALGYS   A KG S  +P    TF  P
Sbjct  793  IQVGNAVAVPVAIALGYSFGFACKGFSDNKPLITLTFKFP  832



>dbj|BAF34637.1| chromomethylase [Brassica rapa]
Length=805

 Score =   285 bits (730),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 163/219 (74%), Gaps = 13/219 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL-----------PGIVLHDHRPLQLNDDDY  661
            V NNE+R +M Y   P + FQ+FIRL ++G+              VL+DH PL LN DDY
Sbjct  582  VANNERRAEMPYDKDPKTPFQKFIRLTQEGMLASPKDPKSNSKNEVLYDHHPLNLNKDDY  641

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            QRVC IPK K ANFRDLPGV V  +NKV WDP + R+YL S  PL+P+YAM FV G S K
Sbjct  642  QRVCRIPKKKQANFRDLPGVTVNANNKVEWDPKIPRIYLESNHPLIPEYAMKFVEGKSKK  701

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+ RAEPHN  I+HP QDRVLT+RENARLQGFPDYY+L GP K++Y 
Sbjct  702  PFGRLWWDETVPTVIGRAEPHNHVIIHPNQDRVLTVRENARLQGFPDYYRLFGPTKKKYT  761

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
            QVGNAVAVPVARALGY+L  AF+GL+ G +P F LPEG+
Sbjct  762  QVGNAVAVPVARALGYALGQAFQGLTNGSDPLFTLPEGF  800



>emb|CDY08836.1| BnaA06g23880D [Brassica napus]
Length=805

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 163/219 (74%), Gaps = 13/219 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL-----------PGIVLHDHRPLQLNDDDY  661
            V NNE+R +M Y   P + FQ+FIRL ++G+              VL+DH PL LN DDY
Sbjct  582  VANNERRAEMPYDKDPKTPFQKFIRLTQEGMLASPKDPKSNSKNEVLYDHHPLNLNKDDY  641

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            QRVC IPK K ANFRDLPGV V  +NKV WDP + R+YL S  PL+P+YAM FV G S K
Sbjct  642  QRVCRIPKKKQANFRDLPGVTVNANNKVEWDPKIPRIYLESNHPLIPEYAMKFVEGKSKK  701

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+ RAEPHN  I+HP QDRVLT+RENARLQGFPDYY+L GP K++Y 
Sbjct  702  PFGRLWWDETVPTVIGRAEPHNHVIIHPNQDRVLTVRENARLQGFPDYYRLFGPTKKKYT  761

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
            QVGNAVAVPVARALGY+L  AF+GL+ G +P F LPEG+
Sbjct  762  QVGNAVAVPVARALGYALGQAFQGLTNGSDPLFTLPEGF  800



>ref|XP_004512254.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Cicer arietinum]
Length=882

 Score =   286 bits (733),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -1

Query  714  PGIVLHDHRPLQLNDDDYQRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGK  535
            P  VL+DHRPLQLN DDY+RVC IPK KGANFRDLPGV V DNKV WDP+VER+ L SGK
Sbjct  687  PRRVLYDHRPLQLNKDDYERVCQIPKKKGANFRDLPGVLVKDNKVEWDPSVERLLLQSGK  746

Query  534  PLVPDYAMSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQ  355
            PLVPDYAMSFV GTSSKPF RLWWDE V TVVTRAEPHNQA+LHP QDRVL+IRENARLQ
Sbjct  747  PLVPDYAMSFVRGTSSKPFGRLWWDEIVSTVVTRAEPHNQALLHPAQDRVLSIRENARLQ  806

Query  354  GFPDYYKLCGPIKERYIQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAA  175
            GFPD YKLCGPIKERY+QVGNAVAVPVA ALGY+  LA +GLS  +P   +P  Y +  A
Sbjct  807  GFPDCYKLCGPIKERYMQVGNAVAVPVALALGYTFGLACQGLSDDKPLTTVPFKYPKCLA  866

Query  174  T  172
            +
Sbjct  867  S  867


 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 69/101 (68%), Gaps = 11/101 (11%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGIVLHDHRPLQLNDDDYQ  658
            + N+E +D+M Y   P ++FQ++IRL R  +          P  VL+DHRPLQLN DDY+
Sbjct  585  IANDESQDEMSYGTTPRTDFQKYIRLKRSEMVNYMATSKSAPRRVLYDHRPLQLNKDDYE  644

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGK  535
            RVC IPK KGANFRDLPGV V DNKV WDP+V   Y+++ K
Sbjct  645  RVCQIPKKKGANFRDLPGVLVKDNKVEWDPSVVN-YMATSK  684



>ref|XP_009150572.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Brassica 
rapa]
Length=805

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 163/219 (74%), Gaps = 13/219 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL-----------PGIVLHDHRPLQLNDDDY  661
            V NNE+R +M Y   P + FQ+FIRL ++G+              VL+DH PL LN DDY
Sbjct  582  VANNERRAEMPYDKDPKTPFQKFIRLTQEGMLASPKDPKSNSKNEVLYDHHPLNLNKDDY  641

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            QRVC IPK K ANFRDLPGV V  +NKV WDP + R+YL S  PL+P+YAM FV G S K
Sbjct  642  QRVCRIPKKKQANFRDLPGVTVNANNKVEWDPKIPRIYLESNHPLIPEYAMKFVEGKSKK  701

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+ RAEPHN  I+HP QDRVLT+RENARLQGFPDYY+L GP K++Y 
Sbjct  702  PFGRLWWDETVPTVIGRAEPHNHVIIHPNQDRVLTVRENARLQGFPDYYRLFGPTKKKYT  761

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
            QVGNAVAVPVARALGY+L  AF+GL+ G +P F LPEG+
Sbjct  762  QVGNAVAVPVARALGYALGQAFQGLTNGSDPLFTLPEGF  800



>ref|XP_004983483.1| PREDICTED: DNA (cytosine-5)-methyltransferase 3-like [Setaria 
italica]
Length=915

 Score =   286 bits (732),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 171/234 (73%), Gaps = 15/234 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN +  D MEY   P +EFQ++IRLGR  +             G +L DH+PL+LN+DD
Sbjct  673  VENYQPHDVMEYTSSPKTEFQRYIRLGRKDMLDWSFGEEAGPDEGKLL-DHQPLRLNNDD  731

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GV+V  +N V WDP +ERVYLSSGKPLVPDYAMSF+ G S 
Sbjct  732  YERVKQIPVKKGANFRDLKGVKVGANNIVEWDPEIERVYLSSGKPLVPDYAMSFIKGRSP  791

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY+L GPIKE+Y
Sbjct  792  KPFGRLWWDETVPTVVTRAEPHNQIILHPTQARVLTVRENARLQGFPDYYRLFGPIKEKY  851

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAAEV  148
            IQVGNAVAVPVARALGY L  AF G S G +P + LP  +  +A      A+ V
Sbjct  852  IQVGNAVAVPVARALGYCLGQAFLGESEGSQPLYELPASFTSVARVAQVGASSV  905



>ref|XP_006662134.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Oryza brachyantha]
Length=827

 Score =   284 bits (726),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/231 (63%), Positives = 174/231 (75%), Gaps = 13/231 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGI-VLHDHRPLQLNDDDY  661
            V NN+  + MEY   P +EFQ++IRL R  +          P + +L DH+PL+LN+DD+
Sbjct  584  VNNNQPNEVMEYGSSPKTEFQRYIRLSRREMLDNSFEGNAGPDVGMLLDHQPLKLNNDDH  643

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GV+V  +N V WDP+++RVYLSSGKPLVPDYAMSF+ G S K
Sbjct  644  ERVQQIPVKKGANFRDLKGVKVGANNIVEWDPDIDRVYLSSGKPLVPDYAMSFIRGRSLK  703

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVL++RENARLQGFPDYYK+ GPIKE+YI
Sbjct  704  PFGRLWWDETVPTVVTRAEPHNQIILHPTQARVLSVRENARLQGFPDYYKMFGPIKEKYI  763

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAA  154
            QVGNAVAVPVARALGYSL LA++G S G  P F LP+ +  +   L  + A
Sbjct  764  QVGNAVAVPVARALGYSLGLAYQGDSEGSSPLFILPDSFTAVGRQLAPARA  814



>ref|XP_006849583.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
 gb|ERN11164.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
Length=884

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/233 (63%), Positives = 170/233 (73%), Gaps = 13/233 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG-----------IVLHDHRPLQLNDDDY  661
            V N E RD+  Y   P +EFQ++IRLG+  + G            +L+DH+PLQLN+DDY
Sbjct  648  VTNFETRDEFPYERPPRTEFQKYIRLGKHQMMGECSNGNGSSEKALLYDHQPLQLNEDDY  707

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            QRVC IPK KGANFRDLPGV V  D  V+ D +VER YL SGKPLVPDYA++FV G S K
Sbjct  708  QRVCRIPKKKGANFRDLPGVLVRQDKTVYLDSSVERAYLPSGKPLVPDYAITFVRGRSKK  767

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWD TVPTVVTRAEPHNQAILHP QDRVLTIRENARLQGFPDYYKLCG +K+RYI
Sbjct  768  PFGRLWWDVTVPTVVTRAEPHNQAILHPEQDRVLTIRENARLQGFPDYYKLCGSVKDRYI  827

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGM-EPTFGLPEGYGEIAATLVESAAEV  148
            QVGNAVAVPV RALG++LALA + L    EP   LP  + +    +  S  +V
Sbjct  828  QVGNAVAVPVGRALGHALALAIQKLGSYDEPLMALPPKFPQCLHRVSSSTIDV  880



>ref|XP_002275932.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Vitis 
vinifera]
Length=829

 Score =   282 bits (721),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 163/223 (73%), Gaps = 12/223 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N   +D+M Y     +EFQ++IRL            +D     +L+DHRPLQLN+DD 
Sbjct  596  VTNYNGQDEMPYNKAAHTEFQRYIRLRKHDMVYCSDAEKDASEPPMLYDHRPLQLNEDDN  655

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RVC IPK KGANFRDLPGV V  DN+V WDP++ERV L SGKPLVPDYAMSFV G S+K
Sbjct  656  ERVCRIPKKKGANFRDLPGVMVGSDNRVEWDPSMERVLLPSGKPLVPDYAMSFVRGKSTK  715

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDE V TVVTRAEPHNQAI+HP QDRVLTIRENAR QGFPD YKLCGP+KERYI
Sbjct  716  PFARLWWDEIVATVVTRAEPHNQAIIHPTQDRVLTIRENARFQGFPDCYKLCGPVKERYI  775

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAA  175
            QVGNAVAVPVA ALGYS  +A +GL    P   LP  + E  A
Sbjct  776  QVGNAVAVPVALALGYSFGMASQGLCDDHPLATLPFKFPECLA  818



>emb|CBI29991.3| unnamed protein product [Vitis vinifera]
Length=827

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 163/223 (73%), Gaps = 12/223 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N   +D+M Y     +EFQ++IRL            +D     +L+DHRPLQLN+DD 
Sbjct  594  VTNYNGQDEMPYNKAAHTEFQRYIRLRKHDMVYCSDAEKDASEPPMLYDHRPLQLNEDDN  653

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RVC IPK KGANFRDLPGV V  DN+V WDP++ERV L SGKPLVPDYAMSFV G S+K
Sbjct  654  ERVCRIPKKKGANFRDLPGVMVGSDNRVEWDPSMERVLLPSGKPLVPDYAMSFVRGKSTK  713

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDE V TVVTRAEPHNQAI+HP QDRVLTIRENAR QGFPD YKLCGP+KERYI
Sbjct  714  PFARLWWDEIVATVVTRAEPHNQAIIHPTQDRVLTIRENARFQGFPDCYKLCGPVKERYI  773

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAA  175
            QVGNAVAVPVA ALGYS  +A +GL    P   LP  + E  A
Sbjct  774  QVGNAVAVPVALALGYSFGMASQGLCDDHPLATLPFKFPECLA  816



>ref|XP_010415636.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=835

 Score =   281 bits (720),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 168/221 (76%), Gaps = 12/221 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            + N+E RD++ Y   P + FQQFIRL +D + G          VL+DH PL LN DDYQR
Sbjct  613  IANSEVRDEIPYDKDPITPFQQFIRLRKDEVLGSSTNFKSKKHVLYDHHPLNLNIDDYQR  672

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N VH D ++ERV L SG PLVPDYA+S+V GTSSKPF
Sbjct  673  VCRVPKKKGANFRDFPGVIVGRGNVVHLDESMERVMLESGNPLVPDYAVSYVDGTSSKPF  732

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQ I+HP QDRVL+IRENARLQGFPD YKL GP K++YIQV
Sbjct  733  GRLWWDETVPTVVTRAEPHNQVIIHPQQDRVLSIRENARLQGFPDDYKLFGPPKQKYIQV  792

Query  297  GNAVAVPVARALGYSLALAFKGLS--GMEPTFGLPEGYGEI  181
            GNAVAVPVA+ALGY+LA+AF+GL+    +P   LPEG+  +
Sbjct  793  GNAVAVPVAKALGYALAMAFQGLTVRNDDPLLTLPEGFAHM  833



>ref|XP_010470977.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=831

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 167/221 (76%), Gaps = 12/221 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N+E RD++ Y   P + FQQFIRL +D + G          VL+DH PL LN DDYQR
Sbjct  609  VANSEVRDEIPYDKDPITPFQQFIRLRKDEVLGSSTNFKSKKHVLYDHHPLNLNIDDYQR  668

Query  654  VCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N VH D ++ERV L SG PLVPDYA+S+V GTSSKPF
Sbjct  669  VCRVPKKKGANFRDFPGVIVGHGNVVHLDESMERVMLESGNPLVPDYAVSYVDGTSSKPF  728

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETVPTVVTRAEPHNQ I+HP QDRVLTIRENARLQGFPD YKL GP K++YIQV
Sbjct  729  GRLWWDETVPTVVTRAEPHNQVIIHPQQDRVLTIRENARLQGFPDDYKLFGPPKQKYIQV  788

Query  297  GNAVAVPVARALGYSLALAFKGL--SGMEPTFGLPEGYGEI  181
            GNAVAVPVA+ALGY+LA+AF+GL     +P   LPEG+  +
Sbjct  789  GNAVAVPVAKALGYALAMAFQGLIVRNDDPLLTLPEGFAHM  829



>ref|XP_010234610.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=894

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 169/231 (73%), Gaps = 13/231 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
            V+N +  + MEY  +P +EFQ +IRL R  +               L DH+PL+LN DDY
Sbjct  651  VDNFQPHEVMEYGAQPKTEFQSYIRLSRKDMLDYSFGDNTCPEEGKLLDHQPLRLNQDDY  710

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RV  IP  KGANFRDLPGV+V  +N V WDP V+RVYL SGKPLVPDYAMSF+ G S K
Sbjct  711  DRVQQIPVKKGANFRDLPGVKVGANNIVEWDPEVQRVYLKSGKPLVPDYAMSFIKGRSLK  770

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY++ GPIKE+YI
Sbjct  771  PFGRLWWDETVPTVVTRAEPHNQIILHPNQARVLTVRENARLQGFPDYYRMNGPIKEKYI  830

Query  303  QVGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGYGEIAATLVESAA  154
            QVGNAVAVPVARALGYSL  A++G + G  P F LP+ +  +  T+V + A
Sbjct  831  QVGNAVAVPVARALGYSLGRAYQGEMEGSNPLFTLPDSFTNVGQTVVLARA  881



>ref|XP_010415637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=834

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 167/220 (76%), Gaps = 11/220 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            + N+E RD++ Y   P + FQQFIRL +D L           VL+DH PL LN DDYQRV
Sbjct  613  IANSEVRDEIPYDKDPITPFQQFIRLRKDVLGSSTNFKSKKHVLYDHHPLNLNIDDYQRV  672

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C +PK KGANFRD PGV V   N VH D ++ERV L SG PLVPDYA+S+V GTSSKPF 
Sbjct  673  CRVPKKKGANFRDFPGVIVGRGNVVHLDESMERVMLESGNPLVPDYAVSYVDGTSSKPFG  732

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQ I+HP QDRVL+IRENARLQGFPD YKL GP K++YIQVG
Sbjct  733  RLWWDETVPTVVTRAEPHNQVIIHPQQDRVLSIRENARLQGFPDDYKLFGPPKQKYIQVG  792

Query  294  NAVAVPVARALGYSLALAFKGLS--GMEPTFGLPEGYGEI  181
            NAVAVPVA+ALGY+LA+AF+GL+    +P   LPEG+  +
Sbjct  793  NAVAVPVAKALGYALAMAFQGLTVRNDDPLLTLPEGFAHM  832



>ref|XP_010470978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=830

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 166/220 (75%), Gaps = 11/220 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            V N+E RD++ Y   P + FQQFIRL +D L           VL+DH PL LN DDYQRV
Sbjct  609  VANSEVRDEIPYDKDPITPFQQFIRLRKDVLGSSTNFKSKKHVLYDHHPLNLNIDDYQRV  668

Query  651  CHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C +PK KGANFRD PGV V   N VH D ++ERV L SG PLVPDYA+S+V GTSSKPF 
Sbjct  669  CRVPKKKGANFRDFPGVIVGHGNVVHLDESMERVMLESGNPLVPDYAVSYVDGTSSKPFG  728

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQ I+HP QDRVLTIRENARLQGFPD YKL GP K++YIQVG
Sbjct  729  RLWWDETVPTVVTRAEPHNQVIIHPQQDRVLTIRENARLQGFPDDYKLFGPPKQKYIQVG  788

Query  294  NAVAVPVARALGYSLALAFKGL--SGMEPTFGLPEGYGEI  181
            NAVAVPVA+ALGY+LA+AF+GL     +P   LPEG+  +
Sbjct  789  NAVAVPVAKALGYALAMAFQGLIVRNDDPLLTLPEGFAHM  828



>gb|EEC70797.1| hypothetical protein OsI_02246 [Oryza sativa Indica Group]
Length=907

 Score =   281 bits (719),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 168/223 (75%), Gaps = 13/223 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N++  + MEY   P +EFQ++IRL           G+DG     L DH+PL+LN DD+
Sbjct  664  VNNHQPNEVMEYGSSPKTEFQRYIRLSRKEMLDSSFEGKDGPDLGKLLDHQPLKLNKDDH  723

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  +N V WDP+V RVYLSSGKPLVPDYAMSF+ G S K
Sbjct  724  ERVQQIPVKKGANFRDLKGVRVGANNIVEWDPDVPRVYLSSGKPLVPDYAMSFIKGRSLK  783

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYYK+ GPIKE+YI
Sbjct  784  PFGRLWWDETVPTVVTRAEPHNQIILHPNQARVLTVRENARLQGFPDYYKMFGPIKEKYI  843

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIA  178
            QVGNAVAVPVARALGYSL LA++  S G  P F LP+ + E+ 
Sbjct  844  QVGNAVAVPVARALGYSLGLAYQRESEGSSPLFVLPDSFTEVG  886



>dbj|BAH37019.1| chromomethylase OsMET2a [Oryza sativa Japonica Group]
Length=907

 Score =   281 bits (718),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 168/223 (75%), Gaps = 13/223 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N++  + MEY   P +EFQ++IRL           G+DG     L DH+PL+LN DD+
Sbjct  664  VNNHQPNEVMEYGSSPKTEFQRYIRLSRKEMLDSSFEGKDGPDLGKLLDHQPLKLNKDDH  723

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  +N V WDP+V RVYLSSGKPLVPDYAMSF+ G S K
Sbjct  724  ERVQQIPVKKGANFRDLKGVRVGANNIVEWDPDVPRVYLSSGKPLVPDYAMSFIKGRSLK  783

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYYK+ GPIKE+YI
Sbjct  784  PFGRLWWDETVPTVVTRAEPHNQIILHPNQARVLTVRENARLQGFPDYYKMFGPIKEKYI  843

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIA  178
            QVGNAVAVPVARALGYSL LA++  S G  P F LP+ + E+ 
Sbjct  844  QVGNAVAVPVARALGYSLGLAYQRESEGSSPLFVLPDSFTEVG  886



>gb|EEE50451.1| hypothetical protein OsJ_30466 [Oryza sativa Japonica Group]
Length=907

 Score =   281 bits (718),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 168/223 (75%), Gaps = 13/223 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL-----------GRDGLPGIVLHDHRPLQLNDDDY  661
            V N++  + MEY   P +EFQ++IRL           G+DG     L DH+PL+LN DD+
Sbjct  664  VNNHQPNEVMEYGSSPKTEFQRYIRLSRKEMLDSSFEGKDGPDLGKLLDHQPLKLNKDDH  723

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  +N V WDP+V RVYLSSGKPLVPDYAMSF+ G S K
Sbjct  724  ERVQQIPVKKGANFRDLKGVRVGANNIVEWDPDVPRVYLSSGKPLVPDYAMSFIKGRSLK  783

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYYK+ GPIKE+YI
Sbjct  784  PFGRLWWDETVPTVVTRAEPHNQIILHPNQARVLTVRENARLQGFPDYYKMFGPIKEKYI  843

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIA  178
            QVGNAVAVPVARALGYSL LA++  S G  P F LP+ + E+ 
Sbjct  844  QVGNAVAVPVARALGYSLGLAYQRESEGSSPLFVLPDSFTEVG  886



>gb|AIU80190.1| chromomethylase [Hevea brasiliensis]
Length=851

 Score =   280 bits (715),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 160/216 (74%), Gaps = 13/216 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI------------VLHDHRPLQLNDDD  664
            V N+E RD+  Y       FQ++IRL RD + G             +L+DHRPL+LN DD
Sbjct  615  VTNDESRDERRYGTTSRMGFQRYIRLKRDDVVGYTAAAAKNASRPRMLYDHRPLKLNSDD  674

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RVC IPK KGANFRDLPGV V  DNKV WD ++ERV L SGKPLVPDYAM FV GTS 
Sbjct  675  YERVCRIPKKKGANFRDLPGVSVGPDNKVEWDQSMERVMLPSGKPLVPDYAMKFVRGTSC  734

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
             PF RLWWDE V TVVTRAEPHNQA+LHP+QDRVLTIRENARLQGFPD Y+L GPIKERY
Sbjct  735  NPFGRLWWDEIVATVVTRAEPHNQAVLHPVQDRVLTIRENARLQGFPDCYQLYGPIKERY  794

Query  306  IQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            IQVGNAVAVPVA ALGYS  +A +G S  +P   LP
Sbjct  795  IQVGNAVAVPVAIALGYSFGMACQGFSDDKPLTTLP  830



>gb|KFK30827.1| hypothetical protein AALP_AA6G031000 [Arabis alpina]
Length=913

 Score =   280 bits (717),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 169/218 (78%), Gaps = 12/218 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N+E+R+ M Y +   +EFQ+FIRL R+ + G            L DH PL LN+DD +
Sbjct  680  VGNDERREQMRYDNGGLTEFQKFIRLSREEMLGSSTKTSSKKEGFLFDHHPLNLNNDDAE  739

Query  657  RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RV  +PK KGANFR+ PGV V+ +N V +DP+V RV LSSG PLVPDYAM+FV GTSSKP
Sbjct  740  RVSRVPKEKGANFRNFPGVIVLPNNVVAFDPDVPRVLLSSGAPLVPDYAMTFVKGTSSKP  799

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F R+WWDETVPTVVTRAEPHNQ I+HP Q RVLTIRENARLQGFPDYY+L GP K++Y+Q
Sbjct  800  FGRIWWDETVPTVVTRAEPHNQVIIHPDQHRVLTIRENARLQGFPDYYRLFGPTKQKYMQ  859

Query  300  VGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
            VGNAVAVPVARALGYSL +AF+G++ G EP F LPEG+
Sbjct  860  VGNAVAVPVARALGYSLGMAFQGIAIGDEPLFTLPEGF  897



>emb|CDX97957.1| BnaA06g07080D [Brassica napus]
Length=788

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 161/215 (75%), Gaps = 11/215 (5%)
 Frame = -1

Query  801  NNEKRDDMEYVDKPGSEFQQFIRLGR----------DGLPGIVLHDHRPLQLNDDDYQRV  652
            N EK D+ +Y  +P + FQ FIRL R          D     +L+DH+PL+LNDDD +RV
Sbjct  561  NYEKTDERKYDTRPQTNFQNFIRLSRAESIIPLDGGDASKSRILYDHQPLELNDDDLERV  620

