BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044I03

Length=695
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04139.1|  unnamed protein product                                353   8e-117   Coffea canephora [robusta coffee]
ref|XP_009788611.1|  PREDICTED: acetolactate synthase small subun...    345   2e-116   Nicotiana sylvestris
gb|EYU39756.1|  hypothetical protein MIMGU_mgv1a005187mg                347   7e-114   Erythranthe guttata [common monkey flower]
ref|XP_011084704.1|  PREDICTED: acetolactate synthase small subun...    345   3e-113   Sesamum indicum [beniseed]
ref|XP_011084705.1|  PREDICTED: acetolactate synthase small subun...    344   7e-113   Sesamum indicum [beniseed]
ref|XP_006353245.1|  PREDICTED: acetolactate synthase small subun...    344   9e-113   Solanum tuberosum [potatoes]
ref|XP_004250085.1|  PREDICTED: acetolactate synthase small subun...    342   5e-112   Solanum lycopersicum
ref|XP_007028126.1|  ACT domain-containing small subunit of aceto...    341   1e-111   
ref|XP_009351614.1|  PREDICTED: acetolactate synthase small subun...    340   3e-111   Pyrus x bretschneideri [bai li]
ref|XP_010242460.1|  PREDICTED: acetolactate synthase small subun...    337   3e-110   Nelumbo nucifera [Indian lotus]
ref|XP_008371723.1|  PREDICTED: acetolactate synthase small subun...    337   3e-110   
ref|XP_006468633.1|  PREDICTED: acetolactate synthase small subun...    336   8e-110   Citrus sinensis [apfelsine]
ref|XP_008225227.1|  PREDICTED: acetolactate synthase small subun...    336   9e-110   Prunus mume [ume]
ref|XP_007212091.1|  hypothetical protein PRUPE_ppa005063mg             336   1e-109   
gb|KJB78879.1|  hypothetical protein B456_013G024000                    327   2e-109   Gossypium raimondii
ref|XP_002311270.2|  hypothetical protein POPTR_0008s07820g             335   4e-109   
ref|XP_006448525.1|  hypothetical protein CICLE_v10015040mg             334   4e-109   Citrus clementina [clementine]
ref|XP_006664907.1|  PREDICTED: acetolactate synthase small subun...    330   2e-108   Oryza brachyantha
ref|XP_011014712.1|  PREDICTED: acetolactate synthase small subun...    332   2e-108   Populus euphratica
ref|XP_011014695.1|  PREDICTED: acetolactate synthase small subun...    332   5e-108   Populus euphratica
ref|XP_008383599.1|  PREDICTED: acetolactate synthase small subun...    331   7e-108   
gb|KCW59209.1|  hypothetical protein EUGRSUZ_H01869                     328   7e-108   Eucalyptus grandis [rose gum]
ref|XP_002514772.1|  acetolactate synthase, putative                    333   7e-108   
ref|XP_011010159.1|  PREDICTED: acetolactate synthase small subun...    331   9e-108   Populus euphratica
gb|KHG18039.1|  Acetolactate synthase small subunit                     332   9e-108   Gossypium arboreum [tree cotton]
gb|KJB27747.1|  hypothetical protein B456_005G007600                    330   1e-107   Gossypium raimondii
gb|KGN66639.1|  hypothetical protein Csa_1G652220                       321   1e-107   Cucumis sativus [cucumbers]
ref|XP_011460628.1|  PREDICTED: acetolactate synthase small subun...    330   2e-107   Fragaria vesca subsp. vesca
ref|XP_009352938.1|  PREDICTED: acetolactate synthase small subun...    330   2e-107   Pyrus x bretschneideri [bai li]
gb|EYU17620.1|  hypothetical protein MIMGU_mgv1a005378mg                330   2e-107   Erythranthe guttata [common monkey flower]
gb|KJB78878.1|  hypothetical protein B456_013G024000                    330   2e-107   Gossypium raimondii
ref|XP_004251994.1|  PREDICTED: acetolactate synthase small subun...    330   2e-107   Solanum lycopersicum
emb|CAN61470.1|  hypothetical protein VITISV_043824                     328   3e-107   Vitis vinifera
gb|KCW46077.1|  hypothetical protein EUGRSUZ_L00052                     326   5e-107   Eucalyptus grandis [rose gum]
ref|XP_006353111.1|  PREDICTED: acetolactate synthase small subun...    328   6e-107   Solanum tuberosum [potatoes]
ref|XP_008800993.1|  PREDICTED: acetolactate synthase small subun...    328   9e-107   Phoenix dactylifera
ref|XP_002279286.1|  PREDICTED: acetolactate synthase small subun...    328   1e-106   Vitis vinifera
ref|XP_010650733.1|  PREDICTED: acetolactate synthase small subun...    328   1e-106   Vitis vinifera
ref|XP_006470698.1|  PREDICTED: acetolactate synthase small subun...    328   1e-106   Citrus sinensis [apfelsine]
ref|XP_006446199.1|  hypothetical protein CICLE_v10015044mg             328   1e-106   Citrus clementina [clementine]
ref|XP_010070426.1|  PREDICTED: acetolactate synthase small subun...    328   2e-106   Eucalyptus grandis [rose gum]
ref|XP_008800984.1|  PREDICTED: acetolactate synthase small subun...    328   2e-106   
ref|XP_009404280.1|  PREDICTED: acetolactate synthase small subun...    327   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW59207.1|  hypothetical protein EUGRSUZ_H01869                     328   2e-106   Eucalyptus grandis [rose gum]
ref|XP_006446198.1|  hypothetical protein CICLE_v10015044mg             327   2e-106   
dbj|BAD19594.1|  putative acetolactate synthase small subunit           322   2e-106   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047389.2|  Os02g0608600                                       322   2e-106   
ref|XP_008349232.1|  PREDICTED: acetolactate synthase small subun...    325   3e-106   
ref|XP_010039380.1|  PREDICTED: acetolactate synthase small subun...    325   3e-106   
ref|XP_002266924.2|  PREDICTED: acetolactate synthase small subun...    327   4e-106   Vitis vinifera
ref|XP_011005277.1|  PREDICTED: acetolactate synthase small subun...    327   4e-106   Populus euphratica
ref|XP_002310395.2|  hypothetical protein POPTR_0007s00700g             327   4e-106   
ref|XP_003524233.1|  PREDICTED: acetolactate synthase small subun...    326   5e-106   Glycine max [soybeans]
ref|XP_009404279.1|  PREDICTED: acetolactate synthase small subun...    327   5e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO50434.1|  hypothetical protein CISIN_1g047033mg                   327   5e-106   Citrus sinensis [apfelsine]
ref|XP_002316167.1|  hypothetical protein POPTR_0010s18560g             324   6e-106   
ref|XP_002529819.1|  acetolactate synthase, putative                    327   7e-106   Ricinus communis
ref|XP_010557052.1|  PREDICTED: acetolactate synthase small subun...    323   1e-105   Tarenaya hassleriana [spider flower]
ref|XP_008243055.1|  PREDICTED: acetolactate synthase small subun...    326   1e-105   Prunus mume [ume]
ref|XP_007033634.1|  ACT domain-containing small subunit of aceto...    325   1e-105   
ref|XP_007201965.1|  hypothetical protein PRUPE_ppa004716mg             326   1e-105   Prunus persica
ref|XP_008243054.1|  PREDICTED: acetolactate synthase small subun...    326   1e-105   Prunus mume [ume]
ref|XP_011047624.1|  PREDICTED: acetolactate synthase small subun...    327   1e-105   Populus euphratica
ref|XP_004139096.1|  PREDICTED: uncharacterized protein LOC101208212    325   2e-105   Cucumis sativus [cucumbers]
ref|XP_009406425.1|  PREDICTED: acetolactate synthase small subun...    325   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009782832.1|  PREDICTED: acetolactate synthase small subun...    325   2e-105   Nicotiana sylvestris
ref|XP_009366239.1|  PREDICTED: acetolactate synthase small subun...    325   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_010557051.1|  PREDICTED: acetolactate synthase small subun...    325   3e-105   Tarenaya hassleriana [spider flower]
gb|EPS72034.1|  hypothetical protein M569_02723                         322   3e-105   Genlisea aurea
gb|KDP35124.1|  hypothetical protein JCGZ_10658                         324   3e-105   Jatropha curcas
ref|XP_010109954.1|  hypothetical protein L484_011796                   325   5e-105   Morus notabilis
ref|XP_008383971.1|  PREDICTED: acetolactate synthase small subun...    323   7e-105   
ref|XP_008354318.1|  PREDICTED: acetolactate synthase small subun...    323   9e-105   
gb|EYU36664.1|  hypothetical protein MIMGU_mgv1a005401mg                322   2e-104   Erythranthe guttata [common monkey flower]
gb|KHN48087.1|  Acetolactate synthase small subunit                     321   3e-104   Glycine soja [wild soybean]
ref|XP_008443657.1|  PREDICTED: acetolactate synthase small subun...    322   4e-104   Cucumis melo [Oriental melon]