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            CHI K KGANFRDLPGV V  DNKV +DP+VER  L SGK LVPDYA+SFV G S KPF 
Sbjct  621  CHIVKKKGANFRDLPGVIVDEDNKVKFDPSVERPKLKSGKFLVPDYAVSFVNGKSKKPFG  680

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HPLQDRVLT+RENAR+QGFPD+YKLCGPIKE+YIQVG
Sbjct  681  RLWWDEIVHTVVTRAEPHNQIVIHPLQDRVLTVRENARIQGFPDFYKLCGPIKEKYIQVG  740

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            NAVAVPV  ALGY+  LA +GL+  +P   LP  Y
Sbjct  741  NAVAVPVGVALGYAFGLASQGLTDNQPVIKLPFQY  775



>ref|XP_002448525.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
 gb|EES12853.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
Length=913

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/232 (63%), Positives = 171/232 (74%), Gaps = 15/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN++ ++ MEY   P +EFQ++IRL R  +             G +L DH+PL+LN+DD
Sbjct  670  VENHQPKEVMEYGGSPKTEFQRYIRLSRKDMLDWSFGEEAGPDKGKLL-DHQPLRLNNDD  728

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GV+V  +N V WDP +ERV LSSGKPLVPDYAMSF+ G S 
Sbjct  729  YERVQQIPVKKGANFRDLKGVKVGANNIVEWDPEIERVKLSSGKPLVPDYAMSFIKGKSL  788

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  789  KPFGRLWWDETVPTVVTRAEPHNQIILHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  848

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAA  154
            IQVGNAVAVPVARALGY L  A+ G S G  P + LP  +  +  T V++ A
Sbjct  849  IQVGNAVAVPVARALGYCLGQAYLGESEGSHPLYQLPPSFTALGRTAVQARA  900



>ref|XP_009148471.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Brassica 
rapa]
Length=786

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 161/215 (75%), Gaps = 11/215 (5%)
 Frame = -1

Query  801  NNEKRDDMEYVDKPGSEFQQFIRLGR----------DGLPGIVLHDHRPLQLNDDDYQRV  652
            N EK D+ +Y  +P + FQ FIRL R          D     +L+DH+PL+LNDDD +RV
Sbjct  559  NYEKTDERKYDTRPQTNFQNFIRLSRAESIIPLDGGDASKSRILYDHQPLELNDDDLERV  618

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            CHI K KGANFRDLPGV V  DNKV +DP+VER  L SGK LVPDYA+SFV G S KPF 
Sbjct  619  CHIVKKKGANFRDLPGVIVDEDNKVKFDPSVERPKLKSGKFLVPDYAVSFVNGKSKKPFG  678

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HPLQDRVLT+RENAR+QGFPD+YKLCGPIKE+YIQVG
Sbjct  679  RLWWDEIVHTVVTRAEPHNQIVIHPLQDRVLTVRENARIQGFPDFYKLCGPIKEKYIQVG  738

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            NAVAVPV  ALGY+  LA +GL+  +P   LP  Y
Sbjct  739  NAVAVPVGVALGYAFGLASQGLTDNQPVIKLPFQY  773



>pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT2|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT4|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
 pdb|4FT4|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
Length=784

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 166/225 (74%), Gaps = 15/225 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            V+N++  D MEY   P +EFQ++IRL R  +             G +L DH+PL+LN+DD
Sbjct  540  VQNHQPNDVMEYGGSPKTEFQRYIRLSRKDMLDWSFGEGAGPDEGKLL-DHQPLRLNNDD  598

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GVRV  +N V WDP +ERV LSSGKPLVPDYAMSF+ G S 
Sbjct  599  YERVQQIPVKKGANFRDLKGVRVGANNIVEWDPEIERVKLSSGKPLVPDYAMSFIKGKSL  658

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ I+HP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  659  KPFGRLWWDETVPTVVTRAEPHNQVIIHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  718

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAA  175
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +  
Sbjct  719  IQVGNAVAVPVARALGYCLGQAYLGESEGSDPLYQLPPSFTSVGG  763



>emb|CDY19364.1| BnaC05g08730D [Brassica napus]
Length=796

 Score =   276 bits (707),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 161/215 (75%), Gaps = 11/215 (5%)
 Frame = -1

Query  801  NNEKRDDMEYVDKPGSEFQQFIRLGR----------DGLPGIVLHDHRPLQLNDDDYQRV  652
            N EK D+ +Y  KP S FQ+FIRL R          D     +L+DH+PL+LNDDD +RV
Sbjct  569  NYEKNDERKYDTKPQSNFQKFIRLSRAESILPLDGGDASKSRLLYDHQPLELNDDDLERV  628

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C I K KGANFRDLPGV V  DNKV +DP+VER  L SGK LVPDYA+SFV G S KPF 
Sbjct  629  CQIVKKKGANFRDLPGVIVDEDNKVKFDPSVERPKLKSGKFLVPDYAVSFVNGKSKKPFG  688

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HPLQDRVLT+RENAR+QGFPD+YKLCGPIKE+YIQVG
Sbjct  689  RLWWDEIVHTVVTRAEPHNQIVIHPLQDRVLTVRENARIQGFPDFYKLCGPIKEKYIQVG  748

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            NAVAVPV  ALGY+  LA +GL+  +P   LP  Y
Sbjct  749  NAVAVPVGVALGYAFGLASQGLTDNQPVIKLPFLY  783



>ref|XP_004987095.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 
1-like [Setaria italica]
Length=1608

 Score =   283 bits (724),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 167/219 (76%), Gaps = 13/219 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
            V NN+ +D M+++  P +EFQ++IRL R  +               L DH+PL+LNDDDY
Sbjct  746  VGNNQPKDVMDFIVGPKTEFQRYIRLNRKAMMDYSFDGEASSGESKLFDHQPLRLNDDDY  805

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GV+V ++N V WDP+V RV LSSGKPLVPDYAMSF+ G S K
Sbjct  806  ERVQQIPLKKGANFRDLKGVKVGINNTVEWDPDVPRVLLSSGKPLVPDYAMSFIKGKSLK  865

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLTIRENARLQGFPDYYKL GPIK++Y+
Sbjct  866  PFGRLWWDETVPTVVTRAEPHNQIILHPSQARVLTIRENARLQGFPDYYKLFGPIKQKYM  925

Query  303  QVGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGY  190
            QVGNAVAVPVARALGYSL +A+ G L G  P F LP+ +
Sbjct  926  QVGNAVAVPVARALGYSLGMAYMGRLDGDGPLFKLPKSF  964



>ref|XP_006417360.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
 gb|ESQ35713.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
Length=784

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 160/214 (75%), Gaps = 10/214 (5%)
 Frame = -1

Query  801  NNEKRDDMEYVDKPGSEFQQFIRLGR----------DGLPGIVLHDHRPLQLNDDDYQRV  652
            N E++D   Y   P ++FQ+FIRL R          +     +L+DH+PLQLNDDDY+RV
Sbjct  558  NCEEKDKRNYGTVPQTDFQKFIRLSRAESLIPCDGGEASQSRMLYDHQPLQLNDDDYERV  617

Query  651  CHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
            C I K KGANFRDL GV V DN+V +DP+VER  L SGK LVPDYAM+FV G S KPF R
Sbjct  618  CRIEKKKGANFRDLGGVLVKDNRVKFDPSVERPKLKSGKFLVPDYAMTFVNGRSKKPFGR  677

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
            LWWDE V TVVTRAEPHNQ I+HPLQDRVLT+RENARLQGFPD+YKLCGPIK++YIQVGN
Sbjct  678  LWWDEIVNTVVTRAEPHNQNIIHPLQDRVLTVRENARLQGFPDFYKLCGPIKQKYIQVGN  737

Query  291  AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            AVAVPV  ALGY+  LA +GLS  +P   LP  Y
Sbjct  738  AVAVPVGVALGYAFGLASQGLSDDKPVIKLPFKY  771



>gb|AFW59438.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
Length=915

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 167/231 (72%), Gaps = 15/231 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            V+N++  D MEY   P +EFQ++IRL R  +             G +L DH+PL+LN+DD
Sbjct  671  VQNHQPNDVMEYGGSPKTEFQRYIRLSRKDMLDWSFGEGAGPDEGKLL-DHQPLRLNNDD  729

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GVRV  +N V WDP +ERV LSSGKPLVPDYAMSF+ G S 
Sbjct  730  YERVQQIPVKKGANFRDLKGVRVGANNIVEWDPEIERVKLSSGKPLVPDYAMSFIKGKSL  789

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ I+HP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  790  KPFGRLWWDETVPTVVTRAEPHNQVIIHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  849

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESA  157
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +       A
Sbjct  850  IQVGNAVAVPVARALGYCLGQAYLGESEGSDPLYQLPPSFTSVGGRTAGQA  900



>ref|NP_001104978.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
 sp|Q9AXT8.1|CMT1_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 1; AltName: 
Full=Chromomethylase 1; AltName: Full=DNA cytosine methyltransferase 
MET2a; AltName: Full=Zea methyltransferase2; Short=Zmet2 
[Zea mays]
 gb|AAK11516.1|AF243043_1 DNA cytosine methyltransferase MET2a [Zea mays]
 gb|ACX48824.1| chromomethylase [Zea mays]
Length=912

 Score =   277 bits (708),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 167/231 (72%), Gaps = 15/231 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            V+N++  D MEY   P +EFQ++IRL R  +             G +L DH+PL+LN+DD
Sbjct  668  VQNHQPNDVMEYGGSPKTEFQRYIRLSRKDMLDWSFGEGAGPDEGKLL-DHQPLRLNNDD  726

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GVRV  +N V WDP +ERV LSSGKPLVPDYAMSF+ G S 
Sbjct  727  YERVQQIPVKKGANFRDLKGVRVGANNIVEWDPEIERVKLSSGKPLVPDYAMSFIKGKSL  786

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTVVTRAEPHNQ I+HP Q RVLTIRENARLQGFPDYY+L GPIKE+Y
Sbjct  787  KPFGRLWWDETVPTVVTRAEPHNQVIIHPTQARVLTIRENARLQGFPDYYRLFGPIKEKY  846

Query  306  IQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESA  157
            IQVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +       A
Sbjct  847  IQVGNAVAVPVARALGYCLGQAYLGESEGSDPLYQLPPSFTSVGGRTAGQA  897



>ref|XP_010666617.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Beta 
vulgaris subsp. vulgaris]
Length=832

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 161/214 (75%), Gaps = 11/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E++D+  Y   P SEFQQ+IRL R+ +              L+DHRPLQLN DDYQ
Sbjct  607  VTNYEEQDERPYEGSPVSEFQQYIRLKREDMISFNGSAEVALDCALYDHRPLQLNKDDYQ  666

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFR+LPGV V   NKV+ DP++ERV+L S KPLVPDYA+ FV GTSSKP
Sbjct  667  RVCQIPKKKGANFRNLPGVLVDSKNKVYLDPSMERVFLPSKKPLVPDYALKFVRGTSSKP  726

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETV TVVTRAEPHNQ +LHP QDRVLTIRENARLQGF D YKL G +KERYIQ
Sbjct  727  FGRLWWDETVSTVVTRAEPHNQTLLHPEQDRVLTIRENARLQGFLDCYKLYGSVKERYIQ  786

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            VGNAVA+PVA ALGY+  LA +GL+  +P   LP
Sbjct  787  VGNAVAIPVATALGYAFGLACQGLADDKPVTTLP  820



>ref|XP_002974335.1| hypothetical protein SELMODRAFT_30570, partial [Selaginella moellendorffii]
 gb|EFJ24557.1| hypothetical protein SELMODRAFT_30570, partial [Selaginella moellendorffii]
Length=773

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 160/217 (74%), Gaps = 12/217 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP----------GIVLHDHRPLQLNDDDYQ  658
            V+N E RD++ Y D P +EFQ+ IR  RD                +HDHRPL+LNDDDYQ
Sbjct  558  VKNCETRDEIPYRDGPKTEFQKRIRSARDDFAVFYGRGPRAMNSTVHDHRPLRLNDDDYQ  617

Query  657  RVCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            R C IPK KGANFRDL G+++ D N V  D  VER YL SGKPL+PDYA+SF+ G S KP
Sbjct  618  RACRIPKRKGANFRDLGGLKIKDDNSVTLDLTVEREYLPSGKPLIPDYAISFIKGRSLKP  677

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F R+WWDETVPTV+TRAEPHN  +LHP QDRVLT+RENARLQGFPD+YKL G +KERYIQ
Sbjct  678  FARMWWDETVPTVITRAEPHNHRMLHPTQDRVLTVRENARLQGFPDWYKLTGSVKERYIQ  737

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVAVPVARALG+SLAL  + L   EP   LP G+
Sbjct  738  VGNAVAVPVARALGFSLALTTQRLCK-EPRLELPAGF  773



>gb|EMS51591.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=758

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 167/226 (74%), Gaps = 14/226 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
            V+N +  + +EY  +P ++FQ++IRL R  +               L DH+PL+LN DDY
Sbjct  514  VDNCQPHEVIEYGGQPKTDFQRYIRLSRKDMLDYSFGDATCPEEGKLLDHQPLRLNQDDY  573

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RV  IP  KGANFRDLPGV+V  +N V WDP+VERVYL SGKPLVPDYAMSF+ G S K
Sbjct  574  DRVQQIPIKKGANFRDLPGVKVGANNIVEWDPDVERVYLKSGKPLVPDYAMSFIKGRSPK  633

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY++ GP+KE+YI
Sbjct  634  PFGRLWWDETVPTVVTRAEPHNQIILHPNQGRVLTVRENARLQGFPDYYRMYGPMKEKYI  693

Query  303  QVGNAVAVPVARALGYSLALAFKGL--SGMEPTFGLPEGYGEIAAT  172
            QVGNAVAVPVARALGYSL  A++G   +G +  F LP+ +  I  T
Sbjct  694  QVGNAVAVPVARALGYSLGRAYQGEVDAGYDALFVLPDSFTNIGQT  739



>gb|KJB16173.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=836

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 154/204 (75%), Gaps = 5/204 (2%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            V N+E RD   Y     +EFQ+FIRL R G+    L DH+PLQLN DDY RVCHIPK KG
Sbjct  618  VNNDESRDQRNYGTTARTEFQKFIRLRRKGM----LCDHQPLQLNPDDYDRVCHIPKKKG  673

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGV V  +N+V WD  ++RV L SGKPLVPDYAM FV G S+KPF RLW DE V
Sbjct  674  ANFRDLPGVVVGENNRVEWDTTMDRVLLKSGKPLVPDYAMKFVKGRSTKPFGRLWMDEIV  733

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
             TVVTRAEPHNQ ++HP Q+RVLTIRENARLQGFPD YKL G IKERYIQVGNAVAVPVA
Sbjct  734  NTVVTRAEPHNQTVIHPSQNRVLTIRENARLQGFPDCYKLFGTIKERYIQVGNAVAVPVA  793

Query  270  RALGYSLALAFKGLSGMEPTFGLP  199
             ALGYS  LA + L G EP   LP
Sbjct  794  IALGYSFGLACRNLCGDEPLMTLP  817



>emb|CDY14524.1| BnaC03g49350D [Brassica napus]
Length=802

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 159/216 (74%), Gaps = 10/216 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP--------GIVLHDHRPLQLNDDDYQRV  652
            V N+E+R +M Y   P + FQ+FIRL +   P          VL+DH PL LN DDYQRV
Sbjct  582  VANSERRAEMAYDKDPQTPFQRFIRLTQQASPQDSKSNSTNDVLYDHHPLNLNKDDYQRV  641

Query  651  CHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C IPK KGANFRDLPGV V   N+V  DP + R+YL S  PL+P+YA+ FV G S+KPF 
Sbjct  642  CRIPKKKGANFRDLPGVTVNGYNRVELDPKIPRIYLESSNPLIPEYAIKFVNGRSTKPFG  701

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTV+ RAEPHN  I+HP QDRVLT+RENARLQGFPDYY+L GP KE+Y QVG
Sbjct  702  RLWWDETVPTVIGRAEPHNHVIIHPSQDRVLTVRENARLQGFPDYYRLFGPTKEKYKQVG  761

Query  294  NAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGY  190
            NAVAVPVA ALG++L  AF+G  SG +P F LPEG+
Sbjct  762  NAVAVPVASALGFALGQAFQGHTSGSDPLFTLPEGF  797



>ref|XP_010236739.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=897

 Score =   275 bits (703),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 165/226 (73%), Gaps = 15/226 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            V+N +  + MEY  KP +EFQ++IRLGR  +             G +L DH+PL+LN DD
Sbjct  654  VDNYQLHEVMEYGTKPKTEFQRYIRLGRKDMLDHSFGDNTCPEEGKLL-DHQPLRLNQDD  712

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y RV  IP  KGANFRDLPG++V  +N V WDP V RVYL SGKPLVPDYAMSF+ G S 
Sbjct  713  YDRVQQIPVKKGANFRDLPGIKVGANNIVEWDPEVPRVYLKSGKPLVPDYAMSFIKGRSL  772

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETV TVVTRAEPHNQ ILHP Q RVL++RENARLQGFPDYY++ GPIKE+Y
Sbjct  773  KPFGRLWWDETVSTVVTRAEPHNQIILHPNQARVLSVRENARLQGFPDYYRMNGPIKEKY  832

Query  306  IQVGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGYGEIAAT  172
            IQVGNAVAVPVARALGYSL  A++G +    P F LP  +  +  T
Sbjct  833  IQVGNAVAVPVARALGYSLGQAYQGEMESTGPLFTLPASFTNVGQT  878



>emb|CAJ01708.1| chromomethylase 1 [Hordeum vulgare subsp. vulgare]
Length=735

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 167/232 (72%), Gaps = 14/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
            V+N +  + +EY  +P +EFQ++IRL R  +               L DH+PL+LN DDY
Sbjct  491  VDNYQPHEVIEYRGQPKTEFQRYIRLSRKDMLDYSFGDDTCPEEGKLLDHQPLRLNQDDY  550

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RV  IP  KGAN RDLPGV+V  +N V WDP VERVYL SGKPLVPDYAMSF+ G S K
Sbjct  551  DRVQQIPIKKGANSRDLPGVKVGANNIVEWDPEVERVYLKSGKPLVPDYAMSFIKGRSPK  610

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY++ GP+KE+YI
Sbjct  611  PFGRLWWDETVPTVVTRAEPHNQIILHPNQGRVLTVRENARLQGFPDYYRMNGPMKEKYI  670

Query  303  QVGNAVAVPVARALGYSLALAFKGL--SGMEPTFGLPEGYGEIAATLVESAA  154
            QVGNAVAVPVARALGYSL  A++G   +G +  F LPE +  +  T   + A
Sbjct  671  QVGNAVAVPVARALGYSLGRAYQGEVDAGHDALFVLPESFTNVGQTGARARA  722



>gb|EMT24338.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=826

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 168/232 (72%), Gaps = 14/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
            V+N +  + +EY  +P ++FQ++IRL R  +               L DH+PL+LN DDY
Sbjct  582  VDNYQPHEVIEYGGQPKTDFQRYIRLSRKDMLDYSFGDATCPEEGKLLDHQPLRLNQDDY  641

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RV  IP  KGANFRDLPGV+V  +N V WDP VERVYL SGKPLVPDYAMSF+ G S K
Sbjct  642  DRVQQIPIKKGANFRDLPGVKVGANNIVEWDPEVERVYLKSGKPLVPDYAMSFIKGRSPK  701

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY++ GP+KE+YI
Sbjct  702  PFGRLWWDETVPTVVTRAEPHNQIILHPNQGRVLTVRENARLQGFPDYYRMYGPMKEKYI  761

Query  303  QVGNAVAVPVARALGYSLALAFKGL--SGMEPTFGLPEGYGEIAATLVESAA  154
            QVGNAVAVPVARALGYSL  A++G   +G +  F LP+ +  I  T   + A
Sbjct  762  QVGNAVAVPVARALGYSLGRAYQGEVDAGYDALFVLPDSFTNIGQTGARARA  813



>ref|XP_002990857.1| hypothetical protein SELMODRAFT_132507 [Selaginella moellendorffii]
 gb|EFJ08130.1| hypothetical protein SELMODRAFT_132507 [Selaginella moellendorffii]
Length=933

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 159/217 (73%), Gaps = 12/217 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP----------GIVLHDHRPLQLNDDDYQ  658
            V+N E RD++ Y D P +EFQ  IR  RD                +HDHRPL+LNDDDYQ
Sbjct  711  VKNCETRDEIPYRDGPKTEFQTRIRSARDDFTVFYGRGPRAMNSTVHDHRPLRLNDDDYQ  770

Query  657  RVCHIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            R C IPK KGANFRDL G+++ D N V  D  VER YL SGKPL+PDYA+SF+ G S KP
Sbjct  771  RACRIPKRKGANFRDLGGLKIKDDNSVTLDLTVEREYLPSGKPLIPDYAISFIKGRSLKP  830

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F R+WWDETVPTV+TRAEPHN  +LHP QDRVLT+RENARLQGFPD+YKL G +KERYIQ
Sbjct  831  FARMWWDETVPTVITRAEPHNHRMLHPTQDRVLTVRENARLQGFPDWYKLTGSVKERYIQ  890

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            VGNAVA+PVARALGYSLAL  + L   EP   LP G+
Sbjct  891  VGNAVAMPVARALGYSLALTTQRLC-KEPRLELPAGF  926



>emb|CAS84142.1| chromomethylase [Nicotiana tomentosiformis]
Length=500

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E  D+M Y+D+P S FQ FIR  R+G  G VL+DHRPL+LN+DDYQRVC IPK KG
Sbjct  332  VENDEPTDEMPYIDEPKSAFQHFIRSRRNGTLGSVLYDHRPLRLNEDDYQRVCQIPKRKG  391

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  392  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  451

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYYKL GPIKERY+
Sbjct  452  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGFPDYYKLTGPIKERYM  500



>ref|XP_002888734.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64993.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   271 bits (694),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 168/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V+N+E+RD++ Y   P + FQQFIRL +D   G          VL+DH PL LN +DYQR
Sbjct  611  VDNSEQRDEIPYDQDPVTPFQQFIRLRKDEALGSLTKSKSKKHVLYDHHPLNLNINDYQR  670

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N VH D ++ ++ L SGK LVP+YA++FV GTSSKPF
Sbjct  671  VCRVPKRKGANFRDFPGVIVGPGNVVHLDEDM-KIMLQSGKQLVPNYALTFVDGTSSKPF  729

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE VPTVVTRAEPHNQ I+HP QDRVL+IRENARLQGFPD YKL GP K++YIQV
Sbjct  730  GRLWWDEIVPTVVTRAEPHNQVIIHPTQDRVLSIRENARLQGFPDDYKLFGPTKQKYIQV  789

Query  297  GNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATL  169
            GNAVAVPVA+ALGY+L +AF+GL+ G +P   LPEG+  +   L
Sbjct  790  GNAVAVPVAKALGYALGIAFQGLADGKDPLLTLPEGFAFMKPNL  833



>pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
 pdb|4FSX|B Chain B, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
Length=784

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 163/230 (71%), Gaps = 13/230 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRD-----------GLPGIVLHDHRPLQLNDDDY  661
            V+N++  D  EY   P +EFQ++IRL R            G     L DH+PL+LN+DDY
Sbjct  540  VQNHQPNDVXEYGGSPKTEFQRYIRLSRKDXLDWSFGEGAGPDEGKLLDHQPLRLNNDDY  599

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  +N V WDP +ERV LSSGKPLVPDYA SF+ G S K
Sbjct  600  ERVQQIPVKKGANFRDLKGVRVGANNIVEWDPEIERVKLSSGKPLVPDYAXSFIKGKSLK  659

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ I+HP Q RVLTIRENARLQGFPDYY+L GPIKE+YI
Sbjct  660  PFGRLWWDETVPTVVTRAEPHNQVIIHPTQARVLTIRENARLQGFPDYYRLFGPIKEKYI  719

Query  303  QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESA  157
            QVGNAVAVPVARALGY L  A+ G S G +P + LP  +  +       A
Sbjct  720  QVGNAVAVPVARALGYCLGQAYLGESEGSDPLYQLPPSFTSVGGRTAGQA  769



>gb|KJB16174.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=838

 Score =   269 bits (687),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 155/215 (72%), Gaps = 12/215 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N+E RD   Y     +EFQ+FIRL R  +  +           +L DH+PLQLN DDY
Sbjct  605  VNNDESRDQRNYGTTARTEFQKFIRLRRKDVINLTVDSRHAPSLGMLCDHQPLQLNPDDY  664