ref|XP_003532793.1|  PREDICTED: acetolactate synthase small subun...    321   5e-104   Glycine max [soybeans]
emb|CDY15367.1|  BnaC04g42560D                                          321   6e-104   Brassica napus [oilseed rape]
ref|XP_010673855.1|  PREDICTED: acetolactate synthase small subun...    321   6e-104   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK41430.1|  unknown                                                 321   7e-104   Lotus japonicus
gb|EEC73569.1|  hypothetical protein OsI_08011                          323   8e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_004504413.1|  PREDICTED: acetolactate synthase small subun...    318   9e-104   
ref|XP_011085048.1|  PREDICTED: acetolactate synthase small subun...    320   1e-103   Sesamum indicum [beniseed]
ref|XP_007159564.1|  hypothetical protein PHAVU_002G248000g             320   1e-103   Phaseolus vulgaris [French bean]
ref|XP_009132818.1|  PREDICTED: acetolactate synthase small subun...    320   1e-103   Brassica rapa
ref|XP_009141188.1|  PREDICTED: acetolactate synthase small subun...    320   2e-103   Brassica rapa
ref|XP_008394266.1|  PREDICTED: acetolactate synthase small subun...    320   2e-103   
ref|XP_004159602.1|  PREDICTED: uncharacterized LOC101212902            317   2e-103   
ref|XP_008367825.1|  PREDICTED: acetolactate synthase small subun...    320   3e-103   
ref|XP_004490063.1|  PREDICTED: acetolactate synthase small subun...    319   3e-103   Cicer arietinum [garbanzo]
emb|CAX48742.1|  acetohydroxyacid synthase regulatory subunit 1 p...    319   4e-103   Eupatorium cannabinum [hemp agrimony]
ref|XP_003629945.1|  Acetolactate synthase small subunit                318   9e-103   Medicago truncatula
ref|XP_006410309.1|  hypothetical protein EUTSA_v10016569mg             317   2e-102   Eutrema salsugineum [saltwater cress]
gb|KGN49589.1|  hypothetical protein Csa_5G013280                       315   2e-102   Cucumis sativus [cucumbers]
ref|XP_006858758.1|  hypothetical protein AMTR_s00066p00141740          317   2e-102   Amborella trichopoda
ref|XP_004149627.1|  PREDICTED: uncharacterized protein LOC101212902    317   3e-102   Cucumis sativus [cucumbers]
ref|XP_008450270.1|  PREDICTED: acetolactate synthase small subun...    315   4e-102   Cucumis melo [Oriental melon]
emb|CDP08089.1|  unnamed protein product                                317   5e-102   Coffea canephora [robusta coffee]
gb|KFK31180.1|  hypothetical protein AALP_AA6G079200                    316   7e-102   Arabis alpina [alpine rockcress]
ref|XP_010414082.1|  PREDICTED: acetolactate synthase small subun...    316   8e-102   Camelina sativa [gold-of-pleasure]
emb|CDY19107.1|  BnaA04g18470D                                          316   8e-102   Brassica napus [oilseed rape]
ref|NP_001151166.1|  acetolactate synthase/ amino acid binding pr...    315   9e-102   Zea mays [maize]
ref|XP_008450269.1|  PREDICTED: acetolactate synthase small subun...    315   1e-101   Cucumis melo [Oriental melon]
ref|NP_850172.1|  ACT domain-containing small subunit of acetolac...    315   1e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31179.1|  hypothetical protein AALP_AA6G079200                    316   2e-101   Arabis alpina [alpine rockcress]
ref|NP_001168069.1|  uncharacterized protein LOC100381801               310   2e-101   Zea mays [maize]
ref|XP_004953051.1|  PREDICTED: acetolactate synthase small subun...    314   3e-101   Setaria italica
ref|XP_002879344.1|  hypothetical protein ARALYDRAFT_482103             313   8e-101   
ref|XP_010672487.1|  PREDICTED: acetolactate synthase small subun...    313   8e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002452423.1|  hypothetical protein SORBIDRAFT_04g025560          313   1e-100   Sorghum bicolor [broomcorn]
ref|XP_004288733.1|  PREDICTED: acetolactate synthase small subun...    313   1e-100   Fragaria vesca subsp. vesca
ref|XP_010469676.1|  PREDICTED: acetolactate synthase small subun...    313   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010469674.1|  PREDICTED: acetolactate synthase small subun...    313   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010414083.1|  PREDICTED: acetolactate synthase small subun...    310   2e-100   
ref|XP_010510152.1|  PREDICTED: acetolactate synthase small subun...    312   2e-100   Camelina sativa [gold-of-pleasure]
ref|NP_850173.2|  ACT domain-containing small subunit of acetolac...    308   9e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663345.1|  PREDICTED: acetolactate synthase small subun...    308   1e-99    
gb|AAX96859.1|  acetolactate synthase, small subunit, putative          309   3e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004504201.1|  PREDICTED: acetolactate synthase small subun...    308   4e-99    Cicer arietinum [garbanzo]
gb|EEE57346.1|  hypothetical protein OsJ_07472                          307   4e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008643958.1|  PREDICTED: uncharacterized protein LOC100381...    309   4e-99    Zea mays [maize]
ref|XP_003572704.1|  PREDICTED: acetolactate synthase small subun...    308   8e-99    Brachypodium distachyon [annual false brome]
dbj|BAJ92239.1|  predicted protein                                      307   1e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006294093.1|  hypothetical protein CARUB_v10023086mg             307   2e-98    Capsella rubella
ref|XP_010524340.1|  PREDICTED: acetolactate synthase small subun...    307   2e-98    Tarenaya hassleriana [spider flower]
ref|XP_007028127.1|  Valine-tolerant 1 isoform 2                        304   2e-98    
ref|XP_006286863.1|  hypothetical protein CARUB_v10003921mg             298   3e-98    
ref|XP_009126106.1|  PREDICTED: acetolactate synthase small subun...    305   8e-98    Brassica rapa
gb|KHG22544.1|  Acetolactate synthase small subunit                     305   8e-98    Gossypium arboreum [tree cotton]
emb|CDX85509.1|  BnaA02g03040D                                          305   8e-98    
gb|EEC67965.1|  hypothetical protein OsI_35716                          305   9e-98    Oryza sativa Indica Group [Indian rice]
ref|XP_010558579.1|  PREDICTED: acetolactate synthase small subun...    303   9e-98    Tarenaya hassleriana [spider flower]
emb|CDY38123.1|  BnaC02g06500D                                          305   1e-97    Brassica napus [oilseed rape]
ref|XP_003576101.1|  PREDICTED: acetolactate synthase small subun...    304   3e-97    Brachypodium distachyon [annual false brome]
ref|NP_197133.1|  acetolactate synthase small subunit 1                 303   4e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19535.1|  AT5G16290                                              303   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625350.1|  PREDICTED: acetolactate synthase small subun...    303   5e-97    Nicotiana tomentosiformis
ref|XP_006400166.1|  hypothetical protein EUTSA_v10016107mg             303   8e-97    Eutrema salsugineum [saltwater cress]
ref|XP_002871713.1|  hypothetical protein ARALYDRAFT_488480             302   1e-96    
gb|KJB27748.1|  hypothetical protein B456_005G007600                    298   1e-96    Gossypium raimondii
ref|XP_006286862.1|  hypothetical protein CARUB_v10003921mg             301   2e-96    Capsella rubella
gb|EMT17230.1|  Acetolactate synthase small subunit                     298   3e-95    
ref|XP_008667813.1|  PREDICTED: uncharacterized protein LOC100279...    296   4e-95    Zea mays [maize]
ref|XP_008344057.1|  PREDICTED: acetolactate synthase small subun...    289   2e-94    
tpg|DAA41907.1|  TPA: hypothetical protein ZEAMMB73_831035              296   3e-94    
ref|NP_001146158.1|  uncharacterized protein LOC100279727               296   4e-94    Zea mays [maize]
ref|XP_010420316.1|  PREDICTED: acetolactate synthase small subun...    296   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009782836.1|  PREDICTED: acetolactate synthase small subun...    294   1e-93    Nicotiana sylvestris
ref|XP_010453787.1|  PREDICTED: acetolactate synthase small subun...    294   1e-93    Camelina sativa [gold-of-pleasure]
dbj|BAM75181.1|  B3-type transcription factor                           301   2e-93    Ricinus communis
ref|XP_010492512.1|  PREDICTED: acetolactate synthase small subun...    293   3e-93    Camelina sativa [gold-of-pleasure]