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVCHIPK KGANFRDLPGV V  +N+V WD  ++RV L SGKPLVPDYAM FV G S+K
Sbjct  665  DRVCHIPKKKGANFRDLPGVVVGENNRVEWDTTMDRVLLKSGKPLVPDYAMKFVKGRSTK  724

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLW DE V TVVTRAEPHNQ ++HP Q+RVLTIRENARLQGFPD YKL G IKERYI
Sbjct  725  PFGRLWMDEIVNTVVTRAEPHNQTVIHPSQNRVLTIRENARLQGFPDCYKLFGTIKERYI  784

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            QVGNAVAVPVA ALGYS  LA + L G EP   LP
Sbjct  785  QVGNAVAVPVAIALGYSFGLACRNLCGDEPLMTLP  819



>gb|KJB16168.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=851

 Score =   269 bits (688),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 155/215 (72%), Gaps = 12/215 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N+E RD   Y     +EFQ+FIRL R  +  +           +L DH+PLQLN DDY
Sbjct  618  VNNDESRDQRNYGTTARTEFQKFIRLRRKDVINLTVDSRHAPSLGMLCDHQPLQLNPDDY  677

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVCHIPK KGANFRDLPGV V  +N+V WD  ++RV L SGKPLVPDYAM FV G S+K
Sbjct  678  DRVCHIPKKKGANFRDLPGVVVGENNRVEWDTTMDRVLLKSGKPLVPDYAMKFVKGRSTK  737

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLW DE V TVVTRAEPHNQ ++HP Q+RVLTIRENARLQGFPD YKL G IKERYI
Sbjct  738  PFGRLWMDEIVNTVVTRAEPHNQTVIHPSQNRVLTIRENARLQGFPDCYKLFGTIKERYI  797

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            QVGNAVAVPVA ALGYS  LA + L G EP   LP
Sbjct  798  QVGNAVAVPVAIALGYSFGLACRNLCGDEPLMTLP  832



>ref|XP_006390678.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
 gb|ESQ27964.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
Length=774

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 158/212 (75%), Gaps = 11/212 (5%)
 Frame = -1

Query  801  NNEKRDDMEYVDKPGSEFQQFIRLGR----------DGLPGIVLHDHRPLQLNDDDYQRV  652
            N E++D+  Y  +P ++FQ+FI L R          D      L+DH+PLQLN+DD++RV
Sbjct  524  NCEEKDERSYETEPQTDFQKFISLTRADSLIPMGGGDASQSRKLYDHQPLQLNEDDFERV  583

Query  651  CHIPKAKGANFRDLPGVRVVDNK-VHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            C I K KGANFR L GV V DN  V +DP+VER  L SGK LVPDYA+SF  GTS+KPF 
Sbjct  584  CQIEKKKGANFRSLAGVLVRDNNTVKFDPSVERPKLKSGKYLVPDYAVSFKNGTSTKPFG  643

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRA+PHNQ ++HPLQDRVLT+RENARLQGFPD+YKLCGPIKE+Y QVG
Sbjct  644  RLWWDEIVNTVVTRAQPHNQTLIHPLQDRVLTVRENARLQGFPDFYKLCGPIKEKYCQVG  703

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            NAVAVPV  ALGY+  +A +GLSG +P   LP
Sbjct  704  NAVAVPVGIALGYAYGMASQGLSGDQPVIKLP  735



>ref|XP_007041239.1| Chromomethylase 1, putative [Theobroma cacao]
 gb|EOX97070.1| Chromomethylase 1, putative [Theobroma cacao]
Length=844

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 158/215 (73%), Gaps = 12/215 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N+E  D  +Y     +EFQ++IRL R  +  +           +L+DHRPLQLN DDY
Sbjct  611  VNNDESVDQRKYGKVARTEFQKYIRLQRKDVINLTVDTPHASSLGMLYDHRPLQLNADDY  670

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RVC +PK KGANFRDLPGV V  +N+V WD  +ERV L SGKPLVPDYAM FV G S+K
Sbjct  671  ERVCRVPKRKGANFRDLPGVIVGENNRVEWDTTMERVKLKSGKPLVPDYAMKFVKGRSTK  730

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLW DE V TVVTRA+PHNQ+ILHP QDRVLTIRENARLQGFPD YKL G IKERYI
Sbjct  731  PFGRLWMDEIVKTVVTRAKPHNQSILHPSQDRVLTIRENARLQGFPDCYKLFGSIKERYI  790

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            QVGNAVAVPVA ALGY+  LA +G+S  EP   LP
Sbjct  791  QVGNAVAVPVAIALGYAFGLACRGVSDDEPLMILP  825



>ref|XP_003615342.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES98300.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=800

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 158/215 (73%), Gaps = 9/215 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL---------PGIVLHDHRPLQLNDDDYQR  655
            +ENNE RDDM+Y      +FQ+FIRL +  +         P  +LHD R  ++N DDYQ 
Sbjct  566  IENNESRDDMDYCGPLLIDFQKFIRLSQSEILGGSIKKKSPKSMLHDRRSYEMNFDDYQC  625

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C IPK KGA FRDLP VR+ + KV  +P+V+R +L+SGKPLVP+YA++FV GTS  PF 
Sbjct  626  ACRIPKRKGACFRDLPCVRMQNKKVKLNPDVKREFLASGKPLVPNYAITFVCGTSPLPFA  685

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            R+WWD+TVPTVVTRAEPHNQ ILHP QDRVL+IR NARLQGFPD+YKLCG  KERYIQVG
Sbjct  686  RIWWDKTVPTVVTRAEPHNQKILHPEQDRVLSIRGNARLQGFPDFYKLCGSSKERYIQVG  745

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            NAVAVPV RAL Y L LA +G S   P + LP+ +
Sbjct  746  NAVAVPVGRALRYCLGLASQGASADGPLYTLPDQF  780



>gb|EEE58631.1| hypothetical protein OsJ_09996 [Oryza sativa Japonica Group]
Length=1033

 Score =   268 bits (685),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 161/219 (74%), Gaps = 13/219 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
             V N++ +D +EY   P +EFQ++IR  R  +               L DH+PL+LN DDY
Sbjct  787   VGNDQPKDVIEYSVAPKTEFQRYIRNNRKDIQDYSFRGDDPSEEGKLFDHQPLKLNKDDY  846

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             +RV  IP  KGANFRDL GV V  DN V  DPN+ R  LSSGKPLVPDYA+SFV G S+K
Sbjct  847   ERVQRIPVKKGANFRDLKGVIVGPDNTVRLDPNISRERLSSGKPLVPDYAISFVKGKSTK  906

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYY+L GP+KE+YI
Sbjct  907   PFGRLWWDETVPTVVTRAEPHNQIILHPSQDRVLTIRENARLQGFPDYYRLIGPLKEKYI  966

Query  303   QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
             QVGNAVA+PVARALGY+L LA++G S G      LPE +
Sbjct  967   QVGNAVAIPVARALGYALGLAYRGESDGDRAVLKLPESF  1005



>ref|XP_010230204.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=956

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 159/209 (76%), Gaps = 12/209 (6%)
 Frame = -1

Query  780  MEYVDKPGSEFQQFIRLGR---------DGLPGIV-LHDHRPLQLNDDDYQRVCHIPKAK  631
            ME+   P +EFQ +IRL R         D  P    L DH+PL+LN+DDY+RV  IP  K
Sbjct  724  MEHRINPKTEFQHYIRLNRKDMKDYSFGDAAPEEAQLFDHQPLELNEDDYERVQQIPVKK  783

Query  630  GANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDET  454
            GANFRDL GV+V  DN V +DP++ RV LSSGKPLVPDYAM+++ G S KPF RLWWDET
Sbjct  784  GANFRDLIGVQVREDNTVEFDPDMARVLLSSGKPLVPDYAMTYIKGKSLKPFGRLWWDET  843

Query  453  VPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPV  274
            VPTVVTRAEPHNQ ILHP Q+RV+TIRENARLQGFPDYY+L GPIK++YIQVGNAVAVPV
Sbjct  844  VPTVVTRAEPHNQIILHPTQNRVMTIRENARLQGFPDYYRLFGPIKQKYIQVGNAVAVPV  903

Query  273  ARALGYSLALAF-KGLSGMEPTFGLPEGY  190
            ARALGYSL  A+ +   G +P F LPE +
Sbjct  904  ARALGYSLGRAYRREFDGDQPLFKLPESF  932



>ref|XP_006431407.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
 gb|ESR44647.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
Length=859

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 166/235 (71%), Gaps = 16/235 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V NNE  D+ +Y     +EFQ++IRL R  +  +          +L+DHRP Q+N+DDY+
Sbjct  625  VTNNESEDERKYGTVARTEFQKYIRLRRHDVVNLSSAQMASRPSLLYDHRPFQVNNDDYE  684

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DNKV WDP++ERV L SGKPLVPDYAM F   +S+KP
Sbjct  685  RVCCIPKRKGANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKP  744

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE V TVVTRA+PHN+ +LHP QDRVLTIRENARLQGFPD Y+L GP+KERYIQ
Sbjct  745  FGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYQLFGPVKERYIQ  804

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEP-----TFGLPEGYGEIAATLVESAAE  151
            VGNAVAVPV  ALGY+   A +GL+  +       F  P    + ++TL E  ++
Sbjct  805  VGNAVAVPVGIALGYAFGQACQGLADDDQPLTTLPFKFPNCLAQSSSTLAEEDSD  859



>dbj|BAF01425.1| putative chromomethylase [Arabidopsis thaliana]
Length=839

 Score =   263 bits (672),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 163/224 (73%), Gaps = 11/224 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N+EKRD++ Y   P + FQ+FIRL +D   G          VL+DH PL LN +DY+R
Sbjct  611  VANSEKRDEITYDKDPTTPFQKFIRLRKDEASGSQSKSKSKKHVLYDHHPLNLNINDYER  670

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N V  +   ERV L SGK LVPDYA+++V G S KPF
Sbjct  671  VCQVPKRKGANFRDFPGVIVGPGNVVKLEEGKERVKLESGKTLVPDYALTYVDGKSCKPF  730

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE VPTVVTRAEPHNQ I+HP Q+RVL+IRENARLQGFPD YKL GP K++YIQV
Sbjct  731  GRLWWDEIVPTVVTRAEPHNQVIIHPEQNRVLSIRENARLQGFPDDYKLFGPPKQKYIQV  790

Query  297  GNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATL  169
            GNAVAVPVA+ALGY+L  AF+GL+ G +P   LPEG+  +  TL
Sbjct  791  GNAVAVPVAKALGYALGTAFQGLAVGKDPLLTLPEGFAFMKPTL  834



>gb|AAK69756.1|AF383170_1 chromomethylase CMT3 [Arabidopsis thaliana]
Length=839

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 163/224 (73%), Gaps = 11/224 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N+EKRD++ Y   P + FQ+FIRL +D   G          VL+DH PL LN +DY+R
Sbjct  611  VANSEKRDEITYDKDPTTPFQKFIRLRKDEASGSQSKSKSKKHVLYDHHPLNLNINDYER  670

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N V  +   ERV L SGK LVPDYA+++V G S KPF
Sbjct  671  VCQVPKRKGANFRDFPGVIVGPGNVVKLEEGKERVKLESGKTLVPDYALTYVDGKSCKPF  730

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE VPTVVTRAEPHNQ I+HP Q+RVL+IRENARLQGFPD YKL GP K++YIQV
Sbjct  731  GRLWWDEIVPTVVTRAEPHNQVIIHPEQNRVLSIRENARLQGFPDDYKLFGPPKQKYIQV  790

Query  297  GNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATL  169
            GNAVAVPVA+ALGY+L  AF+GL+ G +P   LPEG+  +  TL
Sbjct  791  GNAVAVPVAKALGYALGTAFQGLAVGKDPLLTLPEGFAFMKPTL  834



>ref|NP_177135.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
 sp|Q94F88.2|CMT3_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT3; AltName: 
Full=Chromomethylase 3; AltName: Full=Protein CHROMOMETHYLASE 
3 [Arabidopsis thaliana]
 gb|AAG52543.1|AC013289_10 putative chromomethylase; 17383-22406 [Arabidopsis thaliana]
 gb|AEE34973.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
Length=839

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 163/224 (73%), Gaps = 11/224 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N+EKRD++ Y   P + FQ+FIRL +D   G          VL+DH PL LN +DY+R
Sbjct  611  VANSEKRDEITYDKDPTTPFQKFIRLRKDEASGSQSKSKSKKHVLYDHHPLNLNINDYER  670

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N V  +   ERV L SGK LVPDYA+++V G S KPF
Sbjct  671  VCQVPKRKGANFRDFPGVIVGPGNVVKLEEGKERVKLESGKTLVPDYALTYVDGKSCKPF  730

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE VPTVVTRAEPHNQ I+HP Q+RVL+IRENARLQGFPD YKL GP K++YIQV
Sbjct  731  GRLWWDEIVPTVVTRAEPHNQVIIHPEQNRVLSIRENARLQGFPDDYKLFGPPKQKYIQV  790

Query  297  GNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATL  169
            GNAVAVPVA+ALGY+L  AF+GL+ G +P   LPEG+  +  TL
Sbjct  791  GNAVAVPVAKALGYALGTAFQGLAVGKDPLLTLPEGFAFMKPTL  834



>gb|EEC74798.1| hypothetical protein OsI_10599 [Oryza sativa Indica Group]
Length=1760

 Score =   268 bits (684),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 161/219 (74%), Gaps = 13/219 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
             V N++ +D +EY   P +EFQ++IR  R  +               L DH+PL+LN DDY
Sbjct  787   VGNDQPKDVIEYSVAPKTEFQRYIRNNRKDIQDYSFRGDDPSEEGKLFDHQPLKLNKDDY  846

Query  660   QRVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             +RV  IP  KGANFRDL GV V  DN V  DPN+ R  LSSGKPLVPDYA+SFV G S+K
Sbjct  847   ERVQRIPVKKGANFRDLKGVIVGPDNTVRLDPNISRERLSSGKPLVPDYAISFVKGKSTK  906

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYY+L GP+KE+YI
Sbjct  907   PFGRLWWDETVPTVVTRAEPHNQIILHPSQDRVLTIRENARLQGFPDYYRLIGPLKEKYI  966

Query  303   QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
             QVGNAVA+PVARALGY+L LA++G S G      LPE +
Sbjct  967   QVGNAVAIPVARALGYALGLAYRGESDGDRAVLKLPESF  1005



>gb|AAN60988.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
 gb|ABF94750.1| C-5 cytosine-specific DNA methylase family protein, expressed 
[Oryza sativa Japonica Group]
Length=1761

 Score =   268 bits (684),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 161/219 (74%), Gaps = 13/219 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
             V N++ +D +EY   P +EFQ++IR  R  +               L DH+PL+LN DDY
Sbjct  787   VGNDQPKDVIEYSVAPKTEFQRYIRNNRKDIQDYSFRGDDPSEEGKLFDHQPLKLNKDDY  846

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             +RV  IP  KGANFRDL GV V  DN V  DPN+ R  LSSGKPLVPDYA+SFV G S+K
Sbjct  847   ERVQRIPVKKGANFRDLKGVIVGPDNTVRLDPNISRERLSSGKPLVPDYAISFVKGKSTK  906

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYY+L GP+KE+YI
Sbjct  907   PFGRLWWDETVPTVVTRAEPHNQIILHPSQDRVLTIRENARLQGFPDYYRLIGPLKEKYI  966

Query  303   QVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGY  190
             QVGNAVA+PVARALGY+L LA++G S G      LPE +
Sbjct  967   QVGNAVAIPVARALGYALGLAYRGESDGDRAVLKLPESF  1005



>ref|XP_009781267.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X4 [Nicotiana sylvestris]
Length=859

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 142/167 (85%), Gaps = 1/167 (1%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            VEN+E +D+M Y+D+P S FQ FIR  RDG  G VL+DHRPL+LN+DDY+RVC IPK KG
Sbjct  693  VENDEPKDEMPYIDEPKSAFQHFIRSRRDGTLGSVLYDHRPLRLNEDDYERVCQIPKRKG  752

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGVRV  +N V  DP+VERV ++SGKPLVPDYA++FV GTS+KPF RLWWDE V
Sbjct  753  ANFRDLPGVRVRANNTVELDPDVERVKVASGKPLVPDYAITFVRGTSTKPFGRLWWDEIV  812

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKER  310
            PTVVTRAEPHNQ ILHP QDRVLTIRENARLQG PDYYKL GPIKER
Sbjct  813  PTVVTRAEPHNQVILHPEQDRVLTIRENARLQGLPDYYKLTGPIKER  859



>gb|AAK71870.1| chromomethylase 3 [Arabidopsis thaliana]
Length=839

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 163/224 (73%), Gaps = 11/224 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V N+EKRD++ Y   P + FQ+FIRL +D   G          VL+DH PL LN +DY+R
Sbjct  611  VANSEKRDEITYDKDPTTPFQKFIRLRKDEASGSQSKSKSKKHVLYDHHPLNLNINDYER  670

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC +PK KGANFRD PGV V   N V  +   ERV L SGK LVPDYA+++V G S KPF
Sbjct  671  VCQVPKRKGANFRDFPGVIVGPGNVVKLEEGKERVKLESGKTLVPDYALTYVDGKSCKPF  730

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDE VPTVVTRAEPHNQ I+HP Q+RVL+IRENARLQGFPD YKL GP K++YIQV
Sbjct  731  GRLWWDEIVPTVVTRAEPHNQVIIHPEQNRVLSIRENARLQGFPDDYKLFGPPKQKYIQV  790

Query  297  GNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATL  169
            GNAVAVPVA+ALGY+L  AF+GL+ G +P   LPEG+  +  TL
Sbjct  791  GNAVAVPVAKALGYALGTAFQGLAVGKDPLIILPEGFAFMKPTL  834



>ref|XP_011459545.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 
CMT3-like [Fragaria vesca subsp. vesca]
Length=800

 Score =   260 bits (664),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 163/215 (76%), Gaps = 22/215 (10%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLP--------GIVLHDHRPLQLNDDDYQRV  652
            VEN+EK+D+M Y   P ++FQ+ IRLG++ +            L+DHRPL+LN+DD++RV
Sbjct  586  VENSEKQDEMPYAGPPKTDFQKCIRLGKNYVLQHSVSQSWNKTLYDHRPLELNEDDHERV  645

Query  651  CHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
            C +PK KGANFR+L G+R             R YL+S KP+VP YA S+  G S+KPF R
Sbjct  646  CLVPKEKGANFRNLLGIR-------------RKYLASRKPVVPKYARSYRKGRSNKPFAR  692

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
            LWWDETVPTVVTRAEPHNQAILHP+QDRVL+IRENARLQGFPDYYKL GP+K+RYIQVGN
Sbjct  693  LWWDETVPTVVTRAEPHNQAILHPVQDRVLSIRENARLQGFPDYYKLSGPVKQRYIQVGN  752

Query  291  AVAVPVARALGYSLALAFKGLSGM-EPTFGLPEGY  190
            AVAVPV+R+LGY+L LA +G+S   EP F LP+ +
Sbjct  753  AVAVPVSRSLGYALGLAIRGISDNDEPLFTLPKKF  787



>ref|XP_006300392.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
 gb|EOA33290.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
Length=865

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 161/222 (73%), Gaps = 13/222 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            + N+E RD++ Y   P + FQQFIRL +D   G          VL+DH PL LN DDYQR
Sbjct  642  IANSEVRDEIPYDKNPETPFQQFIRLRKDEKLGSSKNSKSKKPVLYDHHPLNLNKDDYQR  701

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            VC +PK KGANFRD PGV V    V        VYL SGK LVP YA++FV GTS+KPF 
Sbjct  702  VCSVPKRKGANFRDFPGVVVGPGNVVHMDESRSVYLESGKSLVPYYAVNFVDGTSTKPFG  761

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETVPTVVTRAEPHNQ I+HP QDRVL+IRENARLQGFPD YKL GP K++YIQVG
Sbjct  762  RLWWDETVPTVVTRAEPHNQVIIHPQQDRVLSIRENARLQGFPDDYKLFGPTKQKYIQVG  821

Query  294  NAVAVPVARALGYSLALAFKGLS----GMEPTFGLPEGYGEI  181
            NAVAVPVA+ALGY+LA+AF+GL+    G  P F LP+G+  +
Sbjct  822  NAVAVPVAKALGYALAMAFQGLTVGDEGDYPLFTLPQGFAHM  863



>ref|XP_006470820.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Citrus 
sinensis]
Length=845

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/231 (58%), Positives = 164/231 (71%), Gaps = 16/231 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V NNE  D+ +Y     ++FQ++IRL R+ +  +          +L+DHRP Q+N+DDY+
Sbjct  611  VTNNESEDERKYGTIARTDFQKYIRLRRNDVVNLSSVQMASRPSLLYDHRPFQVNNDDYE  670

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RV  IPK KGANFRDLPGV V  DNKV WDP++ERV L SGKPLVPDYAM F   +S+KP
Sbjct  671  RVSRIPKKKGANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKP  730

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE V TVVTRA+PHN+ +LHP QDRVLTIRENARLQGFPD Y+L GP+KERYIQ
Sbjct  731  FGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYRLFGPVKERYIQ  790

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEP-----TFGLPEGYGEIAATLVE  163
            VGNAVAVPV  ALGY+   A +GL+  +       F  P    + ++TL +
Sbjct  791  VGNAVAVPVGIALGYAFGQACQGLADDDQPLTTLPFKFPNCLAQSSSTLAD  841



>ref|XP_010091206.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
 gb|EXB43461.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
Length=851

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 159/215 (74%), Gaps = 12/215 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            +EN+E RD+  Y  +  ++FQ++IRL R+ + GI           +L DHRP +LNDDDY
Sbjct  617  IENDESRDERPYDGEALTKFQKYIRLNREEVIGIEGVTTSSLKSGMLFDHRPRKLNDDDY  676

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IPK KGANFRDLPGV V  DN V+ D  + R  ++SGK LVPDYA+ FVGG S+K
Sbjct  677  ERVQSIPKKKGANFRDLPGVLVGSDNIVYLDSTIPRPMVASGKFLVPDYAIKFVGGRSTK  736

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF R+WWDE + TVVTRAEPHNQAI+HP QDRVL++RE ARLQGFPD+YK CGPIKERYI
Sbjct  737  PFGRVWWDEIIATVVTRAEPHNQAIVHPQQDRVLSVRELARLQGFPDFYKFCGPIKERYI  796

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            Q+GNAV+VPV  ALGY+L  A +GL G  P   LP
Sbjct  797  QIGNAVSVPVGIALGYTLGQACQGLCGDHPLTELP  831



>ref|XP_010449422.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Camelina 
sativa]
Length=1242

 Score =   258 bits (659),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 156/216 (72%), Gaps = 10/216 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E R+ M Y   P ++FQ++IR  ++ L G          ++LHDHRP  +N+DDY 
Sbjct  1013  VSNDEDREKMPYESLPQTDFQRYIRSTKNDLTGSPTDNCNKRTMLLHDHRPFHVNEDDYA  1072

Query  657   RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             RVC IPK KGANFRDLPG+ V +N V  DP++E V L SGK LVP+Y  +F  G S +PF
Sbjct  1073  RVCQIPKRKGANFRDLPGLIVRNNTVCRDPSMEPVILPSGKSLVPEYVFTFQQGKSKRPF  1132

Query  477   RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
              RLWWDETVPTV+T    HNQA+LHP QDR+LTIRE+ARLQGFPDY++ CG +K+RY Q+
Sbjct  1133  ARLWWDETVPTVLTVPSCHNQALLHPEQDRMLTIRESARLQGFPDYFQFCGTMKQRYCQI  1192

Query  297   GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             GNAVAV V+RALGYSL +AF+ L+G E    LP+ +
Sbjct  1193  GNAVAVSVSRALGYSLGMAFRDLAGDEHLIKLPQNF  1228



>ref|XP_002870005.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46264.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
Length=1253

 Score =   258 bits (659),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 155/217 (71%), Gaps = 10/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E R+ + Y   P ++FQ++IR  +  L G          ++LHDHRP  +N+DDY 
Sbjct  1024  VSNDEDREKLPYESPPETDFQRYIRSTKRDLTGSATDNSNKRKMLLHDHRPFHINEDDYA  1083

Query  657   RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             RVC IPK KGANFRDLPG+ V +N V  DP++E V L SGKPLVP Y  +F  G S +PF
Sbjct  1084  RVCQIPKRKGANFRDLPGLIVRNNTVCRDPSMEPVILPSGKPLVPGYVFNFQQGKSKRPF  1143