sp|Q9SMC2.1|ILVH_NICPL  RecName: Full=Acetolactate synthase small...    289   6e-92    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002449227.1|  hypothetical protein SORBIDRAFT_05g006620          290   6e-92    Sorghum bicolor [broomcorn]
emb|CDX79442.1|  BnaC03g17780D                                          290   6e-92    
ref|XP_004169905.1|  PREDICTED: acetolactate synthase small subun...    279   1e-91    
emb|CDY34514.1|  BnaC04g12850D                                          289   1e-91    Brassica napus [oilseed rape]
gb|AAD32291.1|  putative acetolactate synthase                          289   2e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDX84757.1|  BnaA03g14730D                                          288   2e-91    
emb|CDY42070.1|  BnaA05g11160D                                          288   3e-91    Brassica napus [oilseed rape]
ref|XP_006448524.1|  hypothetical protein CICLE_v10015040mg             288   4e-91    Citrus clementina [clementine]
gb|KCW46078.1|  hypothetical protein EUGRSUZ_L00052                     284   8e-91    Eucalyptus grandis [rose gum]
ref|XP_006446200.1|  hypothetical protein CICLE_v10015044mg             285   4e-90    
gb|KCW46079.1|  hypothetical protein EUGRSUZ_L00052                     281   1e-89    Eucalyptus grandis [rose gum]
ref|XP_009144046.1|  PREDICTED: acetolactate synthase small subun...    280   4e-89    
ref|XP_009144045.1|  PREDICTED: acetolactate synthase small subun...    280   3e-88    Brassica rapa
ref|XP_004490062.1|  PREDICTED: acetolactate synthase small subun...    278   2e-86    
ref|XP_009625351.1|  PREDICTED: acetolactate synthase small subun...    272   2e-85    Nicotiana tomentosiformis
gb|EMT12300.1|  Acetolactate synthase small subunit                     270   8e-85    
gb|EMS53688.1|  Acetolactate synthase small subunit                     268   1e-84    Triticum urartu
ref|XP_001773408.1|  predicted protein                                  266   4e-83    
ref|NP_850174.1|  ACT domain-containing small subunit of acetolac...    265   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002979412.1|  hypothetical protein SELMODRAFT_111081             257   5e-80    
ref|XP_002977907.1|  hypothetical protein SELMODRAFT_107328             252   6e-78    
ref|XP_010910806.1|  PREDICTED: acetolactate synthase small subun...    246   4e-77    
ref|XP_011014719.1|  PREDICTED: acetolactate synthase small subun...    248   6e-76    Populus euphratica
ref|XP_009144047.1|  PREDICTED: acetolactate synthase small subun...    246   3e-75    Brassica rapa
ref|XP_010101349.1|  Acetolactate synthase small subunit                242   4e-74    
ref|XP_008677344.1|  PREDICTED: acetolactate synthase/ amino acid...    236   2e-71    Zea mays [maize]
gb|EAZ36982.1|  hypothetical protein OsJ_21322                          229   8e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011464846.1|  PREDICTED: LOW QUALITY PROTEIN: acetolactate...    224   6e-68    Fragaria vesca subsp. vesca
ref|WP_015230978.1|  acetolactate synthase small subunit                189   1e-56    Dactylococcopsis salina
ref|WP_015227737.1|  acetolactate synthase small subunit                189   3e-56    Halothece sp. PCC 7418
ref|WP_012195782.1|  acetolactate synthase                              189   3e-56    Prochlorococcus marinus
sp|Q9MS98.1|ILVH_GALSU  RecName: Full=Acetolactate synthase small...    188   4e-56    Galdieria sulphuraria
ref|WP_006453777.1|  acetolactate synthase                              187   1e-55    Synechococcus sp. PCC 7335
gb|ACB49979.1|  acetolactate synthase small subunit                     187   1e-55    Cyanothece sp. ATCC 51142
ref|WP_006527479.1|  acetolactate synthase, small subunit               186   1e-55    Gloeocapsa sp. PCC 73106
ref|YP_009051154.1|  acetohydroxyacid synthase small subunit            186   2e-55    Galdieria sulphuraria
ref|WP_007304707.1|  acetolactate synthase                              186   3e-55    Crocosphaera watsonii
gb|EAZ92294.1|  acetolactate synthase small subunit                     186   4e-55    Cyanothece sp. CCY0110
ref|WP_015219133.1|  acetolactate synthase small subunit                185   4e-55    Cyanobacterium aponinum
ref|WP_009547809.1|  MULTISPECIES: acetolactate synthase                185   9e-55    Cyanothece
ref|WP_011056724.1|  MULTISPECIES: acetolactate synthase                184   1e-54    Thermosynechococcus
ref|WP_035798716.1|  acetolactate synthase                              184   1e-54    Cyanothece sp. CCY0110
ref|WP_017303099.1|  acetolactate synthase                              184   1e-54    Spirulina subsalsa
ref|WP_013322899.1|  acetolactate synthase                              184   2e-54    Cyanothece sp. PCC 7822
ref|WP_026732404.1|  acetolactate synthase                              183   3e-54    Fischerella sp. PCC 9605
ref|WP_015195236.1|  acetolactate synthase, small subunit               183   4e-54    Stanieria cyanosphaera
ref|WP_012598844.1|  acetolactate synthase                              183   5e-54    Cyanothece sp. PCC 7424
ref|WP_002743360.1|  MULTISPECIES: acetolactate synthase                183   5e-54    Microcystis
ref|WP_002732118.1|  acetolactate synthase                              182   5e-54    Microcystis
emb|CCI18700.1|  Acetolactate synthase small subunit                    183   7e-54    Microcystis aeruginosa PCC 9807
dbj|BAA22822.1|  acetolactate synthase                                  182   7e-54    Cyanidioschyzon merolae
ref|WP_017322778.1|  acetolactate synthase                              182   7e-54    cyanobacterium PCC 7702
dbj|GAL94295.1|  acetolactate synthase small subunit                    182   7e-54    Microcystis aeruginosa NIES-44
ref|WP_024971071.1|  acetolactate synthase                              182   8e-54    Microcystis aeruginosa
ref|WP_043999720.1|  acetolactate synthase                              182   1e-53    Microcystis aeruginosa
ref|WP_039716657.1|  acetolactate synthase                              182   1e-53    
ref|NP_848948.1|  aceohydroxyacid synthase small subunit                182   1e-53    Cyanidioschyzon merolae strain 10D
ref|WP_017319158.1|  acetolactate synthase                              181   1e-53    Mastigocladopsis repens
emb|CCI14937.1|  Acetolactate synthase small subunit                    182   2e-53    Microcystis aeruginosa PCC 9806
ref|WP_015154365.1|  acetolactate synthase small subunit                181   2e-53    Cyanobacteria [blue-green bacteria]
ref|WP_036902537.1|  acetolactate synthase                              181   3e-53    Prochlorococcus sp. MIT 0601
gb|AFZ05551.1|  acetolactate synthase, small subunit                    181   3e-53    Oscillatoria nigro-viridis PCC 7112
ref|WP_012626204.1|  acetolactate synthase                              181   3e-53    Cyanothece sp. PCC 7425
ref|WP_008314262.1|  acetolactate synthase, small subunit               181   3e-53    Leptolyngbya sp. PCC 6406
gb|EGK83985.1|  acetolactate synthase, small subunit                    181   4e-53    Microcoleus vaginatus FGP-2
ref|WP_006910483.1|  acetolactate synthase                              181   4e-53    Cyanobium sp. PCC 7001
ref|WP_016875905.1|  acetolactate synthase                              180   4e-53    Chlorogloeopsis fritschii
ref|WP_041622928.1|  acetolactate synthase                              180   5e-53    Oscillatoria nigro-viridis
gb|AIA61091.1|  acetohydroxyacid synthase small subunit (chloropl...    180   5e-53    Cyanidiaceae sp. MX-AZ01
ref|WP_039887977.1|  acetolactate synthase                              180   6e-53    Microcoleus vaginatus
dbj|BAA22831.1|  acetolactate synthase                                  180   6e-53    Cyanidium caldarium
ref|WP_015171191.1|  acetolactate synthase small subunit                180   6e-53    Geitlerinema sp. PCC 7407
ref|WP_014407139.1|  acetolactate synthase                              180   6e-53    Synechocystis
ref|WP_016870148.1|  acetolactate synthase                              180   6e-53    Fischerella muscicola
ref|WP_011818754.1|  MULTISPECIES: acetolactate synthase                180   7e-53    Prochlorococcus
ref|WP_009767679.1|  acetolactate synthase, small subunit               180   8e-53    Oscillatoriales cyanobacterium JSC-12