Query  477   RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
              RLWWDETVPTV+T    H+QA+LHP QDR+LTIRE+ARLQGFPDY++ CG IKERY Q+
Sbjct  1144  ARLWWDETVPTVLTVPTCHSQALLHPEQDRMLTIRESARLQGFPDYFQFCGTIKERYCQI  1203

Query  297   GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             GNAVAV V+RALGYSL +AF+GL+  E    LP+ + 
Sbjct  1204  GNAVAVSVSRALGYSLGMAFRGLASGEHLIKLPQNFS  1240



>ref|NP_193637.2| chromomethylase 2 [Arabidopsis thaliana]
 sp|Q94F87.3|CMT2_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT2; AltName: 
Full=Chromomethylase 2; AltName: Full=Protein CHROMOMETHYLASE 
2 [Arabidopsis thaliana]
 gb|AEE84126.1| chromomethylase 2 [Arabidopsis thaliana]
Length=1295

 Score =   258 bits (660),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 155/217 (71%), Gaps = 10/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E R+ + Y   P ++FQ++IR  +  L G          ++LHDHRP  +N+DDY 
Sbjct  1066  VSNDEDREKLPYESLPKTDFQRYIRSTKRDLTGSAIDNCNKRTMLLHDHRPFHINEDDYA  1125

Query  657   RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             RVC IPK KGANFRDLPG+ V +N V  DP++E V L SGKPLVP Y  +F  G S +PF
Sbjct  1126  RVCQIPKRKGANFRDLPGLIVRNNTVCRDPSMEPVILPSGKPLVPGYVFTFQQGKSKRPF  1185

Query  477   RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
              RLWWDETVPTV+T    H+QA+LHP QDRVLTIRE+ARLQGFPDY++ CG IKERY Q+
Sbjct  1186  ARLWWDETVPTVLTVPTCHSQALLHPEQDRVLTIRESARLQGFPDYFQFCGTIKERYCQI  1245

Query  297   GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             GNAVAV V+RALGYSL +AF+GL+  E    LP+ + 
Sbjct  1246  GNAVAVSVSRALGYSLGMAFRGLARDEHLIKLPQNFS  1282



>gb|AAK69757.1|AF383171_1 chromomethylase CMT2 [Arabidopsis thaliana]
Length=1244

 Score =   257 bits (657),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 154/217 (71%), Gaps = 10/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E R+ + Y   P ++FQ++IR  +  L G          ++LHDHRP  +N+DDY 
Sbjct  1015  VSNDEDREKLPYESLPKTDFQRYIRSTKRDLTGSAIDNCNKRTMLLHDHRPFHINEDDYA  1074

Query  657   RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             RVC IP  KGANFRDLPG+ V +N V  DP++E V L SGKPLVP Y  +F  G S +PF
Sbjct  1075  RVCQIPNRKGANFRDLPGIIVRNNTVCRDPSMEPVILPSGKPLVPGYVFTFQQGKSKRPF  1134

Query  477   RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
              RLWWDETVPTV+T    H+QA+LHP QDRVLTIRE+ARLQGFPDY++ CG IKERY Q+
Sbjct  1135  ARLWWDETVPTVLTVPTCHSQALLHPEQDRVLTIRESARLQGFPDYFQFCGTIKERYCQI  1194

Query  297   GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             GNAVAV V+RALGYSL +AF+GL+  E    LP+ + 
Sbjct  1195  GNAVAVSVSRALGYSLGMAFRGLARDEHLIKLPQNFS  1231



>emb|CBI26560.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   253 bits (647),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 160/230 (70%), Gaps = 14/230 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V NNE R+ M Y   P +EFQ++IR  +  + G            VL+DH PL LN+DDY
Sbjct  615  VSNNETREQMSYRRPPETEFQKYIRATKWEMMGSACKGTRKAEKSVLYDHLPLPLNEDDY  674

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPGV V  +N    DP  E + L SGK +VPDYA++F  G S+K
Sbjct  675  LRVCRIPKKKGANFRDLPGVVVGANNVARRDPKTE-MELPSGKQMVPDYALNFSEGKSTK  733

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+T+ +PH QA LHP QDRVLT+RE+ARLQGFPDYYK CG +KERY 
Sbjct  734  PFARLWWDETVPTVLTKPDPHCQAYLHPEQDRVLTVRESARLQGFPDYYKFCGQVKERYC  793

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-EIAATLVESA  157
            Q+GNAVAVPVARALGY++ LA + LS  EP   LP  +     A L++++
Sbjct  794  QIGNAVAVPVARALGYAMGLAVQKLSRAEPLLTLPPKFSHSTTAQLLQAS  843



>ref|XP_010662139.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=892

 Score =   254 bits (648),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 160/230 (70%), Gaps = 14/230 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V NNE R+ M Y   P +EFQ++IR  +  + G            VL+DH PL LN+DDY
Sbjct  660  VSNNETREQMSYRRPPETEFQKYIRATKWEMMGSACKGTRKAEKSVLYDHLPLPLNEDDY  719

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPGV V  +N    DP  E + L SGK +VPDYA++F  G S+K
Sbjct  720  LRVCRIPKKKGANFRDLPGVVVGANNVARRDPKTE-MELPSGKQMVPDYALNFSEGKSTK  778

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+T+ +PH QA LHP QDRVLT+RE+ARLQGFPDYYK CG +KERY 
Sbjct  779  PFARLWWDETVPTVLTKPDPHCQAYLHPEQDRVLTVRESARLQGFPDYYKFCGQVKERYC  838

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-EIAATLVESA  157
            Q+GNAVAVPVARALGY++ LA + LS  EP   LP  +     A L++++
Sbjct  839  QIGNAVAVPVARALGYAMGLAVQKLSRAEPLLTLPPKFSHSTTAQLLQAS  888



>gb|AHB20162.1| DNA methyltransferase, partial [Populus x canadensis]
Length=755

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/232 (54%), Positives = 162/232 (70%), Gaps = 15/232 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V ++E R++M Y   P + FQQFIR  R+ + G          +L+DHRP  L ++D+ R
Sbjct  523  VTSHETREEMAYDKPPETNFQQFIRSTRNEMTGSELSGTRMINLLYDHRPYSLTEEDFAR  582

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGV V  DN    DP  E++ L SGKPLVPD+A++F GG S +P+
Sbjct  583  VCQIPKKKGANFRDLPGVVVGADNVARRDPTKEQMLLPSGKPLVPDFALNFEGGKSRRPY  642

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETV TVVT  + H+QA++HP QDRVLTIRE ARLQGFPDYY+ CG +K+RY Q+
Sbjct  643  ARLWWDETVSTVVTFPDLHSQAVMHPEQDRVLTIRECARLQGFPDYYRFCGTVKQRYRQI  702

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-----EIAATLVESA  157
            GNAVAVPV RALG++L +AF+ LSG +P   LP  +      ++A +L + A
Sbjct  703  GNAVAVPVGRALGFTLGMAFQKLSGDDPLMTLPPKFSHSTNLQLAKSLFQKA  754



>ref|XP_008790945.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Phoenix 
dactylifera]
Length=994

 Score =   254 bits (650),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 156/217 (72%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E  D M+Y   P +EFQ++IR  +    G+          +L+DHRPL L++DDY 
Sbjct  761  VTNKEVHDQMQYGKGPQTEFQRYIRSPKFETSGLTANGIKNSRCMLYDHRPLPLSEDDYL  820

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IP+ KGANFRDLPG+ +  DN V +DP VER+ L SGKPLVPDYAM++  G S +P
Sbjct  821  RVCQIPRQKGANFRDLPGIIIGCDNTVQFDPIVERILLPSGKPLVPDYAMNYWNGKSLRP  880

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE VPTV+T  + H+QAILHP QDRVLT+RE ARLQGFPDYY+ CG ++ERY Q
Sbjct  881  FARLWWDEIVPTVLTIPDAHSQAILHPEQDRVLTVRECARLQGFPDYYRFCGTVRERYRQ  940

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            +GNAVAVPV RALGY++ALA+   SG EP   LP  +
Sbjct  941  IGNAVAVPVGRALGYAMALAWLKKSGDEPLMTLPPNF  977



>ref|XP_003615347.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES98305.1| cytosine-C5 specific DNA methylase family protein [Medicago truncatula]
Length=192

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = -1

Query  705  VLHDHRPLQLNDDDYQRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLV  526
            +LHD R  ++N DDYQ  C IPK KGA FRDLP  R+ + KV  +P+V+R +L+SG PLV
Sbjct  1    MLHDRRSYEMNFDDYQCACRIPKRKGACFRDLPCARMQNKKVELNPDVKREFLASGNPLV  60

Query  525  PDYAMSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFP  346
            P+YA++FV GTS  PF R+WWD+TVPTVVTRAEPHNQ ILHP QDRVL+IR NARLQGFP
Sbjct  61   PNYAITFVCGTSPLPFARIWWDKTVPTVVTRAEPHNQKILHPEQDRVLSIRGNARLQGFP  120

Query  345  DYYKLCGPIKERYIQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            D+YKLCG  KERYIQVGNAVAVPV RAL Y L LA +G S   P + LP+ +
Sbjct  121  DFYKLCGSSKERYIQVGNAVAVPVGRALRYCLGLASQGASADGPLYTLPDQF  172



>gb|AGT16212.1| methyltransferase [Saccharum hybrid cultivar R570]
Length=811

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 157/232 (68%), Gaps = 27/232 (12%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN++  D MEY   P + FQ++IRLGR  +             G +L DH+PL+LN DD
Sbjct  581  VENHQPNDVMEYGGSPKTGFQRYIRLGRKDMLDWSFGGEAGPNEGKLL-DHQPLRLNSDD  639

Query  663  YQRVCHIPKAK--GANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTS  490
            Y+RV  IP  K  GAN           N V WDP ++RVYLSSGKPLVPDYAMSF+ G S
Sbjct  640  YERVQQIPVKKVFGAN-----------NVVEWDPEIKRVYLSSGKPLVPDYAMSFIKGKS  688

Query  489  SKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKER  310
            SKPF RLWWDE VPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY+L G IKE+
Sbjct  689  SKPFGRLWWDEIVPTVVTRAEPHNQIILHPTQARVLTVRENARLQGFPDYYRLFGSIKEK  748

Query  309  YIQVGNAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESA  157
            YIQVGNAVAVPVARALGY L  A+ G S G  P + LP  +    A    S+
Sbjct  749  YIQVGNAVAVPVARALGYCLGQAYLGESEGSHPLYELPPSFTRTVAQAGASS  800



>ref|XP_006282433.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
 gb|EOA15331.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
Length=1275

 Score =   254 bits (648),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 153/216 (71%), Gaps = 10/216 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E R+ M Y   P ++FQ++IR  +  L G          ++LHDHRP  +N+DDY 
Sbjct  1046  VSNDEDREKMPYECLPETDFQRYIRSTKHDLTGSAIDNCNKKAMLLHDHRPFHVNEDDYA  1105

Query  657   RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             RVC IPK KGANFRDLPG+ V +N V  DP++E V L SGK LVP+Y  +F  G S +PF
Sbjct  1106  RVCQIPKRKGANFRDLPGLVVRNNTVCRDPSMEPVILPSGKALVPEYVFTFQQGKSKRPF  1165

Query  477   RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
              R+WWDETVPTV+T    HNQA+LHP QDRVLTIRE ARLQGFPDY++ CG +K+RY Q+
Sbjct  1166  ARVWWDETVPTVLTVPSCHNQALLHPEQDRVLTIRECARLQGFPDYFQFCGTMKQRYCQI  1225

Query  297   GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             GNAVAV V+RALGYSL  AF GL+G E    LP+ +
Sbjct  1226  GNAVAVSVSRALGYSLGKAFHGLAGDEHLIKLPQNF  1261



>emb|CAN77846.1| hypothetical protein VITISV_020830 [Vitis vinifera]
Length=272

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 140/185 (76%), Gaps = 3/185 (2%)
 Frame = -1

Query  705  VLHDHRPLQLNDDDYQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPL  529
            VL+DH PL LN+DDY RVC IPK KGANFRDLPGV V  +N    DP  E + L SGK +
Sbjct  85   VLYDHLPLPLNEDDYLRVCRIPKKKGANFRDLPGVVVGANNVARRDPKTE-MELPSGKQM  143

Query  528  VPDYAMSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGF  349
            VPDYA++F  G S+KPF RLWWDETVPTV+T+ +PH QA LHP QDRVLT+RE+ARLQGF
Sbjct  144  VPDYALNFSEGKSTKPFARLWWDETVPTVLTKPDPHCQAYLHPEQDRVLTVRESARLQGF  203

Query  348  PDYYKLCGPIKERYIQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-EIAAT  172
            PDYYK CG +KERY Q+GNAVAVPVARALGY++ LA + LS  EP   LP  +     A 
Sbjct  204  PDYYKFCGQVKERYCQIGNAVAVPVARALGYAMGLAVQKLSRAEPLLTLPPKFSHSTTAQ  263

Query  171  LVESA  157
            L++++
Sbjct  264  LLQAS  268



>gb|EMT16647.1| DNA (cytosine-5)-methyltransferase 2 [Aegilops tauschii]
Length=660

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 151/204 (74%), Gaps = 14/204 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            V N+E  D+  Y  K  +EFQ++IRL R  +             G++L DHRPL+LN DD
Sbjct  405  VSNDETADETMYSVKAETEFQRYIRLSRKEMLDYSFGDNKGPSEGMLL-DHRPLKLNKDD  463

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFR+L GV+V  DN  + DP V+   L SGKPLVP YA+SF+ G S 
Sbjct  464  YERVKQIPHQKGANFRNLTGVKVGQDNVAYMDPTVKPPCLESGKPLVPYYALSFMHGKSL  523

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            KPF RLWWDETVPTV TRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY++ GPIKERY
Sbjct  524  KPFGRLWWDETVPTVFTRAEPHNQIILHPDQARVLTVRENARLQGFPDYYRMYGPIKERY  583

Query  306  IQVGNAVAVPVARALGYSLALAFK  235
            +QVGNAVAVPVARALGY+LA AF+
Sbjct  584  MQVGNAVAVPVARALGYALAQAFQ  607



>ref|XP_001769709.1| predicted protein [Physcomitrella patens]
 gb|EDQ65510.1| predicted protein, partial [Physcomitrella patens]
Length=700

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 155/214 (72%), Gaps = 8/214 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG------IVLHDHRPLQLNDDDYQRVCH  646
            V N++ +DD+ Y ++P  +FQ F+RL + G  G       +L DHRPL LN DDY+RV  
Sbjct  479  VGNDQSKDDISYDEEPQCDFQHFLRLPKKGSLGPQQKKKAILPDHRPLCLNADDYERVKQ  538

Query  645  IPKAKGANFRDLPGVRVVDNKVHWDPNVE-RVYLSSGKPLVPDYAMSFVGGTSSKPFRRL  469
            IPK KGANFRDL G+ +  + V  D   E R  L SGKPLVPDYA+SF+ G S KPF RL
Sbjct  539  IPKKKGANFRDLKGIIIKADGVTVDVVREPRELLKSGKPLVPDYAISFIRGRSFKPFGRL  598

Query  468  WWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNA  289
            WWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGF DYYKL GPIK+RY+QVGNA
Sbjct  599  WWDETVPTVVTRAEPHNQIILHPEQDRVLTIRENARLQGFSDYYKLFGPIKQRYMQVGNA  658

Query  288  VAVPVARALGYSLALAF-KGLSGMEPTFGLPEGY  190
            VAVPVA ALGY L  +F + +S  + T  LP  +
Sbjct  659  VAVPVATALGYVLGQSFLRKVSHQQETLELPRHF  692



>ref|XP_009378159.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=240

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 146/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
            V N+EKR++M +   P ++FQ++IR  +  + G          + L+DHR   L +DDY 
Sbjct  6    VSNDEKREEMPFQKPPETDFQRYIRSTQHEMMGSAFDGPMKAKVSLYDHRTYHLYEDDYL  65

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IP  KGANFRDLPGV V  DN    +   +   L SG+PLVPDY  ++  G S +P
Sbjct  66   RVCQIPTRKGANFRDLPGVVVGSDNVARRESTEKHSLLPSGRPLVPDYCFTYEQGKSKRP  125

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTV+T    HNQ +LHP QDR+LT+RE+ARLQGFPDYY+ CG +KERY Q
Sbjct  126  FARLWWDETVPTVLTFPSCHNQVVLHPQQDRILTVRESARLQGFPDYYRFCGTVKERYCQ  185

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAV V VARALGY+L LA + LSG +P   LP  + 
Sbjct  186  IGNAVPVSVARALGYALGLAVRKLSGNDPLMTLPNKFS  223



>gb|KJB25191.1| hypothetical protein B456_004G180300 [Gossypium raimondii]
Length=1185

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 159/233 (68%), Gaps = 16/233 (7%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGR--------DGLPGI--VLHDHRPLQLNDDDYQ  658
             V NNE R++M Y   P ++FQ++IR  +        DG   I  +L+DHRP  L++DDY 
Sbjct  951   VSNNEVREEMTYEKPPETDFQRYIRSSKYVMTGSALDGATRIRNLLYDHRPAPLSEDDYT  1010

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPGV V  DN    DP  E+ +L SGKPLVP+Y  +F  G S +P
Sbjct  1011  RVCLIPKRKGANFRDLPGVIVGADNVARRDPTREKQFLPSGKPLVPEYVFTFEQGKSKRP  1070

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTVVT    H+Q ILHP QDRVLT+RE ARLQGFPDYY+ CG IK+RY Q
Sbjct  1071  FARLWWDETVPTVVTYPYCHSQVILHPEQDRVLTVRECARLQGFPDYYRFCGTIKDRYCQ  1130

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-----EIAATLVESA  157
             +GNAVA+PV RALGY++ +AF+  SG EP   LP  +      ++A +L +S 
Sbjct  1131  IGNAVAIPVGRALGYTMGMAFQKGSGNEPLMILPPKFSLSTNIQLAKSLSQST  1183



>gb|KJB25190.1| hypothetical protein B456_004G180300 [Gossypium raimondii]
Length=1182

 Score =   251 bits (641),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 159/233 (68%), Gaps = 16/233 (7%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGR--------DGLPGI--VLHDHRPLQLNDDDYQ  658
             V NNE R++M Y   P ++FQ++IR  +        DG   I  +L+DHRP  L++DDY 
Sbjct  948   VSNNEVREEMTYEKPPETDFQRYIRSSKYVMTGSALDGATRIRNLLYDHRPAPLSEDDYT  1007

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPGV V  DN    DP  E+ +L SGKPLVP+Y  +F  G S +P
Sbjct  1008  RVCLIPKRKGANFRDLPGVIVGADNVARRDPTREKQFLPSGKPLVPEYVFTFEQGKSKRP  1067

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTVVT    H+Q ILHP QDRVLT+RE ARLQGFPDYY+ CG IK+RY Q
Sbjct  1068  FARLWWDETVPTVVTYPYCHSQVILHPEQDRVLTVRECARLQGFPDYYRFCGTIKDRYCQ  1127

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-----EIAATLVESA  157
             +GNAVA+PV RALGY++ +AF+  SG EP   LP  +      ++A +L +S 
Sbjct  1128  IGNAVAIPVGRALGYTMGMAFQKGSGNEPLMILPPKFSLSTNIQLAKSLSQST  1180



>ref|XP_002889276.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65535.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
Length=876

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 152/217 (70%), Gaps = 9/217 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N+E  D   Y D  P ++F+ FI L R         G P   L DH+PL+L DDD +R
Sbjct  497  VTNSEANDVRNYNDAAPKTDFENFISLKRSETLLPVCGGDPARRLFDHQPLELRDDDLER  556

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            + +IPK KGANFRD+PGV V +NK   +  V+R  L SGK +VP YA+SF+ G S KPF 
Sbjct  557  ISYIPKKKGANFRDMPGVLVHNNKAQLNLRVKRAKLKSGKNVVPAYAVSFIKGKSKKPFG  616

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  617  RLWWDEIVNTVVTRAEPHNQCVIHPMQERVLSVRENARLQGFPDCYKLCGSIKEKYIQVG  676

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGE  184
            NAVAVPV  ALGY+  +A +GL+  EP   LP  Y E
Sbjct  677  NAVAVPVGVALGYAFGMASQGLTDDEPVIKLPFKYPE  713



>ref|XP_008238301.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Prunus mume]
Length=752

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 151/218 (69%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVL----------HDHRPLQLNDDDYQ  658
            V N+E  ++M Y   PG++FQ++IR  +  + G VL          +DHRP  L +DDY 
Sbjct  518  VTNDETSEEMSYQKPPGTDFQRYIRSTQYEMMGSVLDGTMKTKVSLYDHRPYPLFEDDYL  577

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN    D   + + L SGKPLVPDYA ++  G S +P
Sbjct  578  RVCQIPKRKGANFRDLPGVVVGNDNVARRDSTEKHLLLPSGKPLVPDYAFTYEQGKSKRP  637

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTV+T    H+QAILHP QDR+LT+RE ARLQGFPDYY+ CG +KERY Q
Sbjct  638  FARLWWDETVPTVLTFPTCHSQAILHPEQDRILTLRECARLQGFPDYYRFCGTVKERYCQ  697

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            VGNAVAVPVARALGY+L LA + LSG EP   LP  + 
Sbjct  698  VGNAVAVPVARALGYALGLAVRKLSGDEPLMTLPRNFS  735



>ref|XP_007210636.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
 gb|EMJ11835.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
Length=998

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLHDHRPLQLNDDDYQRVCHIPKAKG  628
            V N+E  ++M Y   PG++FQ++IR        + L+DHRP  L +DDY RVC IPK KG
Sbjct  778  VTNDETSEEMSYQKPPGTDFQRYIR----STQYVSLYDHRPYPLFEDDYLRVCQIPKRKG  833

Query  627  ANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRLWWDETV  451
            ANFRDLPGV V  DN    D   + + L SGKPLVPDYA ++  G S +PF RLWWDETV
Sbjct  834  ANFRDLPGVVVGNDNVARRDSTEKHLLLPSGKPLVPDYAFTYEQGKSKRPFARLWWDETV  893

Query  450  PTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNAVAVPVA  271
            PTV+T    H+QAILHP QDR+LT+RE ARLQGFPDYY+ CG +KERY QVGNAVAVPVA
Sbjct  894  PTVLTFPTCHSQAILHPEQDRILTLRECARLQGFPDYYRFCGTVKERYCQVGNAVAVPVA  953

Query  270  RALGYSLALAFKGLSGMEPTFGLPEGYG  187
            RALGY+L LA + LSG EP   LP  + 
Sbjct  954  RALGYALGLAVRKLSGNEPLMTLPRNFS  981



>emb|CDX78915.1| BnaA01g09820D [Brassica napus]
Length=1098

 Score =   249 bits (635),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 153/217 (71%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V NNE R+ M Y   P ++FQ++IR  +  + G          ++L+DHRP  L++DDY 
Sbjct  868   VSNNETRERMSYESLPETDFQRYIRSTKHDMTGSATDNCTKRTMLLYDHRPSLLSEDDYN  927

Query  657   RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ V  DN V  DP++E V L SGK LVP+Y  +F  G S +P
Sbjct  928   RVCQIPKKKGANFRDLPGLIVRNDNTVGRDPSMEPVLLPSGKRLVPEYVFTFQQGKSKRP  987

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T     NQA LHP QDR+LTIRE ARLQGFPDY++ CG +K+RY Q
Sbjct  988   FARLWWDETVPTVLTVPSCSNQAFLHPEQDRILTIREAARLQGFPDYFQFCGTVKQRYCQ  1047

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAV V+RALGYSL +AF+GL+G E    LP+ +
Sbjct  1048  IGNAVAVSVSRALGYSLGMAFRGLAGDENMIKLPQKF  1084



>ref|XP_007040779.1| DNA-methyltransferase CMT2 [Theobroma cacao]
 gb|EOY25280.1| DNA-methyltransferase CMT2 [Theobroma cacao]
Length=1427

 Score =   250 bits (639),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 148/218 (68%), Gaps = 11/218 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVL----------HDHRPLQLNDDDYQ  658
             V NNE  ++M Y   P +EFQ++IR  +  + G  L          +DHRP  L +DDY 
Sbjct  1187  VANNEAHEEMTYRKPPETEFQRYIRSSKHEITGSALNGATRISNPLYDHRPFPLFEDDYA  1246