ref|WP_015145546.1|  acetolactate synthase small subunit                179   8e-53    Pleurocapsales
ref|WP_006508477.1|  acetolactate synthase, small subunit               179   8e-53    Xenococcus sp. PCC 7305
ref|WP_032518375.1|  acetolactate synthase                              179   9e-53    Prochlorococcus marinus
ref|WP_009756687.1|  MULTISPECIES: acetolactate synthase                179   1e-52    Fischerella
ref|YP_008144692.1|  acetolactate synthase small subunit                179   1e-52    Grateloupia taiwanensis
ref|WP_038653708.1|  acetolactate synthase                              179   1e-52    Prochlorococcus sp. MIT 0801
ref|WP_025930661.1|  acetolactate synthase                              179   1e-52    
dbj|BAM54375.1|  acetolactate synthase 3 regulatory subunit             179   1e-52    Bacillus subtilis BEST7613
ref|WP_036918354.1|  MULTISPECIES: acetolactate synthase                179   1e-52    Prochlorococcus
ref|WP_017651464.1|  acetolactate synthase                              179   2e-52    Fortiea contorta
ref|WP_023076484.1|  acetolactate small subunit                         179   2e-52    Leptolyngbya sp. Heron Island J
ref|WP_011294852.1|  acetolactate synthase                              179   2e-52    Prochlorococcus marinus
ref|WP_012008031.1|  MULTISPECIES: acetolactate synthase                179   2e-52    Prochlorococcus marinus
ref|WP_008188861.1|  acetolactate synthase                              178   2e-52    Moorea producens
ref|WP_015189621.1|  acetolactate synthase, small subunit               178   2e-52    Gloeocapsa sp. PCC 7428
ref|WP_040935206.1|  acetolactate synthase                              178   2e-52    
ref|XP_011400735.1|  Acetolactate synthase small subunit                187   3e-52    Auxenochlorella protothecoides
ref|WP_009342538.1|  acetolactate synthase                              178   3e-52    Aphanizomenonaceae
ref|WP_018397129.1|  acetolactate synthase                              178   3e-52    filamentous cyanobacterium ESFC-1
ref|WP_025961335.1|  acetolactate synthase                              178   4e-52    
ref|WP_025939160.1|  acetolactate synthase                              178   4e-52    
ref|WP_040931574.1|  acetolactate synthase                              178   4e-52    
ref|YP_007878297.1|  acetolactate synthase small subunit                178   4e-52    Calliarthron tuberculosum
ref|WP_015116444.1|  acetolactate synthase small subunit                178   4e-52    Rivularia sp. PCC 7116
ref|WP_010477416.1|  MULTISPECIES: acetolactate synthase                177   5e-52    Acaryochloris
ref|YP_007627456.1|  acetolactate synthase small subunit                178   5e-52    Chondrus crispus [carageen]
ref|WP_017715305.1|  acetolactate synthase                              177   5e-52    Oscillatoria sp. PCC 10802
ref|WP_028946400.1|  acetolactate synthase                              177   5e-52    Synechocystis sp. PCC 6714
ref|WP_011125403.1|  MULTISPECIES: acetolactate synthase                177   5e-52    Prochlorococcus
ref|WP_010873502.1|  acetolactate synthase                              178   5e-52    
ref|WP_017286074.1|  acetolactate synthase                              177   5e-52    Leptolyngbya boryana
ref|WP_016859689.1|  acetolactate synthase                              177   5e-52    Fischerella muscicola
ref|WP_017660939.1|  acetolactate synthase                              177   6e-52    Geitlerinema sp. PCC 7105
ref|WP_017294692.1|  acetolactate synthase                              177   6e-52    Geminocystis herdmanii
ref|WP_012595734.1|  MULTISPECIES: acetolactate synthase                177   6e-52    Cyanothece
ref|WP_012408560.1|  acetolactate synthase                              177   7e-52    Nostoc punctiforme
ref|WP_035996987.1|  acetolactate synthase                              177   8e-52    [Leptolyngbya] sp. JSC-1
ref|WP_007100311.1|  acetolactate synthase                              177   9e-52    Synechococcus sp. RS9917
ref|WP_015083282.1|  acetolactate synthase small subunit                177   1e-51    Anabaena sp. 90
ref|WP_036020223.1|  acetolactate synthase                              177   1e-51    Leptolyngbya sp. PCC 7375
ref|WP_011132788.1|  acetolactate synthase                              177   1e-51    Prochlorococcus marinus
ref|WP_039747340.1|  acetolactate synthase                              177   1e-51    
ref|WP_035154634.1|  acetolactate synthase                              177   1e-51    Calothrix sp. 336/3
ref|XP_005851575.1|  hypothetical protein CHLNCDRAFT_29593              183   1e-51    Chlorella variabilis
ref|WP_009631788.1|  acetolactate synthase, small subunit               176   1e-51    Synechocystis sp. PCC 7509
ref|WP_011376800.1|  acetolactate synthase                              176   2e-51    Prochlorococcus marinus
ref|WP_041040884.1|  acetolactate synthase                              176   2e-51    Tolypothrix campylonemoides
ref|WP_017313402.1|  MULTISPECIES: acetolactate synthase                176   2e-51    Hapalosiphonaceae
ref|WP_006277889.1|  acetolactate synthase                              176   2e-51    Cylindrospermopsis
ref|WP_026100701.1|  acetolactate synthase                              176   2e-51    Synechococcus sp. PCC 7336
ref|WP_015125829.1|  acetolactate synthase small subunit                176   2e-51    Synechococcus sp. PCC 6312
ref|YP_063674.1|  acetohydroxyacid synthase small subunit               176   2e-51    
ref|WP_036532119.1|  acetolactate synthase                              176   2e-51    
gb|KIJ82940.1|  acetolactate synthase                                   176   2e-51    
ref|WP_019487064.1|  MULTISPECIES: acetolactate synthase                176   2e-51    
ref|WP_028952581.1|  acetolactate synthase                              176   2e-51    
ref|XP_005648800.1|  acetolactate synthase                              188   2e-51    
ref|WP_038545989.1|  acetolactate synthase                              176   2e-51    
gb|AJO68499.1|  acetohydroxyacid synthase small subunit                 176   2e-51    
ref|WP_017740695.1|  acetolactate synthase                              176   2e-51    
ref|WP_026786440.1|  MULTISPECIES: acetolactate synthase                176   3e-51    
ref|WP_029632809.1|  acetolactate synthase [                            176   3e-51    
ref|WP_015209539.1|  acetolactate synthase, small subunit               176   3e-51    
ref|WP_028084672.1|  acetolactate synthase                              176   3e-51    
ref|WP_015180717.1|  acetolactate synthase small subunit                176   3e-51    
ref|WP_039728011.1|  MULTISPECIES: acetolactate synthase                176   3e-51    
ref|WP_015158120.1|  acetolactate synthase, small subunit               175   4e-51    
gb|EKV00810.1|  acetolactate synthase, small subunit                    176   4e-51    
ref|WP_019492237.1|  acetolactate synthase                              175   4e-51    
gb|KIE11579.1|  acetolactate synthase                                   175   4e-51    
ref|NP_045137.1|  acetohydroxyacid synthase small subunit               175   5e-51    
ref|WP_015196808.1|  acetolactate synthase small subunit                175   5e-51    
ref|WP_006103562.1|  acetolactate synthase                              175   6e-51    
emb|CBN54307.1|  acetolactate synthase 3 regulatory subunit [ [         176   6e-51    
ref|WP_015205120.1|  acetolactate synthase small subunit                175   7e-51    
ref|WP_006196435.1|  acetolactate synthase                              174   7e-51    
ref|WP_024545091.1|  acetolactate synthase                              174   7e-51    
ref|WP_012308298.1|  acetolactate synthase                              174   8e-51    
ref|WP_013190466.1|  acetolactate synthase                              174   9e-51    
ref|WP_015126609.1|  acetolactate synthase small subunit                174   9e-51    
ref|WP_015223783.1|  acetolactate synthase small subunit                174   1e-50    
ref|YP_003359223.1|  acetohydroxyacid synthase small subunit            174   1e-50    
ref|WP_010302742.1|  acetolactate synthase                              174   1e-50    
gb|KDO77101.1|  hypothetical protein CISIN_1g0114912mg                  171   1e-50    
ref|WP_030007373.1|  acetolactate synthase                              174   1e-50    
ref|WP_015146637.1|  acetolactate synthase small subunit                174   1e-50    
ref|WP_011820626.1|  acetolactate synthase                              174   1e-50    
ref|WP_036920271.1|  acetolactate synthase                              174   1e-50    
ref|WP_011611481.1|  acetolactate synthase                              174   1e-50    
ref|WP_025979293.1|  acetolactate synthase                              174   2e-50    
ref|WP_027843130.1|  acetolactate synthase                              174   2e-50    
ref|WP_035993822.1|  acetolactate synthase                              174   2e-50    
ref|WP_026073042.1|  acetolactate synthase                              173   2e-50    
gb|AJH65993.1|  acetolactate synthase small subunit                     174   2e-50    
ref|WP_011364939.1|  acetolactate synthase                              173   2e-50    
ref|WP_036481766.1|  acetolactate synthase                              173   2e-50    
ref|WP_009787902.1|  acetolactate synthase                              173   3e-50    
ref|WP_038553682.1|  acetolactate synthase                              173   3e-50    
gb|AIA21465.1|  acetolactate synthase small subunit                     173   3e-50    
ref|WP_027403392.1|  acetolactate synthase                              173   3e-50    
ref|WP_019474688.1|  acetolactate synthase                              173   3e-50    
ref|XP_002509130.1|  predicted protein                                  179   3e-50    
ref|WP_035832248.1|  acetolactate synthase                              173   3e-50    
ref|YP_001293521.1|  acetohydroxyacid synthetase small subunit          172   3e-50    
ref|WP_015213275.1|  acetolactate synthase, small subunit               173   4e-50    
ref|WP_007098346.1|  acetolactate synthase                              173   4e-50    
ref|YP_009019682.1|  acetolactate synthase small subunit                173   4e-50    
ref|YP_003002120.1|  acetolactate synthase small subunit                172   4e-50    
ref|YP_009027514.1|  acetolactate synthase small subunit                172   4e-50    
ref|WP_006171772.1|  acetolactate synthase                              173   4e-50    
ref|YP_008965793.1|  acetolactate synthase small subunit                172   4e-50    
ref|XP_001420250.1|  predicted protein                                  181   4e-50    
ref|NP_053840.1|  acetohydroxyacid synthase small subunit               172   5e-50    
ref|WP_006852196.1|  acetolactate synthase                              172   5e-50    
ref|WP_015108799.1|  acetolactate synthase small subunit                172   6e-50    
ref|YP_536911.1|  acetohydroxyacid synthase small subunit               172   6e-50    
ref|YP_007947759.1|  acetohydroxyacid synthase small subunit            172   7e-50    
ref|WP_036896778.1|  acetolactate synthase                              172   7e-50    
ref|WP_011130547.1|  acetolactate synthase                              172   7e-50    
ref|WP_044106118.1|  acetolactate synthase                              172   8e-50    
ref|WP_036914369.1|  MULTISPECIES: acetolactate synthase                172   9e-50    
dbj|BAI88928.1|  acetolactate synthase III small subunit                172   9e-50    
ref|WP_044500522.1|  acetolactate synthase                              172   9e-50    
ref|WP_006618438.1|  acetolactate synthase                              172   9e-50    
ref|WP_026099569.1|  acetolactate synthase                              172   1e-49    
ref|WP_015167340.1|  acetolactate synthase small subunit                171   1e-49    
ref|YP_003002269.1|  acetolactate synthase small subunit                171   1e-49    
ref|WP_011618839.1|  acetolactate synthase                              172   1e-49    
ref|XP_005705049.1|  [pt] acetolactate synthase I/III small subunit     171   1e-49    
ref|WP_011430944.1|  acetolactate synthase                              171   1e-49    
ref|WP_023066701.1|  acetolactate synthase, small subunit               171   1e-49    
gb|AHF64430.1|  acetolactate synthase, small subunit                    171   1e-49    
ref|WP_011432604.1|  acetolactate synthase                              171   1e-49    
gb|AIA21259.1|  acetolactate synthase small subunit                     171   1e-49    
ref|WP_015164258.1|  acetolactate synthase small subunit                171   2e-49    
ref|NP_050708.1|  acetohydroxyacid synthase small subunit               171   2e-49    
ref|WP_011933543.1|  acetolactate synthase                              171   2e-49    
ref|WP_041456726.1|  MULTISPECIES: acetolactate synthase                171   2e-49    
dbj|BAB76326.1|  acetolactate synthase                                  171   3e-49    
gb|AFY41657.1|  acetolactate synthase, small subunit                    171   3e-49    
ref|WP_016950575.1|  acetolactate synthase                              170   3e-49    
gb|AFR24747.1|  acetolactate synthase small subunit                     170   4e-49    
ref|WP_006625441.1|  MULTISPECIES: acetolactate synthase                170   4e-49    
ref|WP_011936109.1|  acetolactate synthase                              170   4e-49    
gb|AFC39900.1|  acetohydroxyacid synthase small subunit                 170   4e-49    
gb|AFY38678.1|  acetolactate synthase, small subunit                    170   4e-49    
ref|WP_009790304.1|  acetolactate synthase                              170   4e-49    
ref|WP_019508465.1|  acetolactate synthase                              170   5e-49    
ref|WP_011359483.1|  acetolactate synthase                              170   6e-49    
ref|WP_006041820.1|  acetolactate synthase                              169   7e-49    
ref|XP_003061628.1|  predicted protein                                  179   8e-49    
ref|WP_011825509.1|  acetolactate synthase                              169   8e-49    
ref|WP_011127547.1|  acetolactate synthase                              169   9e-49    
ref|WP_041763544.1|  acetolactate synthase                              169   1e-48    
ref|XP_003081855.1|  Acetolactate synthase, small subunit (ISS)         177   1e-48    
emb|CEF99544.1|  Acetolactate synthase, small subunit, C-terminal       178   1e-48    
ref|WP_043692189.1|  acetolactate synthase                              168   3e-48    
gb|ABB17340.1|  acetolactate synthase                                   167   5e-48    
ref|WP_019502773.1|  acetolactate synthase                              167   5e-48    
gb|AII48755.1|  acetolactate synthase                                   167   7e-48    
ref|WP_040655402.1|  acetolactate synthase                              167   7e-48    
gb|ERN42020.1|  acetolactate synthase, small subunit                    167   7e-48    
ref|WP_015139015.1|  acetolactate synthase small subunit                167   9e-48    
ref|WP_011243982.1|  MULTISPECIES: acetolactate synthase                166   1e-47    
ref|XP_010466593.1|  PREDICTED: acetolactate synthase small subun...    173   1e-47    
ref|XP_001700185.1|  acetolactate synthase, small subunit               174   2e-47    
ref|WP_023175301.1|  acetolactate synthase 3 regulatory subunit         166   2e-47    
ref|WP_011141136.1|  acetolactate synthase                              166   2e-47    
ref|XP_009123667.1|  PREDICTED: acetolactate synthase small subun...    163   3e-47    
ref|WP_010315670.1|  acetolactate synthase                              165   3e-47    
ref|WP_044304865.1|  acetolactate synthase                              164   1e-46    
ref|WP_025968180.1|  acetolactate synthase                              163   1e-46    
emb|CCH67841.1|  Acetolactate synthase small subunit                    164   1e-46    
ref|YP_002327535.1|  acetolactate synthase small subunit                164   2e-46    
ref|WP_040688882.1|  acetolactate synthase                              162   6e-46    
gb|KDD76489.1|  hypothetical protein H632_c209p2                        170   7e-46    
ref|XP_009604733.1|  PREDICTED: acetolactate synthase small subun...    168   7e-46    
ref|XP_002948458.1|  hypothetical protein VOLCADRAFT_73781              169   8e-46    