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPGV V  DN    D   E+  L SGKPLVPDY  +F  G S +P
Sbjct  1247  RVCLIPKRKGANFRDLPGVIVGNDNVARRDSTQEKKLLPSGKPLVPDYVFTFEQGKSRRP  1306

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTVVT  + H+QA LHP QDR+LTIRE ARLQGFPDYY+ CG IKERY Q
Sbjct  1307  FARLWWDETVPTVVTFPQCHSQAALHPEQDRILTIREYARLQGFPDYYRFCGTIKERYCQ  1366

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             VGNAVAVPVARALGY++ +AF+  SG EP   LP  + 
Sbjct  1367  VGNAVAVPVARALGYAMGMAFQKQSGNEPLMTLPPKFS  1404



>ref|XP_009132470.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Brassica rapa]
Length=1141

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 153/217 (71%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V NNE R+ M Y   P ++FQ++IR  +  + G          ++L+DHRP  L++DDY 
Sbjct  911   VSNNETRERMSYESLPETDFQRYIRSTKHDMTGSATDNCTKRTMLLYDHRPSLLSEDDYN  970

Query  657   RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ V  DN V  DP++E V L SGK LVP+Y  +F  G S +P
Sbjct  971   RVCQIPKKKGANFRDLPGLIVRNDNTVGRDPSMEPVLLPSGKRLVPEYVFTFQQGKSKRP  1030

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T     NQA LHP QDR+LTIRE ARLQGFPDY++ CG +K+RY Q
Sbjct  1031  FARLWWDETVPTVLTVPSCSNQAFLHPEQDRILTIREAARLQGFPDYFQFCGTVKQRYCQ  1090

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAV V+RALGYSL +AF+GL+G E    LP+ +
Sbjct  1091  IGNAVAVSVSRALGYSLGMAFRGLAGDENMIKLPQKF  1127



>ref|XP_009132479.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Brassica rapa]
Length=1119

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 153/217 (71%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V NNE R+ M Y   P ++FQ++IR  +  + G          ++L+DHRP  L++DDY 
Sbjct  889   VSNNETRERMSYESLPETDFQRYIRSTKHDMTGSATDNCTKRTMLLYDHRPSLLSEDDYN  948

Query  657   RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ V  DN V  DP++E V L SGK LVP+Y  +F  G S +P
Sbjct  949   RVCQIPKKKGANFRDLPGLIVRNDNTVGRDPSMEPVLLPSGKRLVPEYVFTFQQGKSKRP  1008

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T     NQA LHP QDR+LTIRE ARLQGFPDY++ CG +K+RY Q
Sbjct  1009  FARLWWDETVPTVLTVPSCSNQAFLHPEQDRILTIREAARLQGFPDYFQFCGTVKQRYCQ  1068

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAV V+RALGYSL +AF+GL+G E    LP+ +
Sbjct  1069  IGNAVAVSVSRALGYSLGMAFRGLAGDENMIKLPQKF  1105



>ref|XP_010671153.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Beta 
vulgaris subsp. vulgaris]
Length=841

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 154/222 (69%), Gaps = 12/222 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGR-------DGLPG---IVLHDHRPLQLNDDDYQ  658
            V NNE R +M Y   P +EFQ++IR          D  P     +L+DHRPL L++DDY 
Sbjct  608  VTNNESRVEMSYRKSPETEFQKYIRASECDMIDTPDATPRKRRCILNDHRPLMLSEDDYA  667

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IP  KGANFR+LPG+ +  DN V  DP  + + L SG+ LVPDYA++F GG S +P
Sbjct  668  RVCKIPHQKGANFRNLPGLIIGRDNVVRRDPETD-IKLPSGRQLVPDYAINFCGGKSMRP  726

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDET+PT++TR + HNQ ILHP QDRVLT+RE ARLQGFPDYY+ CG +KERY Q
Sbjct  727  FARLWWDETIPTLLTRPDVHNQVILHPEQDRVLTVREYARLQGFPDYYRFCGSVKERYCQ  786

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAA  175
            +GNAVA+ V++ALGYSL +A + L+G  P   LP  +  I A
Sbjct  787  IGNAVAISVSKALGYSLGMAVQKLTGEGPLVTLPAKFSHITA  828



>ref|XP_010908353.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Elaeis 
guineensis]
Length=1011

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 156/220 (71%), Gaps = 14/220 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIR-----------LGRDGLPGI--VLHDHRPLQLNDD  667
            V N E  D+M Y   P +EFQ++IR           L  + + G   +L+DH PL L++D
Sbjct  775  VTNKEVHDEMPYGKGPQTEFQRYIRSPKLAFAETLGLTANCIKGSQSMLYDHCPLPLSED  834

Query  666  DYQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTS  490
            DY RVC IP+ KGANFRDLPG+ V  DN V +DP +ER+ L SGKPLVPDYAM++  G S
Sbjct  835  DYLRVCQIPRRKGANFRDLPGIIVGCDNTVQFDPTMERILLPSGKPLVPDYAMNYWEGKS  894

Query  489  SKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKER  310
             +PF RLWWDETVPTV+T  + H QAILHP QDRVLT+RE ARLQGFPDYY+ CG ++ER
Sbjct  895  LRPFARLWWDETVPTVLTIPDAHCQAILHPEQDRVLTVRECARLQGFPDYYRFCGTVRER  954

Query  309  YIQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
            Y Q+GNAVAVPV+RALGY++ALA+   S  EP   LP  +
Sbjct  955  YRQIGNAVAVPVSRALGYAMALAWLKKSDDEPLVTLPPNF  994



>ref|XP_006300613.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
 gb|EOA33511.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
Length=824

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 153/217 (71%), Gaps = 9/217 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N E  D   Y ++ P ++FQ++I L R         G    +L DH+PL+L D+D +R
Sbjct  597  VTNYEINDVRNYNEEGPKTDFQKYIALKRSETLLPLCGGDSSHMLFDHQPLELGDNDLER  656

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            + +IPK KGANFRD+PGV V  NK   D +V+R  L SGK +VP YA+SFV GTS KPF 
Sbjct  657  ISYIPKKKGANFRDMPGVLVHKNKAKIDKSVKRAKLKSGKNVVPAYAISFVKGTSKKPFG  716

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HP QDRVL++RENARLQGFPD YKLCG IK++YIQVG
Sbjct  717  RLWWDEIVNTVVTRAEPHNQCVIHPKQDRVLSVRENARLQGFPDCYKLCGTIKQKYIQVG  776

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGE  184
            NAVAVPV  ALGY+  +A +GL+  EP   LP  Y E
Sbjct  777  NAVAVPVGVALGYAFGMASQGLTDDEPVMKLPFKYPE  813



>emb|CDX99400.1| BnaC01g11520D [Brassica napus]
Length=1144

 Score =   246 bits (629),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 151/217 (70%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V NNE R+ M Y   P ++FQ++IR  +  + G          + L+DHRP  L++DDY 
Sbjct  914   VSNNETRERMSYESLPETDFQRYIRSTKHDMTGSATDNCTKRTMQLYDHRPSLLSEDDYN  973

Query  657   RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ V  DN V  DP++E V L SGK LVP+Y  +F  G S +P
Sbjct  974   RVCQIPKKKGANFRDLPGLIVRNDNTVCRDPSMEPVLLPSGKRLVPEYVFTFQQGKSKRP  1033

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T     NQA LHP QDR+LTIRE ARLQGFPDY++ CG +K+RY Q
Sbjct  1034  FARLWWDETVPTVLTVPSCSNQAFLHPEQDRILTIREAARLQGFPDYFQFCGTVKQRYCQ  1093

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAV V+RALGYSL + F+GL+G E    LP+ +
Sbjct  1094  IGNAVAVSVSRALGYSLGMTFRGLAGDENMIKLPQKF  1130



>gb|EYU22416.1| hypothetical protein MIMGU_mgv1a001955mg [Erythranthe guttata]
Length=734

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 154/224 (69%), Gaps = 15/224 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N    D+M Y   P + FQ+FIRL R  L G            VL+DHRPL+LN+DDY
Sbjct  503  VTNFADLDEMPYGRAPQTAFQKFIRLKRKELFGYTDKKKNDSSKSVLYDHRPLKLNEDDY  562

Query  660  QRVCHIPKAKGANFRDLPGVRVVDNK-VHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RVCH+PK KGANFR+LPG+ +  NK V  DP+VE     SGKPLVP+YA+ F  G SSK
Sbjct  563  ERVCHVPKQKGANFRNLPGLIIEPNKIVRQDPSVEIPLCKSGKPLVPNYAIKFESGKSSK  622

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLW+DE V TVVTRAEPHNQ +LHP QDRVL++RENARLQGFPD YKL GPIKERY+
Sbjct  623  PFGRLWYDEIVSTVVTRAEPHNQILLHPSQDRVLSVRENARLQGFPDCYKLHGPIKERYM  682

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPT---FGLPEGYGEI  181
            QVGNAV+  V+  LGY LA A +G+    P       P+  GE+
Sbjct  683  QVGNAVSFAVSIPLGYCLAKAMQGVEIATPLKIPVKFPDCLGEL  726



>gb|KFK28331.1| chromomethylase [Arabis alpina]
Length=781

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 150/223 (67%), Gaps = 10/223 (4%)
 Frame = -1

Query  801  NNEKRDDMEYVDKPGSEFQQFIRLGR--------DGLPG--IVLHDHRPLQLNDDDYQRV  652
            N E  D   Y  +P   FQ++I L R         G P     L DH+PL+   DD +R 
Sbjct  551  NTEVNDVRNYETEPQCAFQKYISLARAESIIPKDGGGPSEPRRLFDHQPLEQKADDLERT  610

Query  651  CHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
            C IPK KGANFRDL GV V +N  + DP++ER  L SGK LVP+YA+ F  GTS KPF R
Sbjct  611  CQIPKKKGANFRDLKGVLVKNNVAYLDPSIERPRLKSGKYLVPNYAIKFTKGTSKKPFGR  670

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
             W+DE V TVVTRAEPHNQA+LHPLQDRVL++RENARLQGFPD+YKLCG IKE+YIQVGN
Sbjct  671  KWFDEVVRTVVTRAEPHNQAVLHPLQDRVLSVRENARLQGFPDFYKLCGTIKEKYIQVGN  730

Query  291  AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVE  163
            AVAVPV  ALGY+  +A +GL+  +P   LP  Y E     VE
Sbjct  731  AVAVPVGVALGYAFGMASRGLTDDQPVITLPFKYPECMEGSVE  773



>ref|XP_008346523.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=611

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 147/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
            V NNEKR++M +   P ++FQ++IR  +  + G          + L+DHR   LN+DDY 
Sbjct  377  VSNNEKREEMPFQKPPETDFQRYIRSTQHEMMGSAFDGTTKATVSLYDHRTYHLNEDDYL  436

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN    +   +   L SG+PLVPDY  +   G S +P
Sbjct  437  RVCQIPKRKGANFRDLPGVVVGSDNVARRESTEKHSLLPSGRPLVPDYCFTXEQGKSKRP  496

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTV+T    HNQ +LHP QDR+LT+RE+ARLQGFPDYY+ CG +KERY Q
Sbjct  497  FARLWWDETVPTVLTFPSCHNQVVLHPEQDRILTVRESARLQGFPDYYRFCGTVKERYCQ  556

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAV V VARALGY+L LA + LSG +P   LP  + 
Sbjct  557  IGNAVPVSVARALGYALGLAVRKLSGNDPLMTLPNKFS  594



>ref|XP_010429915.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X2 [Camelina sativa]
Length=795

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 158/229 (69%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEY-VDKPGSEFQQFIRLGRDG--LPGI------VLHDHRPLQLNDDDYQR  655
            V N EK D   Y V  P ++FQ++I L R    LP I      +L DH+PL+L+ +D +R
Sbjct  567  VTNYEKNDVRNYNVAGPKTDFQKYIALKRSETLLPVIGGDSSHMLFDHQPLKLSTNDLER  626

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            + +IPK KGANFRD+PGV V +NKV  D +V+R  L SG  +VP YA+ +V GTS KPF 
Sbjct  627  ISYIPKKKGANFRDMPGVLVHNNKVQIDDSVKRAKLKSGDNVVPTYAIKYVKGTSKKPFG  686

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HP QDRVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  687  RLWWDEIVNTVVTRAEPHNQCVIHPKQDRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  746

Query  294  NAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAAE  151
            NAVAVPV  ALGY+  +A +GL+   EP   LP  Y E      E  ++
Sbjct  747  NAVAVPVGVALGYAFGMASQGLTDDNEPVMKLPFKYPECMQAKAEDQSD  795



>ref|XP_010429914.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X1 [Camelina sativa]
Length=796

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 158/229 (69%), Gaps = 10/229 (4%)
 Frame = -1

Query  807  VENNEKRDDMEY-VDKPGSEFQQFIRLGRDG--LPGI------VLHDHRPLQLNDDDYQR  655
            V N EK D   Y V  P ++FQ++I L R    LP I      +L DH+PL+L+ +D +R
Sbjct  568  VTNYEKNDVRNYNVAGPKTDFQKYIALKRSETLLPVIGGDSSHMLFDHQPLKLSTNDLER  627

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            + +IPK KGANFRD+PGV V +NKV  D +V+R  L SG  +VP YA+ +V GTS KPF 
Sbjct  628  ISYIPKKKGANFRDMPGVLVHNNKVQIDDSVKRAKLKSGDNVVPTYAIKYVKGTSKKPFG  687

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HP QDRVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  688  RLWWDEIVNTVVTRAEPHNQCVIHPKQDRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  747

Query  294  NAVAVPVARALGYSLALAFKGLS-GMEPTFGLPEGYGEIAATLVESAAE  151
            NAVAVPV  ALGY+  +A +GL+   EP   LP  Y E      E  ++
Sbjct  748  NAVAVPVGVALGYAFGMASQGLTDDNEPVMKLPFKYPECMQAKAEDQSD  796



>gb|KDP46676.1| hypothetical protein JCGZ_12200 [Jatropha curcas]
Length=535

 Score =   237 bits (604),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 150/218 (69%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V ++E  +++ Y   P ++FQ+FIR  +  + G           +L+DHRP  L ++DY 
Sbjct  302  VTSHETHEELTYGMPPKTDFQRFIRSTKYEMTGSSLKGSTETKNLLYDHRPYSLTEEDYA  361

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFR+LPGV V  DN    DP  E+V L SGKPLVPD+A+ F  G S +P
Sbjct  362  RVCQIPKRKGANFRNLPGVVVGPDNVARRDPKHEQVLLPSGKPLVPDFALGFESGKSKRP  421

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            + RLWWDETV TVVT  + H+QAI+HP QDRVLTIRE ARLQGFPDYY+ CG +KERY Q
Sbjct  422  YARLWWDETVSTVVTFPDLHSQAIIHPEQDRVLTIRECARLQGFPDYYRFCGTVKERYRQ  481

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            VGNAVAVPV RALGY+L +AF+ L   EP   LP  + 
Sbjct  482  VGNAVAVPVGRALGYALGMAFQKLIDDEPLMKLPPKFS  519



>gb|AHB18565.1| DNA methyltransferase CMT3, partial [Brassica oleracea var. botrytis]
Length=140

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 1/140 (1%)
 Frame = -1

Query  690  RPLQLNDDDYQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYA  514
            +PL+LNDDD +RVC I K KGANFRDLPGV V  DNKV +DP+VER  L SGK LVPDYA
Sbjct  1    QPLELNDDDLERVCQIVKKKGANFRDLPGVIVDEDNKVKFDPSVERPKLKSGKFLVPDYA  60

Query  513  MSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYK  334
            +SFV G S KPF RLWWDE V TVVTRAEPHNQ ++HPLQDRVLT+RENAR+QGFPD+YK
Sbjct  61   VSFVNGKSKKPFGRLWWDEIVHTVVTRAEPHNQIVIHPLQDRVLTVRENARIQGFPDFYK  120

Query  333  LCGPIKERYIQVGNAVAVPV  274
            LCGPIKE+YIQVGNAVAVPV
Sbjct  121  LCGPIKEKYIQVGNAVAVPV  140



>ref|XP_011028080.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Populus euphratica]
Length=1218

 Score =   244 bits (624),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 160/232 (69%), Gaps = 15/232 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
             V ++E R+ M Y   P ++FQQFIR  R+ + G          +L+DHRP  L ++D+ R
Sbjct  986   VTSHETREKMAYDKPPETDFQQFIRSTRNEMTGSELSGTRMINLLYDHRPYSLTEEDFAR  1045

Query  654   VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
             VC IPK KGANFRDLPGV V  DN     P  E++ L SGKPLVPD+A++F GG S +P+
Sbjct  1046  VCQIPKKKGANFRDLPGVVVGADNVARRGPMKEQMLLPSGKPLVPDFALNFEGGKSRRPY  1105

Query  477   RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
              RLWWDETV TVVT  + H+QA++HP QDRVLTIRE ARLQGFPDYY+  G +K+RY Q+
Sbjct  1106  ARLWWDETVSTVVTFPDLHSQAVMHPEQDRVLTIRECARLQGFPDYYRFYGTVKQRYRQI  1165

Query  297   GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG-----EIAATLVESA  157
             GNAVAVPV RALG++L +AF+ LSG +P   LP  +      ++A +L + A
Sbjct  1166  GNAVAVPVGRALGFTLGMAFQKLSGDDPLMTLPPKFSHSTNLQLAKSLFQKA  1217



>ref|XP_008373678.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=666

 Score =   239 bits (610),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 147/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
            V NNEKR++M +   P ++FQ++IR  +  + G          + L+DHR   LN+DDY 
Sbjct  432  VSNNEKREEMPFQKPPETDFQRYIRSTQHEMMGSAFDGTTKATVSLYDHRTYHLNEDDYL  491

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN    +   +   L SG+PLVPDY  +   G S +P
Sbjct  492  RVCQIPKRKGANFRDLPGVVVGSDNVARRESTEKHSLLPSGRPLVPDYCFTXEQGKSKRP  551

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTV+T    HNQ +LHP QDR+LT+RE+ARLQGFPDYY+ CG +KERY Q
Sbjct  552  FARLWWDETVPTVLTFPSCHNQVVLHPEQDRILTVRESARLQGFPDYYRFCGTVKERYCQ  611

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAV V VARALGY+L LA + LSG +P   LP  + 
Sbjct  612  IGNAVPVSVARALGYALGLAVRKLSGNDPLMTLPNKFS  649



>gb|AHB20163.1| DNA methyltransferase, partial [Populus x canadensis]
Length=760

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 147/202 (73%), Gaps = 10/202 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI---------VLHDHRPLQLNDDDYQR  655
            V ++E R++M Y   P ++FQQFIR  R+ + G           L+DHRP  L ++D+ R
Sbjct  559  VTSHETREEMAYDKPPETDFQQFIRSTRNEMTGSELSGTRMINFLYDHRPYSLTEEDFAR  618

Query  654  VCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            VC IPK KGANFRDLPGV V  DN    DP  E++ L SGKPLVPD+A++F GG S +P+
Sbjct  619  VCQIPKKKGANFRDLPGVVVGADNVARRDPTKEQMLLPSGKPLVPDFALNFEGGKSRRPY  678

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDETV TVVT  + H+QA++HP QDRVLTIRE ARLQGFPDYY+ CG +K+RY Q+
Sbjct  679  ARLWWDETVSTVVTFPDLHSQAVMHPEQDRVLTIRECARLQGFPDYYRFCGTVKQRYRQI  738

Query  297  GNAVAVPVARALGYSLALAFKG  232
            GNAVAVPV RALG++L LAF+ 
Sbjct  739  GNAVAVPVGRALGFTLGLAFQN  760



>ref|XP_010518849.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Tarenaya hassleriana]
Length=917

 Score =   241 bits (616),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 148/218 (68%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
            V N+E  + + Y   P ++FQ++IR  +  + G          ++LHDHRP  LN DD+ 
Sbjct  686  VSNDESCEKISYGSLPETDFQRYIRSTKHEMTGSEADGCTKRTMMLHDHRPYNLNKDDWT  745

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPG+ +  D  V  DP++  V L SGKPL+PDY  +F  G S +P
Sbjct  746  RVCQIPKRKGANFRDLPGIIIRQDGTVRRDPSMMPVVLPSGKPLIPDYVFTFEQGKSKRP  805

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTV+T     NQA LHP QDR+LTIRE ARLQGFPDYY+ CG  KERY Q
Sbjct  806  FARLWWDETVPTVLTFPSCRNQASLHPEQDRMLTIREYARLQGFPDYYRFCGTTKERYCQ  865

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAVAV V+RALGY+L +AF+G+ G EP   LP  + 
Sbjct  866  IGNAVAVSVSRALGYTLGMAFRGVVGDEPLVKLPPKFS  903



>ref|XP_011465073.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X4 
[Fragaria vesca subsp. vesca]
Length=770

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 151/218 (69%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V++NEK ++M + + P ++FQ++IR  +  + G           +L+DHR L L++DDY 
Sbjct  539  VKHNEKSEEMSFKNPPETDFQRYIRSTQYEMVGYALDDTMKKENLLYDHRSLPLHEDDYA  598

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN    D   +++ L SGKPLVPDYA +F  G S +P
Sbjct  599  RVCQIPKQKGANFRDLPGVVVGRDNVARRDLTEKQLVLPSGKPLVPDYAFTFEQGKSKRP  658

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETV TV+T    HNQ +LHP QDR+LT+RE ARLQGFPDYY+ CG +KERY Q
Sbjct  659  FGRLWWDETVATVLTFPSCHNQVVLHPEQDRILTLRECARLQGFPDYYRFCGTVKERYCQ  718

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            VGNAVA+PVARALGY+L LA    SG EP   LP  + 
Sbjct  719  VGNAVAIPVARALGYALGLAVHKSSGNEPLLTLPPKFS  756



>emb|CDP11756.1| unnamed protein product [Coffea canephora]
Length=792

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 148/219 (68%), Gaps = 12/219 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N+E R+ M Y   PG++FQ++IRL ++ + G            +L+DHRP  LN+D+Y
Sbjct  560  VTNHESREKMAYDKPPGTDFQRYIRLSKEEMMGSTPIQVTEAKEQMLYDHRPYHLNEDNY  619

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC +P  KGANFRDLPGV V  DN VH D   +   L SG P+VPD   +F  G S +
Sbjct  620  LRVCQVPHRKGANFRDLPGVIVGDDNVVHRDTTKDTFVLPSGGPIVPDCVFTFEKGKSKR  679

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+T     +QAILHP QDRVLT+RE ARLQGFPD+Y+ CG IKERY 
Sbjct  680  PFARLWWDETVPTVLTFPHHRSQAILHPEQDRVLTVRECARLQGFPDFYRFCGTIKERYC  739

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            Q+GNAVA+PV +ALGY+L + F+ L G EP   LP  + 
Sbjct  740  QIGNAVAIPVGKALGYTLGMTFQNLCGDEPLLTLPSNFS  778



>ref|XP_011465072.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Fragaria vesca subsp. vesca]
Length=999

 Score =   241 bits (614),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 151/218 (69%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V++NEK ++M + + P ++FQ++IR  +  + G           +L+DHR L L++DDY 
Sbjct  768  VKHNEKSEEMSFKNPPETDFQRYIRSTQYEMVGYALDDTMKKENLLYDHRSLPLHEDDYA  827

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN    D   +++ L SGKPLVPDYA +F  G S +P
Sbjct  828  RVCQIPKQKGANFRDLPGVVVGRDNVARRDLTEKQLVLPSGKPLVPDYAFTFEQGKSKRP  887

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETV TV+T    HNQ +LHP QDR+LT+RE ARLQGFPDYY+ CG +KERY Q
Sbjct  888  FGRLWWDETVATVLTFPSCHNQVVLHPEQDRILTLRECARLQGFPDYYRFCGTVKERYCQ  947

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            VGNAVA+PVARALGY+L LA    SG EP   LP  + 
Sbjct  948  VGNAVAIPVARALGYALGLAVHKSSGNEPLLTLPPKFS  985



>ref|XP_004509555.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cicer 
arietinum]
Length=1093

 Score =   241 bits (615),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 147/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            + N E RD+M Y + P +EFQ++IR  +  + G           +L+DHRP  L +DDY 
Sbjct  745  ITNFETRDEMSYQNPPETEFQRYIRSTKYEMTGSTLNGTTEERHLLYDHRPCFLFEDDYL  804