gb|ELS31853.1|  acetolactate synthase, small subunit                    162   1e-45    
ref|WP_037218077.1|  acetolactate synthase                              160   2e-45    
ref|NP_001067632.2|  Os11g0256000                                       159   2e-45    
ref|YP_002048700.1|  acetolactate synthase III small subunit            160   3e-45    
gb|KDO77103.1|  hypothetical protein CISIN_1g0114911mg                  164   2e-44    
ref|WP_018130638.1|  acetolactate synthase                              157   3e-44    
gb|ABH11012.1|  acetolactate synthase, small subunit                    154   4e-43    
ref|WP_012547617.1|  acetolactate synthase                              151   5e-42    
ref|WP_012583549.1|  acetolactate synthase                              151   7e-42    
gb|KIY94579.1|  hypothetical protein MNEG_13384                         150   7e-42    
ref|WP_011832981.1|  acetolactate synthase                              149   3e-41    
ref|WP_018334921.1|  acetolactate synthase                              149   6e-41    
gb|KDO77100.1|  hypothetical protein CISIN_1g0114912mg                  146   8e-41    
dbj|BAJ91504.1|  predicted protein                                      149   2e-40    
gb|AJH65840.1|  acetolactate synthase small subunit                     147   2e-40    
ref|WP_012874144.1|  acetolactate synthase                              147   2e-40    
ref|WP_013074977.1|  acetolactate synthase                              147   3e-40    
ref|WP_012037024.1|  acetolactate synthase                              147   5e-40    
ref|WP_012901445.1|  acetolactate synthase                              146   5e-40    
ref|WP_013673986.1|  acetolactate synthase                              146   6e-40    
gb|KDE54705.1|  acetolactate synthase                                   146   6e-40    
ref|XP_010911692.1|  PREDICTED: acetolactate synthase small subun...    149   6e-40    
ref|WP_011699818.1|  acetolactate synthase                              146   9e-40    
ref|YP_001936325.1|  acetohydroxyacid synthase small subunit            146   9e-40    
ref|WP_011498832.1|  acetolactate synthase                              145   1e-39    
ref|WP_014404822.1|  acetolactate synthase                              145   1e-39    
ref|XP_008394268.1|  PREDICTED: acetolactate synthase small subun...    152   1e-39    
ref|XP_008394267.1|  PREDICTED: acetolactate synthase small subun...    151   1e-39    
ref|WP_028051312.1|  acetolactate synthase                              145   1e-39    
ref|WP_038290690.1|  acetolactate synthase [                            145   2e-39    
ref|WP_014868187.1|  acetolactate synthase                              145   2e-39    
ref|WP_007314994.1|  acetolactate synthase                              145   2e-39    
ref|WP_011343452.1|  acetolactate synthase                              145   2e-39    
ref|WP_011448263.1|  acetolactate synthase                              144   3e-39    
ref|WP_009304310.1|  MULTISPECIES: acetolactate synthase                144   3e-39    
ref|WP_042164163.1|  acetolactate synthase                              144   3e-39    
ref|WP_013980211.1|  acetolactate synthase                              144   3e-39    
ref|WP_015051056.1|  acetolactate synthase                              144   4e-39    
ref|WP_015842926.1|  acetolactate synthase                              144   4e-39    
ref|WP_037283263.1|  acetolactate synthase                              144   4e-39    
ref|WP_006895934.1|  acetolactate synthase small subunit                144   4e-39    
ref|WP_034125045.1|  acetolactate synthase                              144   4e-39    
ref|WP_011843915.1|  acetolactate synthase                              144   5e-39    
ref|WP_015285675.1|  acetolactate synthase, small subunit               144   5e-39    
ref|WP_019005125.1|  acetolactate synthase                              144   5e-39    
ref|WP_013277625.1|  acetolactate synthase                              144   5e-39    
ref|WP_013809503.1|  acetolactate synthase                              144   6e-39    
ref|WP_022739987.1|  acetolactate synthase small subunit                143   6e-39    
ref|WP_016308921.1|  acetolactate synthase, small subunit               143   6e-39    
ref|WP_012031699.1|  acetolactate synthase                              144   6e-39    
ref|WP_028026253.1|  acetolactate synthase                              143   8e-39    
ref|WP_031516768.1|  acetolactate synthase                              143   8e-39    
ref|XP_007033633.1|  Poly(A) polymerase 1                               153   9e-39    
ref|WP_003513130.1|  acetolactate synthase                              143   9e-39    
ref|WP_026918252.1|  acetolactate synthase                              143   1e-38    
ref|WP_013328365.1|  acetolactate synthase                              143   1e-38    
ref|WP_044602782.1|  acetolactate synthase                              142   1e-38    
ref|WP_015538691.1|  acetolactate synthase, small subunit               142   1e-38    
ref|WP_012618999.1|  acetolactate synthase                              142   1e-38    
ref|XP_011014725.1|  PREDICTED: acetolactate synthase small subun...    148   2e-38    
ref|WP_026487036.1|  acetolactate synthase                              142   2e-38    
ref|WP_004039165.1|  acetolactate synthase                              142   2e-38    
ref|WP_021899366.1|  acetolactate synthase small subunit                142   2e-38    
ref|WP_003544157.1|  acetolactate synthase                              142   2e-38    
ref|WP_042698724.1|  acetolactate synthase                              142   2e-38    
ref|WP_026293601.1|  acetolactate synthase                              142   3e-38    
ref|WP_033404309.1|  acetolactate synthase                              142   3e-38    
gb|ADG81247.1|  acetolactate synthase, small subunit                    142   3e-38    
ref|WP_008378105.1|  acetolactate synthase small subunit                142   4e-38    
ref|WP_028612083.1|  acetolactate synthase                              141   4e-38    
ref|WP_005935794.1|  acetolactate synthase small subunit                141   4e-38    
ref|WP_022378646.1|  hypothetical protein                               141   4e-38    
ref|WP_013823910.1|  acetolactate synthase                              142   4e-38    
ref|WP_006037294.1|  acetolactate synthase                              141   5e-38    
ref|WP_031466719.1|  acetolactate synthase                              141   6e-38    
ref|WP_013914493.1|  acetolactate synthase                              140   7e-38    
ref|WP_022363661.1|  acetolactate synthase small subunit                140   7e-38    
ref|WP_009677532.1|  acetolactate synthase                              141   7e-38    
ref|WP_027356889.1|  acetolactate synthase                              141   7e-38    
ref|WP_008410933.1|  putative acetolactate synthase small subunit       140   9e-38    
ref|WP_036583592.1|  acetolactate synthase                              140   1e-37    
ref|WP_014368422.1|  acetolactate synthase                              140   1e-37    
ref|WP_006677976.1|  acetolactate synthase                              140   1e-37    
ref|WP_011876669.1|  acetolactate synthase                              140   1e-37    
ref|WP_005199381.1|  MULTISPECIES: acetolactate synthase                140   1e-37    
ref|WP_036704322.1|  acetolactate synthase                              140   1e-37    
ref|WP_014162314.1|  acetolactate synthase                              140   1e-37    
ref|WP_018886441.1|  MULTISPECIES: acetolactate synthase                140   1e-37    
ref|WP_010681301.1|  acetolactate synthase                              140   1e-37    
ref|WP_006434782.1|  acetolactate synthase small subunit                140   1e-37    
ref|WP_041285150.1|  acetolactate synthase                              140   1e-37    
ref|WP_041587884.1|  acetolactate synthase                              140   1e-37    
ref|WP_022370560.1|  hypothetical protein                               140   1e-37    
gb|AGL00152.1|  acetolactate synthase, small subunit                    140   1e-37    