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V   P  +   L SGKPLVPDY  +F  G S +P
Sbjct  805  RVCQIPKRKGANFRDLPGVVVGADNVVRTHPTEKIPLLPSGKPLVPDYCFTFEQGKSKRP  864

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPT +T    HNQ +LHP QDRVLTIRE ARLQGF DYY+ CG +KERY Q
Sbjct  865  FGRLWWDETVPTALTFPSCHNQVVLHPEQDRVLTIREFARLQGFHDYYRFCGTVKERYCQ  924

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAVA+PV+RALGY+L  A++ LSG EP   LP  + 
Sbjct  925  IGNAVAIPVSRALGYALGTAYRKLSGNEPLMTLPPKFS  962



>ref|XP_002519960.1| protein with unknown function [Ricinus communis]
 gb|EEF42564.1| protein with unknown function [Ricinus communis]
Length=734

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 146/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V  +E R++M Y   P +EFQ+FIR     + G           +L DHRP  L ++D  
Sbjct  501  VTTHETREEMAYEKPPETEFQRFIRSTEHEMTGSSQRGTTQMNNLLSDHRPYALTEEDCA  560

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPG+ V  DN V  DP  E+V L SGKPLVPD+A +F  G S +P
Sbjct  561  RVCLIPKRKGANFRDLPGILVGNDNVVRRDPTKEQVLLPSGKPLVPDFAFTFEQGKSKRP  620

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            + RLWWDETVPTVVT    H+QA+LHP QDR LTIRE ARLQGFPDYY+  G +KERY Q
Sbjct  621  YARLWWDETVPTVVTYPSIHSQAMLHPEQDRALTIRECARLQGFPDYYRFSGTVKERYRQ  680

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAVAVPV RALGY+L +AF  LSG  P   LP  + 
Sbjct  681  IGNAVAVPVGRALGYALGMAFLKLSGDGPLMTLPPKFS  718



>ref|XP_011465070.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Fragaria vesca subsp. vesca]
Length=1089

 Score =   241 bits (614),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 151/218 (69%), Gaps = 11/218 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V++NEK ++M + + P ++FQ++IR  +  + G           +L+DHR L L++DDY 
Sbjct  858   VKHNEKSEEMSFKNPPETDFQRYIRSTQYEMVGYALDDTMKKENLLYDHRSLPLHEDDYA  917

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPGV V  DN    D   +++ L SGKPLVPDYA +F  G S +P
Sbjct  918   RVCQIPKQKGANFRDLPGVVVGRDNVARRDLTEKQLVLPSGKPLVPDYAFTFEQGKSKRP  977

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETV TV+T    HNQ +LHP QDR+LT+RE ARLQGFPDYY+ CG +KERY Q
Sbjct  978   FGRLWWDETVATVLTFPSCHNQVVLHPEQDRILTLRECARLQGFPDYYRFCGTVKERYCQ  1037

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             VGNAVA+PVARALGY+L LA    SG EP   LP  + 
Sbjct  1038  VGNAVAIPVARALGYALGLAVHKSSGNEPLLTLPPKFS  1075



>ref|XP_010518846.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Tarenaya hassleriana]
Length=1290

 Score =   242 bits (617),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 147/214 (69%), Gaps = 11/214 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E  + + Y   P ++FQ++IR  +  + G          ++LHDHRP  LN DD+ 
Sbjct  1059  VSNDESCEKISYGSLPETDFQRYIRSTKHEMTGSEADGCTKRTMMLHDHRPYNLNKDDWT  1118

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ +  D  V  DP++  V L SGKPL+PDY  +F  G S +P
Sbjct  1119  RVCQIPKRKGANFRDLPGIIIRQDGTVRRDPSMMPVVLPSGKPLIPDYVFTFEQGKSKRP  1178

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T     NQA LHP QDR+LTIRE ARLQGFPDYY+ CG  KERY Q
Sbjct  1179  FARLWWDETVPTVLTFPSCRNQASLHPEQDRMLTIREYARLQGFPDYYRFCGTTKERYCQ  1238

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             +GNAVAV V+RALGY+L +AF+G+ G EP   LP
Sbjct  1239  IGNAVAVSVSRALGYTLGMAFRGVVGDEPLVKLP  1272



>tpg|DAA36033.1| TPA: hypothetical protein ZEAMMB73_314017 [Zea mays]
Length=849

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 137/179 (77%), Gaps = 14/179 (8%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL------------PGIVLHDHRPLQLNDDD  664
            VEN++  D MEY   P +EFQ++IRLGR  +             G +L DH+PL+LN+DD
Sbjct  672  VENHQPNDVMEYGGSPKTEFQRYIRLGRKDMLDWSFGEEAGPDEGKLL-DHQPLRLNNDD  730

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            Y+RV  IP  KGANFRDL GV+V  +N V WDP VERVYLSSGKPLVPDYAMSF+ G S 
Sbjct  731  YERVKQIPVKKGANFRDLKGVKVGANNVVEWDPEVERVYLSSGKPLVPDYAMSFIKGKSL  790

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKER  310
            KPF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLTIRENARLQGFPDYY+L GPIKE+
Sbjct  791  KPFGRLWWDETVPTVVTRAEPHNQVILHPTQARVLTIRENARLQGFPDYYRLFGPIKEK  849



>ref|XP_006471441.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Citrus 
sinensis]
Length=969

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 151/217 (70%), Gaps = 11/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
            V ++E RD+M Y   P +EFQ+FIR G+  + G          ++L+DHRP +L++DDY 
Sbjct  738  VTSHEARDEMPYEKPPETEFQRFIRSGKSEMTGSAFNGSSRVKVMLYDHRPKRLSEDDYI  797

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPF  478
            RVC IPK KGANFRDLPGV V  + V      E++ L SGKP++PDYA++F  G S +PF
Sbjct  798  RVCQIPKRKGANFRDLPGVVVGADNVARRTE-EQMLLPSGKPMIPDYALTFEQGKSRRPF  856

Query  477  RRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQV  298
             RLWWDET+ TVVT    H+ A+LHP QDRVLTIRE ARLQGFPDYY+ CG +KERY QV
Sbjct  857  ARLWWDETMTTVVTFPSLHSMAVLHPEQDRVLTIRECARLQGFPDYYRFCGTVKERYCQV  916

Query  297  GNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            GNAV V VARALGY+L +AF+ L   +P   LP  + 
Sbjct  917  GNAVPVVVARALGYALGMAFQKLGDDKPLMTLPPKFS  953



>gb|KFK28574.1| chromomethylase 2 [Arabis alpina]
Length=1039

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 151/217 (70%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V N+E R++M Y + P ++FQ++IR  +  + G          ++LHDHR   L D DY 
Sbjct  809   VSNDENRENMPYDNLPETDFQRYIRSTKHDMTGSVIDNCTKRTMLLHDHRAYHLYDSDYI  868

Query  657   RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ V  DN V  DP++E V L SG+PLVP+Y  +F  G S +P
Sbjct  869   RVCQIPKRKGANFRDLPGLIVNNDNTVSRDPSMEPVLLPSGRPLVPEYVFTFQQGKSKRP  928

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T    H+Q +LHP QDR+LTIRE ARLQGFPDY++  G +KERY Q
Sbjct  929   FGRLWWDETVPTVLTVPSCHSQVLLHPEQDRLLTIRECARLQGFPDYFQFSGTVKERYCQ  988

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAV V+RALGYSL LAF+ L+  E    LP+ +
Sbjct  989   IGNAVAVSVSRALGYSLGLAFRDLARDEHLIKLPQNF  1025



>ref|XP_006414021.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
 gb|ESQ55474.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
Length=1192

 Score =   240 bits (612),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 154/218 (71%), Gaps = 11/218 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
             V  +E R+ M Y + P ++FQ++IR  +  + G          ++LHDHR + + +DDY 
Sbjct  962   VSYDEVREKMPYGNLPETDFQKYIRSTKHDMTGSAIDKCTKRTMLLHDHRSVPMFEDDYL  1021

Query  657   RVCHIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPG+ V  DN V  DP++  V L SG+PLVP+Y  +F  G S +P
Sbjct  1022  RVCQIPKRKGANFRDLPGLIVRNDNTVCRDPSMTPVILPSGRPLVPEYVFTFQQGKSKRP  1081

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T    HNQA+LHP QDR+LTIRE+ARLQGFPDY++ CG +K+RY Q
Sbjct  1082  FARLWWDETVPTVLTVPSCHNQALLHPEQDRLLTIRESARLQGFPDYFQFCGTVKQRYCQ  1141

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             +GNAVAV V+RALGYSL +AF+G++  E    LP+ + 
Sbjct  1142  IGNAVAVSVSRALGYSLGMAFRGVARDEHLITLPQNFS  1179



>ref|XP_011092593.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Sesamum indicum]
Length=1352

 Score =   240 bits (613),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 154/228 (68%), Gaps = 12/228 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
             V N+E R++M Y   P +EFQ +IR  +D +  +V           L+DHRPLQL++ DY
Sbjct  1123  VRNDEIREEMAYEKPPETEFQAYIRSSKDEMMRLVSTSDSQTKVSVLYDHRPLQLSEHDY  1182

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
              RVC +P  KGANFRD PG+ V  DN V  DP  E V L +G+PLVPD  +SF  G S  
Sbjct  1183  LRVCQVPHQKGANFRDFPGLVVGEDNVVRRDPTKEPVMLPTGRPLVPDCVLSFKQGKSKN  1242

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             P+ RLWWDETV TVVT     +QA+LHP QDR+LTIRE ARLQGFPD+Y+ CG IKERY 
Sbjct  1243  PYARLWWDETVSTVVTFPHVRSQAVLHPEQDRLLTIREYARLQGFPDFYRFCGTIKERYC  1302

Query  303   QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGEIAATLVES  160
             Q+GNAV++PVARALGY+L +A++ + G EP   LP  + +   T+ E+
Sbjct  1303  QIGNAVSIPVARALGYALGMAYRKVIGGEPLMTLPPEFSDHGPTVDET  1350



>ref|NP_565245.1| chromomethylase 1 [Arabidopsis thaliana]
 sp|O49139.2|CMT1_ARATH RecName: Full=Putative DNA (cytosine-5)-methyltransferase CMT1; 
AltName: Full=Chromomethylase 1; AltName: Full=Protein CHROMOMETHYLASE 
1 [Arabidopsis thaliana]
 gb|AAF14662.1|AC011713_10 Identical to gb|AF039367 ecotype Col-0 chromomethylase (CMT1) 
gene from Arabidopsis thaliana [Arabidopsis thaliana]
 gb|AAC02660.1| chromomethylase [Arabidopsis thaliana]
 gb|AEE36442.1| chromomethylase 1 [Arabidopsis thaliana]
Length=791

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 149/217 (69%), Gaps = 10/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N    D M+Y D  P +EF+ FI L R         G P   L DH+PL L DDD +R
Sbjct  568  VTNYVANDVMDYNDAAPKTEFENFISLKRSETLLPAFGGDPTRRLFDHQPLVLGDDDLER  627

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            V +IPK KGAN+RD+PGV V +NK   +P   R  L SGK +VP YA+SF+ G S KPF 
Sbjct  628  VSYIPKQKGANYRDMPGVLVHNNKAEINPRF-RAKLKSGKNVVPAYAISFIKGKSKKPFG  686

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLW DE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  687  RLWGDEIVNTVVTRAEPHNQCVIHPMQNRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  746

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGE  184
            NAVAVPV  ALGY+  +A +GL+  EP   LP  Y E
Sbjct  747  NAVAVPVGVALGYAFGMASQGLTDDEPVIKLPFKYPE  783



>gb|AAB95485.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02659.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 149/217 (69%), Gaps = 10/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N    D M+Y D  P +EF+ FI L R         G P   L DH+PL L DDD +R
Sbjct  568  VTNYVANDVMDYNDAAPKTEFENFISLKRSETLLPACGGDPTRRLFDHQPLVLGDDDLER  627

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            V +IPK KGAN+RD+PGV V +NK   +P   R  L SGK +VP YA+SF+ G S KPF 
Sbjct  628  VSYIPKQKGANYRDMPGVLVHNNKAEINPRF-RAKLKSGKNVVPAYAISFIKGKSKKPFG  686

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLW DE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  687  RLWGDEIVNTVVTRAEPHNQCVIHPMQNRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  746

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGE  184
            NAVAVPV  ALGY+  +A +GL+  EP   LP  Y E
Sbjct  747  NAVAVPVGVALGYAFGMASQGLTDDEPVIKLPFKYPE  783



>gb|AAC02663.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 149/217 (69%), Gaps = 10/217 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N    D M+Y D  P +EF+ FI L R         G P   L DH+PL L DDD +R
Sbjct  568  VTNYVANDVMDYNDAAPKTEFENFISLKRSETLLPACGGDPTRRLFDHQPLVLGDDDLER  627

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            V +IPK KGAN+RD+PGV V +NK   +P   R  L SGK +VP YA+SF+ G S KPF 
Sbjct  628  VSYIPKQKGANYRDMPGVLVHNNKAEINPRF-RAKLKSGKNVVPAYAISFIKGKSKKPFG  686

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLW DE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  687  RLWGDEIVNTVVTRAEPHNQCVIHPMQNRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  746

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGE  184
            NAVAVPV  ALGY+  +A +GL+  EP   LP  Y E
Sbjct  747  NAVAVPVGVALGYAFGMASQGLTDDEPVIKLPFKYPE  783



>dbj|BAH37020.1| chromomethylase OsMET2b [Oryza sativa Japonica Group]
Length=690

 Score =   234 bits (597),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 138/186 (74%), Gaps = 12/186 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV-----------LHDHRPLQLNDDDY  661
            V N++ +D +EY   P +EFQ++IR  R  +               L DH+PL+LN DDY
Sbjct  505  VGNDQPKDVIEYSVAPKTEFQRYIRNNRKDIQDYSFRGDDPSEEGKLFDHQPLKLNKDDY  564

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GV V  DN V  DPN+ R  LSSGKPLVPDYA+SFV G S+K
Sbjct  565  ERVQRIPVKKGANFRDLKGVIVGPDNTVRLDPNISRERLSSGKPLVPDYAISFVKGKSTK  624

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP QDRVLTIRENARLQGFPDYY+L GP+KE+YI
Sbjct  625  PFGRLWWDETVPTVVTRAEPHNQIILHPSQDRVLTIRENARLQGFPDYYRLIGPLKEKYI  684

Query  303  QVGNAV  286
            QVGNAV
Sbjct  685  QVGNAV  690



>ref|XP_009378155.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=670

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 146/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG----------IVLHDHRPLQLNDDDYQ  658
            V N+EKR++M +   P ++FQ++IR  +  + G          + L+DHR   L +DDY 
Sbjct  436  VSNDEKREEMPFQKPPETDFQRYIRSTQHEMMGSAFDGPMKAKVSLYDHRTYHLYEDDYL  495

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IP  KGANFRDLPGV V  DN    +   +   L SG+PLVPDY  ++  G S +P
Sbjct  496  RVCQIPTRKGANFRDLPGVVVGSDNVARRESTEKHSLLPSGRPLVPDYCFTYEQGKSKRP  555

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPTV+T    HNQ +LHP QDR+LT+RE+ARLQGFPDYY+ CG +KERY Q
Sbjct  556  FARLWWDETVPTVLTFPSCHNQVVLHPQQDRILTVRESARLQGFPDYYRFCGTVKERYCQ  615

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAV V VARALGY+L LA + LSG +P   LP  + 
Sbjct  616  IGNAVPVSVARALGYALGLAVRKLSGNDPLMTLPNKFS  653



>emb|CBI37413.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 144/215 (67%), Gaps = 12/215 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N E RD+M Y   P +EFQ++IR  +D + G            +L+DHRP  LN+D+Y
Sbjct  507  VTNYETRDEMLYGKPPETEFQKYIRSTKDAMAGSSSSGITKGYNSILYDHRPYPLNEDNY  566

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             R+C IP+ KGANFRDL GV V  DN    DP ++ + L SG PLVPD   S+  G S +
Sbjct  567  LRICQIPRRKGANFRDLSGVIVGTDNVAVRDPTMKPILLPSGHPLVPDCVFSYEQGKSKR  626

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV+T     NQAILHP QDRVLTIRE ARLQGFPDYY+  G +KERY 
Sbjct  627  PFARLWWDETVPTVLTFPYLRNQAILHPEQDRVLTIRECARLQGFPDYYRFRGTVKERYC  686

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            Q+GNAVA PVARALGY L +AF+  SG E    LP
Sbjct  687  QIGNAVAFPVARALGYMLGMAFQNQSGNEALATLP  721



>gb|AAB95486.1| chromomethylase [Arabidopsis arenosa]
 gb|AAC02671.1| chromomethylase [Arabidopsis arenosa]
Length=744

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 139/193 (72%), Gaps = 9/193 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N+E  D   Y D  P ++F+ FI L R         G P   L DH PL+L DDD +R
Sbjct  552  VTNSEANDVRNYNDAAPKTDFENFISLKRSETLLPVCGGDPARRLFDHHPLELRDDDLER  611

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            + +IPK KGANFRD+PGV V +NK   +  V+R  L SGK +VPDYA+SF+ G S KPF 
Sbjct  612  ISYIPKKKGANFRDMPGVLVHNNKAQLNLRVKRAKLKSGKNVVPDYAVSFIKGKSKKPFG  671

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  672  RLWWDEIVNTVVTRAEPHNQCVIHPMQERVLSVRENARLQGFPDCYKLCGSIKEKYIQVG  731

Query  294  NAVAVPVARALGY  256
            NAVAVPV  ALGY
Sbjct  732  NAVAVPVGVALGY  744



>gb|KHF98017.1| DNA (cytosine-5)-methyltransferase CMT3 -like protein [Gossypium 
arboreum]
 gb|KHG10473.1| DNA (cytosine-5)-methyltransferase CMT3 -like protein [Gossypium 
arboreum]
Length=161

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 129/186 (69%), Gaps = 35/186 (19%)
 Frame = -1

Query  705  VLHDHRPLQLNDDDYQRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLV  526
            +L+DHRPLQLN DDYQRVC +PK K                                  V
Sbjct  7    LLYDHRPLQLNTDDYQRVCRVPKRK----------------------------------V  32

Query  525  PDYAMSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFP  346
            PDYAMSFVGG+SSKPF RLWWDETVP VVTRAEPHNQAILHP+QDRVL+IRENARLQGFP
Sbjct  33   PDYAMSFVGGSSSKPFARLWWDETVPPVVTRAEPHNQAILHPVQDRVLSIRENARLQGFP  92

Query  345  DYYKLCGPIKERYIQVGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGYGEIAATL  169
            DYYKL GP+KERYIQVGNAVAVPV+RALGY+L LA++G +S  EP   LP  +  I+   
Sbjct  93   DYYKLFGPVKERYIQVGNAVAVPVSRALGYALGLAYQGVVSNDEPLTKLPPRFPNISEKA  152

Query  168  VESAAE  151
               +++
Sbjct  153  SSDSSQ  158



>ref|XP_006599217.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Glycine max]
Length=777

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E RD+M Y + P +EFQ++IR  +  + G           +L+DHRP  L +DDY 
Sbjct  501  VMNTETRDEMPYQNPPETEFQRYIRSTKYEMTGSKSNGTTEKRPLLYDHRPYFLFEDDYL  560

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V   P  E   L SGKPLVP+Y  +F  G S +P
Sbjct  561  RVCQIPKRKGANFRDLPGVIVGADNVVRRHP-TENPLLPSGKPLVPEYCFTFEHGKSKRP  619

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE +PT +T    HNQ +LHP QDRVLTIRE ARLQGFPDYY+  G +KERY Q
Sbjct  620  FARLWWDENLPTALTFPSCHNQVVLHPEQDRVLTIREFARLQGFPDYYRFYGTVKERYCQ  679

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAVAVPV+RALGY+L LA + L+G EP   LP  + 
Sbjct  680  IGNAVAVPVSRALGYALGLACRKLNGNEPLVTLPSKFS  717



>ref|XP_002886525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62784.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=732

 Score =   233 bits (594),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 149/217 (69%), Gaps = 9/217 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL---------GRDGLPGIVLHDHRPLQLNDDDYQR  655
            V N E+R+ + Y  +P +EFQ+FI L         G +     +L+DH+PLQ+N DDYQR
Sbjct  492  VTNFEEREAINYDIEPETEFQKFISLPRADTLISNGEEESQLRILYDHQPLQMNKDDYQR  551

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C+I K KGA F DL GV   D  V  DP+VERV L SGKP+VP+YA+++  G S KPF 
Sbjct  552  ACNISKKKGAYFTDLGGVVFEDKTVRIDPSVERVILPSGKPMVPNYAITYRDGKSKKPFG  611

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLW+DE + TVVTRA+PHNQ +LHP Q+RVL+ RENARLQGFPD Y+L GP+ E+YIQVG
Sbjct  612  RLWYDEIINTVVTRAQPHNQCVLHPKQNRVLSARENARLQGFPDCYRLYGPVDEKYIQVG  671

Query  294  NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYGE  184
            NAVAVPV  ALGY+  +A + L   +P    P  Y E
Sbjct  672  NAVAVPVGVALGYAFGMASQRLCDDKPVIDYPFMYPE  708



>gb|KHN10109.1| DNA (cytosine-5)-methyltransferase CMT2 [Glycine soja]
Length=1031

 Score =   234 bits (598),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E RD+M Y + P +EFQ++IR  +  + G           +L+DHRP  L +DDY 
Sbjct  755  VMNTETRDEMPYQNPPETEFQRYIRSTKYEMTGSKSNGTTEKRPLLYDHRPYFLFEDDYL  814

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V   P  E   L SGKPLVP+Y  +F  G S +P
Sbjct  815  RVCQIPKRKGANFRDLPGVIVGADNVVRRHP-TENPLLPSGKPLVPEYCFTFEHGKSKRP  873

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE +PT +T    HNQ +LHP QDRVLTIRE ARLQGFPDYY+  G +KERY Q
Sbjct  874  FARLWWDENLPTALTFPSCHNQVVLHPEQDRVLTIREFARLQGFPDYYRFYGTVKERYCQ  933

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAVAVPV+RALGY+L LA + L+G EP   LP  + 
Sbjct  934  IGNAVAVPVSRALGYALGLACRKLNGNEPLVTLPSKFS  971



>ref|XP_006599216.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Glycine max]
Length=1042

 Score =   234 bits (597),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E RD+M Y + P +EFQ++IR  +  + G           +L+DHRP  L +DDY 
Sbjct  766  VMNTETRDEMPYQNPPETEFQRYIRSTKYEMTGSKSNGTTEKRPLLYDHRPYFLFEDDYL  825

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V   P  E   L SGKPLVP+Y  +F  G S +P
Sbjct  826  RVCQIPKRKGANFRDLPGVIVGADNVVRRHP-TENPLLPSGKPLVPEYCFTFEHGKSKRP  884

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDE +PT +T    HNQ +LHP QDRVLTIRE ARLQGFPDYY+  G +KERY Q
Sbjct  885  FARLWWDENLPTALTFPSCHNQVVLHPEQDRVLTIREFARLQGFPDYYRFYGTVKERYCQ  944

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            +GNAVAVPV+RALGY+L LA + L+G EP   LP  + 
Sbjct  945  IGNAVAVPVSRALGYALGLACRKLNGNEPLVTLPSKFS  982



>ref|XP_006599215.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Glycine max]
Length=1118

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V N E RD+M Y + P +EFQ++IR  +  + G           +L+DHRP  L +DDY 
Sbjct  842   VMNTETRDEMPYQNPPETEFQRYIRSTKYEMTGSKSNGTTEKRPLLYDHRPYFLFEDDYL  901

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPGV V  DN V   P  E   L SGKPLVP+Y  +F  G S +P
Sbjct  902   RVCQIPKRKGANFRDLPGVIVGADNVVRRHP-TENPLLPSGKPLVPEYCFTFEHGKSKRP  960

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDE +PT +T    HNQ +LHP QDRVLTIRE ARLQGFPDYY+  G +KERY Q
Sbjct  961   FARLWWDENLPTALTFPSCHNQVVLHPEQDRVLTIREFARLQGFPDYYRFYGTVKERYCQ  1020

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             +GNAVAVPV+RALGY+L LA + L+G EP   LP  + 
Sbjct  1021  IGNAVAVPVSRALGYALGLACRKLNGNEPLVTLPSKFS  1058



>gb|KDO42579.1| hypothetical protein CISIN_1g0039741mg, partial [Citrus sinensis]
Length=381