>emb|CDP04139.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   353 bits (905),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/196 (87%), Positives = 187/196 (95%), Gaps = 1/196 (1%)
 Frame = -1

Query  689  DDLFV-NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            DD +V NQVLDA+WGVLYDEDS+GL+SHTLSMLVNDSPGVLNL+TGVISRRGYN+QSLAV
Sbjct  256  DDSYVANQVLDANWGVLYDEDSNGLRSHTLSMLVNDSPGVLNLVTGVISRRGYNVQSLAV  315

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            GPAE+EG+SRITTV+PGT+ETI KL+Q FYKLVD+HEVQD+T LPFAERELMLIKVAVNA
Sbjct  316  GPAEKEGVSRITTVVPGTNETIGKLVQQFYKLVDVHEVQDITPLPFAERELMLIKVAVNA  375

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAKPVDVSDHTITLELTG FNK+LALQ+LLEPYGICEVARTGRVALV
Sbjct  376  AARRDVLDIASIFRAKPVDVSDHTITLELTGDFNKMLALQKLLEPYGICEVARTGRVALV  435

Query  152  RESGVDSTSLRGYCLP  105
            RESGVDST LRGY LP
Sbjct  436  RESGVDSTLLRGYPLP  451


 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++T+++
Sbjct  47   VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKTLQQ  104

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL+R P  ERELMLIK+  ++    +++ +  IFRAK VD+S+H 
Sbjct  105  VVEQLNKLVNVLKVEDLSREPQVERELMLIKLHADSETIAEVMWLKDIFRAKIVDISEHF  164

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K  A+ R    +GI EVARTGR+AL RE
Sbjct  165  LTVEVTGDPGKTAAVLRNFSKFGIKEVARTGRIALRRE  202



>ref|XP_009788611.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Nicotiana sylvestris]
Length=276