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 133/177 (75%), Gaps = 11/177 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V NNE  D+ +Y     +EFQ++IRL R  +  +          +L+DHRP Q+N+DDY+
Sbjct  205  VTNNESEDERKYGTVARTEFQKYIRLRRHDVVNLSSAQMASRPSLLYDHRPFQVNNDDYE  264

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DNKV WDP++ERV L SGKPLVPDYAM F   +S+KP
Sbjct  265  RVCCIPKRKGANFRDLPGVLVGPDNKVRWDPSMERVMLKSGKPLVPDYAMKFEHQSSTKP  324

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKER  310
            F RLWWDE V TVVTRA+PHN+ +LHP QDRVLTIRENARLQGFPD Y+L GP+KER
Sbjct  325  FGRLWWDEIVNTVVTRAQPHNRILLHPSQDRVLTIRENARLQGFPDCYQLFGPVKER  381



>ref|XP_010665041.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=1349

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 144/215 (67%), Gaps = 12/215 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
             V N E RD+M Y   P +EFQ++IR  +D + G            +L+DHRP  LN+D+Y
Sbjct  1127  VTNYETRDEMLYGKPPETEFQKYIRSTKDAMAGSSSSGITKGYNSILYDHRPYPLNEDNY  1186

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
              R+C IP+ KGANFRDL GV V  DN    DP ++ + L SG PLVPD   S+  G S +
Sbjct  1187  LRICQIPRRKGANFRDLSGVIVGTDNVAVRDPTMKPILLPSGHPLVPDCVFSYEQGKSKR  1246

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF RLWWDETVPTV+T     NQAILHP QDRVLTIRE ARLQGFPDYY+  G +KERY 
Sbjct  1247  PFARLWWDETVPTVLTFPYLRNQAILHPEQDRVLTIRECARLQGFPDYYRFRGTVKERYC  1306

Query  303   QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             Q+GNAVA PVARALGY L +AF+  SG E    LP
Sbjct  1307  QIGNAVAFPVARALGYMLGMAFQNQSGNEALATLP  1341



>ref|XP_010665031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=1432

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 144/215 (67%), Gaps = 12/215 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
             V N E RD+M Y   P +EFQ++IR  +D + G            +L+DHRP  LN+D+Y
Sbjct  1210  VTNYETRDEMLYGKPPETEFQKYIRSTKDAMAGSSSSGITKGYNSILYDHRPYPLNEDNY  1269

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
              R+C IP+ KGANFRDL GV V  DN    DP ++ + L SG PLVPD   S+  G S +
Sbjct  1270  LRICQIPRRKGANFRDLSGVIVGTDNVAVRDPTMKPILLPSGHPLVPDCVFSYEQGKSKR  1329

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF RLWWDETVPTV+T     NQAILHP QDRVLTIRE ARLQGFPDYY+  G +KERY 
Sbjct  1330  PFARLWWDETVPTVLTFPYLRNQAILHPEQDRVLTIRECARLQGFPDYYRFRGTVKERYC  1389

Query  303   QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             Q+GNAVA PVARALGY L +AF+  SG E    LP
Sbjct  1390  QIGNAVAFPVARALGYMLGMAFQNQSGNEALATLP  1424



>ref|XP_010665035.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=1430

 Score =   235 bits (600),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 144/215 (67%), Gaps = 12/215 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
             V N E RD+M Y   P +EFQ++IR  +D + G            +L+DHRP  LN+D+Y
Sbjct  1208  VTNYETRDEMLYGKPPETEFQKYIRSTKDAMAGSSSSGITKGYNSILYDHRPYPLNEDNY  1267

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
              R+C IP+ KGANFRDL GV V  DN    DP ++ + L SG PLVPD   S+  G S +
Sbjct  1268  LRICQIPRRKGANFRDLSGVIVGTDNVAVRDPTMKPILLPSGHPLVPDCVFSYEQGKSKR  1327

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF RLWWDETVPTV+T     NQAILHP QDRVLTIRE ARLQGFPDYY+  G +KERY 
Sbjct  1328  PFARLWWDETVPTVLTFPYLRNQAILHPEQDRVLTIRECARLQGFPDYYRFRGTVKERYC  1387

Query  303   QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             Q+GNAVA PVARALGY L +AF+  SG E    LP
Sbjct  1388  QIGNAVAFPVARALGYMLGMAFQNQSGNEALATLP  1422



>ref|XP_006432633.1| hypothetical protein CICLE_v100004872mg, partial [Citrus clementina]
 gb|ESR45873.1| hypothetical protein CICLE_v100004872mg, partial [Citrus clementina]
Length=188

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 128/173 (74%), Gaps = 1/173 (1%)
 Frame = -1

Query  705  VLHDHRPLQLNDDDYQRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLV  526
            +L+DHRP +L++DDY RVC IPK KGANFRDLPGV V  + V      E++ L SGKP++
Sbjct  1    MLYDHRPKRLSEDDYIRVCQIPKRKGANFRDLPGVVVGADNVARRTE-EQMLLPSGKPMI  59

Query  525  PDYAMSFVGGTSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFP  346
            PDYA++F  G S +PF RLWWDET+ TVVT    H+ A+LHP QDRVLTIRE ARLQGFP
Sbjct  60   PDYALTFEQGKSRRPFARLWWDETMTTVVTFPSLHSMAVLHPEQDRVLTIRECARLQGFP  119

Query  345  DYYKLCGPIKERYIQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            DYY+ CG +KERY QVGNAV V VARALGY+L +AF+ L   +P   LP  + 
Sbjct  120  DYYRFCGTVKERYCQVGNAVPVVVARALGYALGMAFQKLGDDKPLMTLPPKFS  172



>ref|XP_011075808.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Sesamum indicum]
Length=907

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 149/229 (65%), Gaps = 15/229 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N+EKRD   Y   P +EFQ +IR  +  + G            VL+DH P  L+DDDY
Sbjct  674  VANDEKRDKTSYRKAPETEFQNYIRAAKLDMMGSSSCETSMGKNPVLYDHLPYPLSDDDY  733

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPG+ +  DN+V      +   + SGKP VPDYA++F  G S+K
Sbjct  734  MRVCKIPKRKGANFRDLPGIIIGSDNRVRRAKQPD--LMPSGKPWVPDYAINFRDGKSTK  791

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV    +PH +A+LHP QDR+LT+RE ARLQGF DYYK CG +KERY 
Sbjct  792  PFGRLWWDETVPTVFCFPDPHMRAVLHPEQDRLLTLRECARLQGFHDYYKFCGKLKERYS  851

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGM-EPTFGLPEGYGEIAATLVES  160
            QVGNAVAV V RALGYSL +A + LSG  E    LP  +     T ++S
Sbjct  852  QVGNAVAVSVGRALGYSLGMAVQKLSGGDEHLMTLPPNFSHSTTTQLQS  900



>ref|XP_011075807.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Sesamum indicum]
Length=911

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 149/229 (65%), Gaps = 15/229 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDY  661
            V N+EKRD   Y   P +EFQ +IR  +  + G            VL+DH P  L+DDDY
Sbjct  678  VANDEKRDKTSYRKAPETEFQNYIRAAKLDMMGSSSCETSMGKNPVLYDHLPYPLSDDDY  737

Query  660  QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             RVC IPK KGANFRDLPG+ +  DN+V      +   + SGKP VPDYA++F  G S+K
Sbjct  738  MRVCKIPKRKGANFRDLPGIIIGSDNRVRRAKQPD--LMPSGKPWVPDYAINFRDGKSTK  795

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTV    +PH +A+LHP QDR+LT+RE ARLQGF DYYK CG +KERY 
Sbjct  796  PFGRLWWDETVPTVFCFPDPHMRAVLHPEQDRLLTLRECARLQGFHDYYKFCGKLKERYS  855

Query  303  QVGNAVAVPVARALGYSLALAFKGLSGM-EPTFGLPEGYGEIAATLVES  160
            QVGNAVAV V RALGYSL +A + LSG  E    LP  +     T ++S
Sbjct  856  QVGNAVAVSVGRALGYSLGMAVQKLSGGDEHLMTLPPNFSHSTTTQLQS  904



>ref|XP_007156278.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
 gb|ESW28272.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
Length=1047

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V+N+E R++M Y   P +EFQ++IR  +  + G           +L+DHRP  L++DD+Q
Sbjct  815   VKNSETREEMPYRSPPETEFQRYIRSTKYEMTGSKSNETKEKRPLLYDHRPHTLSEDDHQ  874

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RV  IPK KGANFRDLPGV V  DN V   P  E   L SGKPL+PDY  +F  G S +P
Sbjct  875   RVSQIPKRKGANFRDLPGVIVGADNVVRRHP-TENPMLPSGKPLIPDYCFTFEQGKSKRP  933

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDE +PT +T    HNQ +LHP QDRVLTIRE ARLQGFPDYY+  G  K+RY Q
Sbjct  934   FARLWWDENLPTALTFPSCHNQVVLHPEQDRVLTIREFARLQGFPDYYRFHGTAKKRYCQ  993

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             +GNAVAV V+RALGY+L LA + LSG EP   LP  + 
Sbjct  994   IGNAVAVSVSRALGYTLGLACRKLSGNEPLVALPPKFS  1031



>ref|XP_009392768.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1098

 Score =   230 bits (586),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 149/217 (69%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V+++E  D M Y   P +EFQ++IR+ +D + G+          +L+DH  L L +DDY 
Sbjct  872   VKHSEDMDQMPYGKSPQTEFQRYIRMPKDEMLGLKENGAKISKSMLYDHCTLPLGEDDYL  931

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             R+  IP+ KGANFRDLPGV V  DN V +DP  ERV L SG+PLVPDYAM+F  G S +P
Sbjct  932   RISQIPRKKGANFRDLPGVIVGSDNSVQFDPTRERVLLPSGRPLVPDYAMNFGHGKSLRP  991

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDE VPTV+T      QA++HP QDR L+IRE ARLQGFPD+Y+  G ++ERY Q
Sbjct  992   FSRLWWDEIVPTVITIPNFRCQAMIHPEQDRTLSIRECARLQGFPDFYRFYGTVEERYRQ  1051

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAVPV R LGY+LA+++   SG EP   LP  +
Sbjct  1052  IGNAVAVPVGRTLGYALAMSWLRKSGDEPLMTLPSNF  1088



>ref|XP_009392766.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1098

 Score =   230 bits (586),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 149/217 (69%), Gaps = 11/217 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V+++E  D M Y   P +EFQ++IR+ +D + G+          +L+DH  L L +DDY 
Sbjct  872   VKHSEDMDQMPYGKSPQTEFQRYIRMPKDEMLGLKENGAKISKSMLYDHCTLPLGEDDYL  931

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             R+  IP+ KGANFRDLPGV V  DN V +DP  ERV L SG+PLVPDYAM+F  G S +P
Sbjct  932   RISQIPRKKGANFRDLPGVIVGSDNSVQFDPTRERVLLPSGRPLVPDYAMNFGHGKSLRP  991

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDE VPTV+T      QA++HP QDR L+IRE ARLQGFPD+Y+  G ++ERY Q
Sbjct  992   FSRLWWDEIVPTVITIPNFRCQAMIHPEQDRTLSIRECARLQGFPDFYRFYGTVEERYRQ  1051

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGY  190
             +GNAVAVPV R LGY+LA+++   SG EP   LP  +
Sbjct  1052  IGNAVAVPVGRTLGYALAMSWLRKSGDEPLMTLPSNF  1088



>ref|XP_008448611.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Cucumis melo]
Length=1022

 Score =   229 bits (584),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 147/216 (68%), Gaps = 10/216 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
             V N+E R+ M Y   P +EFQ++IR  +  + G         +L+DH+P  L +DD+ RV
Sbjct  791   VSNSESREKMPYEKPPETEFQRYIRSSKYEMTGCETDSNSTDLLYDHQPHSLGEDDHLRV  850

Query  651   CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C+IPK KGANFRDLPGV V  DN V  DP  E + L SGK +VPDYA++F  G S +PF 
Sbjct  851   CNIPKRKGANFRDLPGVIVGSDNVVRRDPANEAL-LPSGKLMVPDYAITFEQGKSKRPFG  909

Query  474   RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
             RLWWDETVPTVVT    H+   LHP QDRVLTIRE ARLQGFPDYYK  G +KERY QVG
Sbjct  910   RLWWDETVPTVVTFPSCHSSVALHPEQDRVLTIREYARLQGFPDYYKFSGSVKERYRQVG  969

Query  294   NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             NAVAV V+RALGYSL L+ + + G EP   LP  + 
Sbjct  970   NAVAVSVSRALGYSLGLSVRRMGGDEPLMVLPPKFS  1005



>ref|XP_008448610.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Cucumis melo]
Length=1247

 Score =   230 bits (586),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 146/216 (68%), Gaps = 10/216 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
             V N+E R+ M Y   P +EFQ++IR  +  + G         +L+DH+P  L +DD+ RV
Sbjct  1016  VSNSESREKMPYEKPPETEFQRYIRSSKYEMTGCETDSNSTDLLYDHQPHSLGEDDHLRV  1075

Query  651   CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C+IPK KGANFRDLPGV V  DN V  DP  E   L SGK +VPDYA++F  G S +PF 
Sbjct  1076  CNIPKRKGANFRDLPGVIVGSDNVVRRDPANE-ALLPSGKLMVPDYAITFEQGKSKRPFG  1134

Query  474   RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
             RLWWDETVPTVVT    H+   LHP QDRVLTIRE ARLQGFPDYYK  G +KERY QVG
Sbjct  1135  RLWWDETVPTVVTFPSCHSSVALHPEQDRVLTIREYARLQGFPDYYKFSGSVKERYRQVG  1194

Query  294   NAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             NAVAV V+RALGYSL L+ + + G EP   LP  + 
Sbjct  1195  NAVAVSVSRALGYSLGLSVRRMGGDEPLMVLPPKFS  1230



>ref|XP_010677407.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=774

 Score =   226 bits (577),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 145/215 (67%), Gaps = 8/215 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG-------IVLHDHRPLQLNDDDYQRVC  649
            V N E  D M Y   P +EFQ++IR  +  +          VL+DHRP QL +DDY RVC
Sbjct  551  VTNYESLDAMPYSRPPETEFQKYIRSTKYDMCNSASTEEEAVLYDHRPHQLFEDDYIRVC  610

Query  648  HIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
             IP+ KGANFRDLPGV V  DN V  D   E V L SG+P+VP+YA +F  G S +PF R
Sbjct  611  QIPQRKGANFRDLPGVIVGDDNVVRRDLTQETVLLPSGRPMVPEYAFTFEQGKSKRPFAR  670

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
            LWWDET+PT+VT    H+QA+LHP QDRVL++RE ARLQGFPD Y+  G +K+RY QVGN
Sbjct  671  LWWDETMPTIVTYPNCHSQAVLHPEQDRVLSVRECARLQGFPDNYRFSGTVKKRYRQVGN  730

Query  291  AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            AVAVPVA+ALGY+L +A + L   EP   LP  + 
Sbjct  731  AVAVPVAKALGYALGMASQRLIDKEPLLTLPPKFA  765



>gb|KJB25184.1| hypothetical protein B456_004G180200, partial [Gossypium raimondii]
Length=983

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 143/214 (67%), Gaps = 11/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V NNE R+ M Y   P ++FQ++IR     + G           +L+DHRP  L++DDY 
Sbjct  751  VANNEAREKMTYEKPPETDFQRYIRSSEYKMTGSELNGAKRITNLLYDHRPSPLSEDDYI  810

Query  657  RVCHIPKAKGANFRDLPGVRVVDNKVHWDPNV-ERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC  PK KGANFRDLPGV V  + V W     E+ +L SGKPLVPDY  +   G S +P
Sbjct  811  RVCLNPKRKGANFRDLPGVIVGTDNVAWRGRTQEQQFLPSGKPLVPDYVFTLKQGKSKRP  870

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDET+PTV+T    H+QAILHP QD +LT RE ARLQGFPDYY+  G IKERY Q
Sbjct  871  FARLWWDETMPTVLTAPFCHSQAILHPEQDWLLTAREWARLQGFPDYYRFRGTIKERYCQ  930

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            +GNAVAVPV RALGY++ +AF+  SG EP   LP
Sbjct  931  IGNAVAVPVGRALGYTMGMAFQKGSGNEPLMILP  964



>gb|KEH20304.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
Length=1011

 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 143/214 (67%), Gaps = 11/214 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
            V N E RD+M Y + P +EFQ++IR  +  + G           +L+DHRPL +++DDY 
Sbjct  743  VTNFETRDEMPYQNPPETEFQRYIRSTKHEVTGSTLNGATKKTHILYDHRPLFMSEDDYL  802

Query  657  RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
            RVC IPK KGANFRDLPGV V  DN V   P      L SGK LVPDY  ++  G S +P
Sbjct  803  RVCQIPKRKGANFRDLPGVVVGADNVVRPHPTENIPLLPSGKRLVPDYCFTYEQGRSKRP  862

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            F RLWWDETVPT +T    HNQ ++HP QDR+LT+RE ARLQGF DYY+ CG +KERY Q
Sbjct  863  FGRLWWDETVPTALTSPSCHNQVVIHPEQDRILTVREFARLQGFHDYYRFCGSVKERYRQ  922

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
            +GNAVAVPV+RALGY+L +A + L   E    LP
Sbjct  923  IGNAVAVPVSRALGYALGIAHRKLGSNEHHMTLP  956



>ref|XP_010677408.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=773

 Score =   226 bits (576),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 145/215 (67%), Gaps = 8/215 (4%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG-------IVLHDHRPLQLNDDDYQRVC  649
            V N E  D M Y   P +EFQ++IR  +  +          VL+DHRP QL +DDY RVC
Sbjct  550  VTNYESLDAMPYSRPPETEFQKYIRSTKYDMCNSASTEEEAVLYDHRPHQLFEDDYIRVC  609

Query  648  HIPKAKGANFRDLPGVRVVD-NKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
             IP+ KGANFRDLPGV V D N V  D   E V L SG+P+VP+YA +F  G S +PF R
Sbjct  610  QIPQRKGANFRDLPGVIVGDDNVVRRDLTQETVLLPSGRPMVPEYAFTFEQGKSKRPFAR  669

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
            LWWDET+PT+VT    H+QA+LHP QDRVL++RE ARLQGFPD Y+  G +K+RY QVGN
Sbjct  670  LWWDETMPTIVTYPNCHSQAVLHPEQDRVLSVRECARLQGFPDNYRFSGTVKKRYRQVGN  729

Query  291  AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            AVAVPVA+ALGY+L +A + L   EP   LP  + 
Sbjct  730  AVAVPVAKALGYALGMASQRLIDKEPLLTLPPKFA  764



>ref|XP_010677406.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1060

 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 145/215 (67%), Gaps = 8/215 (4%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG-------IVLHDHRPLQLNDDDYQRVC  649
             V N E  D M Y   P +EFQ++IR  +  +          VL+DHRP QL +DDY RVC
Sbjct  837   VTNYESLDAMPYSRPPETEFQKYIRSTKYDMCNSASTEEEAVLYDHRPHQLFEDDYIRVC  896

Query  648   HIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
              IP+ KGANFRDLPGV V  DN V  D   E V L SG+P+VP+YA +F  G S +PF R
Sbjct  897   QIPQRKGANFRDLPGVIVGDDNVVRRDLTQETVLLPSGRPMVPEYAFTFEQGKSKRPFAR  956

Query  471   LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
             LWWDET+PT+VT    H+QA+LHP QDRVL++RE ARLQGFPD Y+  G +K+RY QVGN
Sbjct  957   LWWDETMPTIVTYPNCHSQAVLHPEQDRVLSVRECARLQGFPDNYRFSGTVKKRYRQVGN  1016

Query  291   AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             AVAVPVA+ALGY+L +A + L   EP   LP  + 
Sbjct  1017  AVAVPVAKALGYALGMASQRLIDKEPLLTLPPKFA  1051



>gb|KGN55702.1| hypothetical protein Csa_3G006640 [Cucumis sativus]
Length=1239

 Score =   229 bits (583),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 144/212 (68%), Gaps = 10/212 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
             V N+E  + M Y   P +EFQ++IR  +  + G          L+DH+P  L +DD+ RV
Sbjct  1008  VSNSESWEKMPYEKPPETEFQRYIRSSKYEMTGCETDNRSTDTLYDHQPHLLGEDDHLRV  1067

Query  651   CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C+IPK KGANFRDLPGV V  DN V  DP  E V L SGK +VPDYA+SF  G S +PF 
Sbjct  1068  CNIPKRKGANFRDLPGVIVGSDNVVRRDPANE-VLLPSGKLMVPDYAISFEQGRSKRPFG  1126

Query  474   RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
             RLWWDETVPTVVT    H+   LHP QDRVLTIRE ARLQGFPDYYK  G +KERY QVG
Sbjct  1127  RLWWDETVPTVVTFPSCHSSVALHPEQDRVLTIREYARLQGFPDYYKFSGSVKERYRQVG  1186

Query  294   NAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             NAVAV V+RALGYSL LA + + G EP   LP
Sbjct  1187  NAVAVSVSRALGYSLGLAVRRMGGDEPLMVLP  1218



>ref|XP_004146191.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
 ref|XP_004164187.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
Length=1243

 Score =   229 bits (583),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 144/212 (68%), Gaps = 10/212 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
             V N+E  + M Y   P +EFQ++IR  +  + G          L+DH+P  L +DD+ RV
Sbjct  1012  VSNSESWEKMPYEKPPETEFQRYIRSSKYEMTGCETDNRSTDTLYDHQPHLLGEDDHLRV  1071

Query  651   CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
             C+IPK KGANFRDLPGV V  DN V  DP  E V L SGK +VPDYA+SF  G S +PF 
Sbjct  1072  CNIPKRKGANFRDLPGVIVGSDNVVRRDPANE-VLLPSGKLMVPDYAISFEQGRSKRPFG  1130

Query  474   RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
             RLWWDETVPTVVT    H+   LHP QDRVLTIRE ARLQGFPDYYK  G +KERY QVG
Sbjct  1131  RLWWDETVPTVVTFPSCHSSVALHPEQDRVLTIREYARLQGFPDYYKFSGSVKERYRQVG  1190

Query  294   NAVAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             NAVAV V+RALGYSL LA + + G EP   LP
Sbjct  1191  NAVAVSVSRALGYSLGLAVRRMGGDEPLMVLP  1222



>ref|NP_001054957.2| Os05g0224800 [Oryza sativa Japonica Group]
 gb|AAW56861.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF16871.2| Os05g0224800 [Oryza sativa Japonica Group]
Length=304

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 145/220 (66%), Gaps = 14/220 (6%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIR------------LGRDGLPGIVLHDHRPLQLNDDD  664
            V N E RD+M YV  P +EFQ++IR            + +D      L+DHRPL L++D+
Sbjct  77   VANGESRDEMLYVKGPQTEFQRYIRSFNVEVHGPRAHVTKDS-KSSKLYDHRPLVLDNDN  135

Query  663  YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
            YQR+  IPK KGANFRDL GV V  DN    DP  ERV L SG+PLV D  +++  G S 
Sbjct  136  YQRILQIPKRKGANFRDLSGVIVGPDNVARLDPTKERVLLPSGRPLVLDCILAYENGKSL  195

Query  486  KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
            +PF R+WWDE V TV+T      QA++HP QDR+LTIRE+ARLQGFPD Y+  G +K+RY
Sbjct  196  RPFGRVWWDEVVGTVLTVPNARMQALIHPAQDRLLTIRESARLQGFPDNYRFRGTVKDRY  255

Query  306  IQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             Q+GNAVAVPV RALGY+LA+A+   SG +P   LP  + 
Sbjct  256  RQIGNAVAVPVGRALGYALAMAYLKKSGDDPLMLLPPNFA  295



>ref|XP_006655109.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Oryza 
brachyantha]
Length=1221

 Score =   226 bits (575),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 147/219 (67%), Gaps = 12/219 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG-----------IVLHDHRPLQLNDDDY  661
             V N E RD+M Y+  P +EFQ++IR     +PG             L+DHRPL L++D+Y
Sbjct  994   VANEESRDEMLYIKGPQTEFQRYIRSFNVEVPGPKAHVTKDFLSSKLYDHRPLVLDNDNY  1053

Query  660   QRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
             QRV  IPK KGANFRDLPGV V  DN    DP  ER++L SG+PLV D  + +  G S +
Sbjct  1054  QRVLQIPKKKGANFRDLPGVVVGPDNVARLDPTKERIFLPSGRPLVLDCILGYENGKSLR  1113

Query  483   PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
             PF R+WWDE V TV+T      QA++HP QDR+LTIRE+ARLQGFPD Y+ CG +K+RY 
Sbjct  1114  PFGRVWWDEVVGTVLTVPNARMQALIHPAQDRLLTIRESARLQGFPDKYRFCGTVKDRYR  1173

Query  303   QVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             Q+GNAVA+PV RALGY+LA+A+   +G +P   LP  + 
Sbjct  1174  QIGNAVAIPVGRALGYTLAMAYLKKTGDDPLMVLPPNFA  1212



>ref|XP_010324482.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Solanum lycopersicum]
Length=1075

 Score =   224 bits (572),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 144/215 (67%), Gaps = 11/215 (5%)
 Frame = -1

Query  798   NEKRDDMEYVDKPGSEFQQFIRLGRDGL-----PGI------VLHDHRPLQLNDDDYQRV  652
             +E R++  Y   P +EFQ++IRL +  +      G+      VL DHRP QLN+DDY RV
Sbjct  847   HETREERPYEMPPETEFQKYIRLSKHEILSCTSTGVKETKEPVLSDHRPCQLNEDDYLRV  906

Query  651   CHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
             C +P+ KGANFRDLPGV V  + V      +   L +GKP+VPD A +F  G S +PF R
Sbjct  907   CLVPRRKGANFRDLPGVIVGGDNVARRDTKDPKVLPNGKPMVPDCAFNFEHGKSKRPFAR  966

Query  471   LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
             LWWDETV T+VT      QAILHP QDRVLTIRE ARLQGFPD+Y+  G +KERY QVGN
Sbjct  967   LWWDETVATLVTFPNHRAQAILHPEQDRVLTIREYARLQGFPDFYRFTGTLKERYCQVGN  1026

Query  291   AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             AVAVPV RALGY+L LA++ L+G EP   LP  + 
Sbjct  1027  AVAVPVGRALGYALGLAYQRLAGNEPLIKLPSNFS  1061



>gb|AEP33250.1| CMT-type DNA-methyltransferase [Posidonia oceanica]
Length=802

 Score =   223 bits (568),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 141/203 (69%), Gaps = 12/203 (6%)
 Frame = -1

Query  795  EKRDDMEYVDKPGSEFQQFIRLGRDGL-----------PGIVLHDHRPLQLNDDDYQRVC  649
            E RD + Y   P +EFQ++IR  +  +              VL+DH  LQL+ ++Y R+C
Sbjct  556  ETRDQLSYGKAPQTEFQRYIRASKSEIMCSKDYDAKKSRTSVLYDHCSLQLSKENYSRIC  615

Query  648  HIPKAKGANFRDLPGVRVV-DNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
             IP+ KGA FRDLPGV V+ DN    DP+ E   L SGKPLVP++  ++  G S +PF R
Sbjct  616  QIPRRKGACFRDLPGVIVLPDNSTQRDPSKEMELLPSGKPLVPNFCFTYENGKSLRPFGR  675

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
            LWWDETVPTV+T A PH QAILHP QDRVLT+RENARLQGFPD+Y+  G IKERY Q+GN
Sbjct  676  LWWDETVPTVLTTAGPHFQAILHPEQDRVLTVRENARLQGFPDFYRFSGTIKERYCQIGN  735

Query  291  AVAVPVARALGYSLALAFKGLSG  223
            AVA+PV+RALGY++ +A+   +G
Sbjct  736  AVAIPVSRALGYAMGVAWPEEAG  758



>ref|XP_006361281.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Solanum 
tuberosum]
Length=1086

 Score =   224 bits (572),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 142/215 (66%), Gaps = 11/215 (5%)
 Frame = -1

Query  798   NEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDYQRV  652
             +E R++  Y   P +EFQ+++RL +  +              VL DHRP QLN+DDY RV
Sbjct  858   HETREERPYEIPPETEFQKYMRLSKHEIMSCSSTGVKETKEPVLSDHRPCQLNEDDYLRV  917

Query  651   CHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
             C +P+ KGANFRDLPGV V  + V      +   L +GKP+VPD A +F  G S +PF R
Sbjct  918   CLVPRRKGANFRDLPGVIVGGDNVARRDTKDPKVLPNGKPMVPDCAFNFENGKSKRPFAR  977

Query  471   LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
             LWWDETV T+VT      QAILHP QDRVLTIRE ARLQGFPD+Y+  G +KERY QVGN
Sbjct  978   LWWDETVATLVTFPNHRAQAILHPEQDRVLTIREYARLQGFPDFYRFTGTLKERYCQVGN  1037

Query  291   AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             AVAVPV RALGY+L LA++ L+G EP   LP  + 
Sbjct  1038  AVAVPVGRALGYALGLAYQRLAGNEPLIKLPSNFS  1072



>ref|XP_011465071.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Fragaria vesca subsp. vesca]
Length=1082

 Score =   224 bits (571),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 146/218 (67%), Gaps = 18/218 (8%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V++NEK ++M + + P ++FQ++IR  +  + G           +L+DHR L L++DDY 
Sbjct  858   VKHNEKSEEMSFKNPPETDFQRYIRSTQYEMVGYALDDTMKKENLLYDHRSLPLHEDDYA  917

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IPK KGANFRDLPGV V  DN    D   +++ L SGKPLVPDYA +F  G S +P
Sbjct  918   RVCQIPKQKGANFRDLPGVVVGRDNVARRDLTEKQLVLPSGKPLVPDYAFTFEQGKSKRP  977

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETV TV+T    HNQ       DR+LT+RE ARLQGFPDYY+ CG +KERY Q
Sbjct  978   FGRLWWDETVATVLTFPSCHNQ-------DRILTLRECARLQGFPDYYRFCGTVKERYCQ  1030

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             VGNAVA+PVARALGY+L LA    SG EP   LP  + 
Sbjct  1031  VGNAVAIPVARALGYALGLAVHKSSGNEPLLTLPPKFS  1068



>ref|XP_009785637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like, partial 
[Nicotiana sylvestris]
Length=764

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 141/218 (65%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRL------GRDGL-----PGIVLHDHRPLQLNDDDY  661
            V  +E R++M Y     SEFQ++IRL      GR         G VL DHRP QL +DDY
Sbjct  533  VTGHETREEMPYEMPAESEFQKYIRLPKHEIVGRSSTRDTETKGPVLSDHRPCQLTEDDY  592

Query  660  QRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC +P  KGANFRDLPGV V  + V      +   L +GKP+VPD A +F  G S +P
Sbjct  593  LRVCLVPHKKGANFRDLPGVIVGKDNVARRDTEDPKVLPNGKPMVPDCAFNFEHGKSKRP  652

Query  480  FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
            + RLWWDETV T+VT      QA+LHP QDRVLTIRE ARLQGFPD+Y+  G  KERY Q
Sbjct  653  YARLWWDETVATLVTFPNHRAQAVLHPEQDRVLTIRECARLQGFPDFYRFSGTAKERYCQ  712

Query  300  VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            VGNAVAVPV RALGY+L LAF+ L+G EP   LP  + 
Sbjct  713  VGNAVAVPVGRALGYALGLAFQRLTGDEPLIKLPPNFS  750



>ref|XP_009625195.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2, partial [Nicotiana 
tomentosiformis]
Length=773

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 140/215 (65%), Gaps = 11/215 (5%)
 Frame = -1

Query  798  NEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI-----------VLHDHRPLQLNDDDYQRV  652
            +E R++M Y     SEFQ++IRL +  + G            VL DHRP QL +DDY RV
Sbjct  545  HETREEMPYEMPAESEFQKYIRLPKHEIVGCSSTRDTETKDPVLSDHRPCQLAEDDYLRV  604

Query  651  CHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRR  472
            C +P  KGANFRDLPGV V  + V      +   L +GKP+VPD A +F  G S +P+ R
Sbjct  605  CLVPHKKGANFRDLPGVIVGKDNVARRDTEDPKVLPNGKPMVPDCAFNFEHGKSKRPYAR  664

Query  471  LWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGN  292
            LWWDETV T+VT      QA+LHP QDRVLTIRE ARLQGFPD+Y+  G  KERY QVGN
Sbjct  665  LWWDETVATLVTFPNHRAQAVLHPEQDRVLTIREYARLQGFPDFYRFSGTPKERYCQVGN  724

Query  291  AVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
            AVAVPV RALGY+L LAF+ L+G EP   LP  + 
Sbjct  725  AVAVPVGRALGYALGLAFQRLTGNEPLIKLPPNFS  759



>gb|EPS64010.1| cytosine-specific methyltransferase, partial [Genlisea aurea]
Length=396

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 139/207 (67%), Gaps = 16/207 (8%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPG---------------IVLHDHRPLQLN  673
            V N EKR+ M Y   P SEFQ +IRL +  + G                VL DHRPLQL+
Sbjct  166  VTNFEKRERMRYGKPPESEFQSYIRLSQGRIMGKKVVVDDDDDEEMSDDVLCDHRPLQLS  225

Query  672  DDDYQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGG  496
            + D+ R+  IP+ KGANFRDLPG+ V  DN    DP +E V L +G+P+VPD  + +  G
Sbjct  226  EHDFLRIRSIPRRKGANFRDLPGIVVGPDNVARRDPGMEPVMLPTGRPMVPDCLLKYDEG  285

Query  495  TSSKPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIK  316
             S  P+RRLWWDETV TV+T      QA+LHP QDR+L+IRE ARLQGFPD+YK  G IK
Sbjct  286  RSKTPYRRLWWDETVSTVLTMPSIVRQAMLHPEQDRILSIRECARLQGFPDFYKFSGTIK  345

Query  315  ERYIQVGNAVAVPVARALGYSLALAFK  235
            ERY Q+GNAV+VPVARALGY+LA+A +
Sbjct  346  ERYQQIGNAVSVPVARALGYALAVAHR  372



>gb|EYU23276.1| hypothetical protein MIMGU_mgv1a002680mg [Erythranthe guttata]
Length=647

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 147/218 (67%), Gaps = 11/218 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI--------VLHDHRPLQLNDDDYQRV  652
            V N E  ++  Y   P ++FQ +IRL +D + G         +L+DHRPL+L++ DY RV
Sbjct  417  VTNEETLEERIYEKPPETDFQTYIRLTKDEMMGFSSKEKPTPILYDHRPLKLSEHDYLRV  476

Query  651  CHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
              +P  KGAN+RD  GV V  DN    DP++E V L +G+PLVP+  ++F  G S KP+ 
Sbjct  477  LQVPHRKGANYRDFAGVIVGEDNVARKDPSMEAVMLPTGRPLVPESTLTFENGRSKKPYA  536

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLWWDETV T+VT      QAILHP QDR+LT+RE ARLQGFPD+Y+ CG +KERY Q+G
Sbjct  537  RLWWDETVSTLVTFPHVRAQAILHPEQDRLLTVRECARLQGFPDFYRFCGTVKERYCQLG  596

Query  294  NAVAVPVARALGYSLALAFKG--LSGMEPTFGLPEGYG  187
            NAV++PVARALGY+L +A++   ++G E    LPE + 
Sbjct  597  NAVSIPVARALGYALGMAYRKVEVAGDEHLMVLPEKFS  634



>gb|EMT30784.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=731

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 145/228 (64%), Gaps = 47/228 (21%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGR---------DGLP---GIVLHDHRPLQLNDDD  664
            V N +  D ME    P +EFQ++IRL R         D  P      L DH+PL+L+ DD
Sbjct  526  VPNYQPNDLMENRINPKTEFQRYIRLSRKDMEDYSFGDATPSPKACQLFDHQPLELSTDD  585

Query  663  YQRVCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            YQR        GANFRDL GV+V                       P YAM+++ G S K
Sbjct  586  YQR--------GANFRDLKGVQV-----------------------PYYAMTYIKGKSPK  614

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVTRAEPHNQ ILHP Q RVLT+RENARLQGFPDYY+L GPIK++YI
Sbjct  615  PFGRLWWDETVPTVVTRAEPHNQIILHPNQHRVLTVRENARLQGFPDYYRLFGPIKQKYI  674

Query  303  QVGNAVAVPVARALGYSLALAFKG-LSGMEPTFGLPEGY---GEIAAT  172
            QVGNAVAVPVARALGYSL  A++G L G +P F LPE +   G+ AAT
Sbjct  675  QVGNAVAVPVARALGYSLGQAYRGALVGGQPLFELPENFASVGQAAAT  722



>gb|AAC02670.1| chromomethylase [Arabidopsis suecica]
Length=754

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 132/188 (70%), Gaps = 10/188 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N    D M+Y D  P +EF+ FI L R         G P   L DH+PL L DDD +R
Sbjct  568  VTNYVANDVMDYNDAAPKTEFENFISLKRSETLLPACGGDPTRRLFDHQPLVLGDDDLER  627

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            V +IPK KGAN+RD+PGV V +NK   +P   R  L SGK +VP YA+SF+ G S KPF 
Sbjct  628  VSYIPKQKGANYRDMPGVLVHNNKAEINPRF-RAKLKSGKNVVPAYAISFIKGKSKKPFG  686

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLW DE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  687  RLWGDEIVNTVVTRAEPHNQCVIHPMQNRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  746

Query  294  NAVAVPVA  271
            NAVAVPV 
Sbjct  747  NAVAVPVG  754



>gb|AAC02662.1| chromomethylase [Arabidopsis thaliana]
Length=754

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 132/188 (70%), Gaps = 10/188 (5%)
 Frame = -1

Query  807  VENNEKRDDMEYVDK-PGSEFQQFIRLGRD--------GLPGIVLHDHRPLQLNDDDYQR  655
            V N    D M+Y D  P +EF+ FI L R         G P   L DH+PL L DDD +R
Sbjct  568  VTNYVANDVMDYNDAAPKTEFENFISLKRSETLLPACGGDPTRRLFDHQPLVLGDDDLER  627

Query  654  VCHIPKAKGANFRDLPGVRVVDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFR  475
            V +IPK KGAN+RD+PGV V +NK   +P   R  L SGK +VP YA+SF+ G S KPF 
Sbjct  628  VSYIPKQKGANYRDMPGVLVHNNKAEINPRF-RAKLKSGKNVVPAYAISFIKGKSKKPFG  686

Query  474  RLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVG  295
            RLW DE V TVVTRAEPHNQ ++HP+Q+RVL++RENARLQGFPD YKLCG IKE+YIQVG
Sbjct  687  RLWGDEIVNTVVTRAEPHNQCVIHPMQNRVLSVRENARLQGFPDCYKLCGTIKEKYIQVG  746

Query  294  NAVAVPVA  271
            NAVAVPV 
Sbjct  747  NAVAVPVG  754



>gb|EEE62800.1| hypothetical protein OsJ_17603 [Oryza sativa Japonica Group]
Length=1190

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 145/220 (66%), Gaps = 14/220 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIR------------LGRDGLPGIVLHDHRPLQLNDDD  664
             V N E RD+M YV  P +EFQ++IR            + +D      L+DHRPL L++D+
Sbjct  963   VANGESRDEMLYVKGPQTEFQRYIRSFNVEVHGPRAHVTKDSKSS-KLYDHRPLVLDNDN  1021

Query  663   YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
             YQR+  IPK KGANFRDL GV V  DN    DP  ERV L SG+PLV D  +++  G S 
Sbjct  1022  YQRILQIPKRKGANFRDLSGVIVGPDNVARLDPTKERVLLPSGRPLVLDCILAYENGKSL  1081

Query  486   KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
             +PF R+WWDE V TV+T      QA++HP QDR+LTIRE+ARLQGFPD Y+  G +K+RY
Sbjct  1082  RPFGRVWWDEVVGTVLTVPNARMQALIHPAQDRLLTIRESARLQGFPDNYRFRGTVKDRY  1141

Query  306   IQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
              Q+GNAVAVPV RALGY+LA+A+   SG +P   LP  + 
Sbjct  1142  RQIGNAVAVPVGRALGYALAMAYLKKSGDDPLMLLPPNFA  1181



>ref|XP_002439474.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
 gb|EES17904.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
Length=1441

 Score =   215 bits (548),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 143/218 (66%), Gaps = 11/218 (5%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGIVLH----------DHRPLQLNDDDYQ  658
             VEN EKR++M Y+  P +EFQ++IR     + G   H          DHRP  L+ D+Y 
Sbjct  1204  VENGEKREEMLYMKGPQTEFQRYIRSFNSEVLGSRAHVIKVSKSKLFDHRPRALDVDNYL  1263

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RV  IPK KGANFRDLPGV V  DN    DP  ER+ L SG PLV D  +++  G S +P
Sbjct  1264  RVLQIPKKKGANFRDLPGVIVGPDNIARLDPTKERILLPSGNPLVVDCVLAYKNGKSLRP  1323

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             + RLWWDE V TV+T    H QA++HP QDR+LTIRE+ARLQGFPD ++  G +K+RY Q
Sbjct  1324  YGRLWWDEVVGTVLTCPNAHMQALIHPAQDRLLTIRESARLQGFPDSFRFRGTVKDRYRQ  1383

Query  300   VGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
             +GNAVAVPV RALGY+LA+A+   +G +P   LP  + 
Sbjct  1384  IGNAVAVPVGRALGYALAMAYLNKTGDDPLMVLPPKFA  1421



>ref|XP_010054093.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Eucalyptus grandis]
Length=1187

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 142/210 (68%), Gaps = 12/210 (6%)
 Frame = -1

Query  795   EKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQRVCH  646
             E R++M Y   P ++FQ++IR  +  + G +          L+DHRPL ++  +Y R+C 
Sbjct  947   ETREEMPYKKLPETDFQKYIRSTKYEMTGSLSDECTRMRRLLYDHRPLPISGVNYLRICQ  1006

Query  645   IPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRL  469
             IPK KGANFRDLPGV V  DN V  D   E++ L SG+PLVPDY  +F  G S +PF RL
Sbjct  1007  IPKRKGANFRDLPGVIVGADNAVRRDKTKEQL-LPSGEPLVPDYVFTFEQGKSKRPFARL  1065

Query  468   WWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNA  289
             WWDETVPTV+T     +QA LHP QDRVLTIRE ARLQGFPDYY+  G +KERY Q+GNA
Sbjct  1066  WWDETVPTVLTFPYYQSQAALHPEQDRVLTIRECARLQGFPDYYRFSGTVKERYRQIGNA  1125

Query  288   VAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             V + VARALGY+L +A   LSG +P   +P
Sbjct  1126  VPITVARALGYALGVACHKLSGDQPNMIVP  1155



>ref|XP_010054090.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 ref|XP_010054091.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 gb|KCW78468.1| hypothetical protein EUGRSUZ_D02616 [Eucalyptus grandis]
Length=1233

 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 142/210 (68%), Gaps = 12/210 (6%)
 Frame = -1

Query  795   EKRDDMEYVDKPGSEFQQFIRLGRDGLPGIV----------LHDHRPLQLNDDDYQRVCH  646
             E R++M Y   P ++FQ++IR  +  + G +          L+DHRPL ++  +Y R+C 
Sbjct  993   ETREEMPYKKLPETDFQKYIRSTKYEMTGSLSDECTRMRRLLYDHRPLPISGVNYLRICQ  1052

Query  645   IPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKPFRRL  469
             IPK KGANFRDLPGV V  DN V  D   E++ L SG+PLVPDY  +F  G S +PF RL
Sbjct  1053  IPKRKGANFRDLPGVIVGADNAVRRDKTKEQL-LPSGEPLVPDYVFTFEQGKSKRPFARL  1111

Query  468   WWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQVGNA  289
             WWDETVPTV+T     +QA LHP QDRVLTIRE ARLQGFPDYY+  G +KERY Q+GNA
Sbjct  1112  WWDETVPTVLTFPYYQSQAALHPEQDRVLTIRECARLQGFPDYYRFSGTVKERYRQIGNA  1171

Query  288   VAVPVARALGYSLALAFKGLSGMEPTFGLP  199
             V + VARALGY+L +A   LSG +P   +P
Sbjct  1172  VPITVARALGYALGVACHKLSGDQPNMIVP  1201



>gb|EEC78738.1| hypothetical protein OsI_18945 [Oryza sativa Indica Group]
Length=1325

 Score =   214 bits (546),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 145/220 (66%), Gaps = 14/220 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIR------------LGRDGLPGIVLHDHRPLQLNDDD  664
             V N E RD+M YV  P +EFQ++IR            + +D      L+DHRPL L++D+
Sbjct  1098  VANGESRDEMLYVKGPQTEFQRYIRSFNVEVHGPRAHVTKDSKSS-KLYDHRPLVLDNDN  1156

Query  663   YQRVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSS  487
             YQR+  IPK KGANFRDL GV V  DN    DP  ERV L SG+PLV D  +++  G S 
Sbjct  1157  YQRILQIPKRKGANFRDLSGVIVGPDNVARLDPTKERVLLPSGRPLVLDCILAYENGKSL  1216

Query  486   KPFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERY  307
             +PF R+WWDE V TV+T      QA++HP QDR+LTIRE+ARLQGFPD Y+  G +K+RY
Sbjct  1217  RPFGRVWWDEVVGTVLTVPNARMQALIHPAQDRLLTIRESARLQGFPDNYRFRGTVKDRY  1276

Query  306   IQVGNAVAVPVARALGYSLALAFKGLSGMEPTFGLPEGYG  187
              Q+GNAVAVPV RALGY+LA+A+   SG +P   LP  + 
Sbjct  1277  RQIGNAVAVPVGRALGYALAMAYLKKSGDDPLMLLPPNFA  1316



>gb|EMT27177.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=616

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 128/180 (71%), Gaps = 12/180 (7%)
 Frame = -1

Query  807  VENNEKRDDMEYVDKPGSEFQQFIRLGRDGL----------PGI-VLHDHRPLQLNDDDY  661
            V N++  D MEY+ KP +EFQ++IRL R  +          PG   L DH PL+LN DDY
Sbjct  432  VGNDQADDVMEYLVKPKTEFQRYIRLSRKEMLDYSFGDKTGPGEGTLMDHCPLRLNKDDY  491

Query  660  QRVCHIPKAKGANFRDLPGVRVVDNKV-HWDPNVERVYLSSGKPLVPDYAMSFVGGTSSK  484
            +RV  IP  KGANFRDL GVRV  N V  +DP + RVYL SG PLVP+YA+ F  G S +
Sbjct  492  ERVKRIPFEKGANFRDLEGVRVGPNNVAEFDPEIPRVYLESGNPLVPEYAIKFRSGKSLR  551

Query  483  PFRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYI  304
            PF RLWWDETVPTVVT A PH+Q ILHP Q RVLT+RENARLQGFPDYY+L GPIKER +
Sbjct  552  PFGRLWWDETVPTVVTSANPHSQRILHPSQARVLTVRENARLQGFPDYYRLDGPIKERQV  611



>ref|XP_010243148.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Nelumbo 
nucifera]
Length=1126

 Score =   212 bits (539),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 128/181 (71%), Gaps = 11/181 (6%)
 Frame = -1

Query  807   VENNEKRDDMEYVDKPGSEFQQFIRLGRDGLPGI----------VLHDHRPLQLNDDDYQ  658
             V N+E R++M Y   P +EFQ++IR     + G           VL+DHRPL LN+DDY 
Sbjct  926   VTNDETREEMSYRKPPETEFQKYIRSTICEMMGSMCNGERQTKSVLYDHRPLPLNEDDYA  985

Query  657   RVCHIPKAKGANFRDLPGVRV-VDNKVHWDPNVERVYLSSGKPLVPDYAMSFVGGTSSKP  481
             RVC IP+ KGANFRDLPG+ V  DN V  DP++ER+ L SGKPLVPDYA+ +  G S +P
Sbjct  986   RVCQIPQRKGANFRDLPGLIVGADNVVQLDPSMERILLPSGKPLVPDYALRYAQGKSVRP  1045

Query  480   FRRLWWDETVPTVVTRAEPHNQAILHPLQDRVLTIRENARLQGFPDYYKLCGPIKERYIQ  301
             F RLWWDETVPTV+T  +P  QA LHP QDRVLTIRE ARLQGFPDYY+  G IK+RYI 
Sbjct  1046  FARLWWDETVPTVLTTIDPRFQATLHPEQDRVLTIRECARLQGFPDYYRFYGTIKQRYIV  1105

Query  300   V  298
             V
Sbjct  1106  V  1106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410