 Score =   345 bits (886),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S+DD+ V QVLDAHWG LYD D SGL+SHT+ MLVN++PGVLNL+TGVISRRGYN+QSLA
Sbjct  80   SSDDISV-QVLDAHWGYLYDGDLSGLRSHTIVMLVNNAPGVLNLITGVISRRGYNVQSLA  138

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE EGLSRITTVIPGTDETI KL++ FYKLVDIHEVQD+T LPFAERELMLIKVA N
Sbjct  139  VGPAESEGLSRITTVIPGTDETIGKLVKQFYKLVDIHEVQDITHLPFAERELMLIKVAAN  198

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            ATARRD+LDIASIFRAKPVDVSDHT+ LELTG FNKLLALQRLLEPYGICEVARTGR+AL
Sbjct  199  ATARRDVLDIASIFRAKPVDVSDHTVALELTGDFNKLLALQRLLEPYGICEVARTGRIAL  258

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDSTSLRGY LPL
Sbjct  259  VRESGVDSTSLRGYPLPL  276



>gb|EYU39756.1| hypothetical protein MIMGU_mgv1a005187mg [Erythranthe guttata]
Length=494

 Score =   347 bits (890),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D  F N++LDA+WGVLYDEDSSGLQSHTLSM+VN+SPGVLNL+TGVISRRGYNIQSLAVG
Sbjct  299  DGGFYNRILDANWGVLYDEDSSGLQSHTLSMVVNNSPGVLNLITGVISRRGYNIQSLAVG  358

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EG+SRITTV+PGTDE+I KL+Q FYKLVDIHEVQD+T LPFAERELMLIK+A NA+
Sbjct  359  PAESEGISRITTVVPGTDESIGKLVQQFYKLVDIHEVQDMTHLPFAERELMLIKIAANAS  418

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA+IFRAKPVDVSDHT+TLE+TG FNK+LALQ LLEPYGICEVARTGRVAL R
Sbjct  419  ARRDVLDIANIFRAKPVDVSDHTVTLEVTGDFNKMLALQNLLEPYGICEVARTGRVALAR  478

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY +PL
Sbjct  479  ESGVDSRYLRGYSIPL  494


 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  617  QSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKL  438
            + HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ ++++
Sbjct  86   KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKAL--FTIVVSGTEKVLQQV  143

Query  437  LQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTI  258
            ++   KLV++ +V+DL++    ERELMLIK+  ++  + +I+ +  IFRA  VD+S+HT+
Sbjct  144  VEQLNKLVNVLKVEDLSKEAQVERELMLIKLNADSNTKGEIMWLVDIFRASVVDISEHTL  203

Query  257  TLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            T+E+TG   K+ A+ R L+ +GI E+ARTG++AL RE
Sbjct  204  TIEVTGDPGKMAAVLRNLKKFGIKELARTGKIALRRE  240



>ref|XP_011084704.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
 ref|XP_011084706.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=493

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD F NQVLDAHWGVLYDEDSSGLQSHTLS+LVN+SPGVLNL+TGV+SRRGYNIQSLAVG
Sbjct  298  DDGFSNQVLDAHWGVLYDEDSSGLQSHTLSLLVNNSPGVLNLVTGVVSRRGYNIQSLAVG  357

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EG+SRITTV+ GTDE+I KL++ FYKLVD++EVQD+T LPFAERELMLIK+A NA 
Sbjct  358  PAETEGISRITTVVAGTDESIGKLVKQFYKLVDVYEVQDMTHLPFAERELMLIKIAANAA  417

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAKPVDVSDHT+TLE+TG FNK+LALQ LLEPYGICEVARTGRVALVR
Sbjct  418  ARRDVLDIASIFRAKPVDVSDHTVTLEVTGDFNKMLALQNLLEPYGICEVARTGRVALVR  477

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY L L
Sbjct  478  ESGVDSRYLRGYSLSL  493


 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -1

Query  617  QSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKL  438
            + HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ ++++
Sbjct  85   KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKAL--FTIVVCGTEKILQQV  142

Query  437  LQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTI  258
            ++   KLV++ +V+DL+R P  ERELMLIK+  ++  + +I+ +  IFR K VD+S++T+
Sbjct  143  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNADSNTKGEIMWLVDIFRGKVVDISENTL  202

Query  257  TLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            T+E+TG   K++A+ R L  +GI E+ARTG++AL RE
Sbjct  203  TIEVTGDPGKMVAVLRNLRKFGIKELARTGKIALRRE  239



>ref|XP_011084705.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=493

 Score =   344 bits (883),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD F NQVLDAHWGVLYDEDSSGLQSHTLS+LVN+SPGVLNL+TGV+SRRGYNIQSLAVG
Sbjct  298  DDGFSNQVLDAHWGVLYDEDSSGLQSHTLSLLVNNSPGVLNLVTGVVSRRGYNIQSLAVG  357

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EG+SRITTV+ GTDE+I KL++ FYKLVD++EVQD+T LPFAERELMLIK+A NA 
Sbjct  358  PAETEGISRITTVVAGTDESIGKLVKQFYKLVDVYEVQDMTHLPFAERELMLIKIAANAA  417

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAKPVDVSDHT+TLE+TG FNK+LALQ LLEPYGICEVARTGRVALVR
Sbjct  418  ARRDVLDIASIFRAKPVDVSDHTVTLEVTGDFNKMLALQNLLEPYGICEVARTGRVALVR  477

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY L L
Sbjct  478  ESGVDSRYLRGYSLSL  493


 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -1

Query  617  QSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKL  438
            + HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ ++++
Sbjct  85   KRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNQDKAL--FTIVVCGTEKILQQV  142

Query  437  LQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTI  258
            ++   KLV++ +V+DL+R P  ERELMLIK+  ++  + +I+ +  IFR K VD+S++T+
Sbjct  143  VEQLNKLVNVLKVEDLSREPQVERELMLIKLNADSNTKGEIMWLVDIFRGKVVDISENTL  202

Query  257  TLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            T+E+TG   K++A+ R L  +GI E+ARTG++AL RE
Sbjct  203  TIEVTGDPGKMVAVLRNLRKFGIKELARTGKIALRRE  239



>ref|XP_006353245.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=490

 Score =   344 bits (882),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/197 (83%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S++++ VNQ+LDAHWG LYD D SG++SHTLSMLVN++PGVLNL++GVISRRGYN+QSLA
Sbjct  293  SSNEISVNQILDAHWGYLYDGDLSGIRSHTLSMLVNNAPGVLNLISGVISRRGYNVQSLA  352

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE EGLSRITTV+PGTDETI KL++ F KL+D+HEVQD+T LPFAERELMLIKVA N
Sbjct  353  VGPAETEGLSRITTVVPGTDETIGKLVKQFNKLIDVHEVQDITHLPFAERELMLIKVAAN  412

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAKPVDVSDHT+TLELTG FNKLLALQRLLEPYGICEVARTGRVAL
Sbjct  413  AAARRDVLDIASIFRAKPVDVSDHTVTLELTGDFNKLLALQRLLEPYGICEVARTGRVAL  472

Query  155  VRESGVDSTSLRGYCLP  105
            VRESGVDST LRGY LP
Sbjct  473  VRESGVDSTYLRGYALP  489


 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            SS ++SHT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ 
Sbjct  84   SSRVKSHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKV  141

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+DL+R P  ERELMLIK+  +AT + +I+ +  IFR K VD+S
Sbjct  142  LQQVVEQLNKLVNVWKVEDLSREPQVERELMLIKLNADATTKAEIMWLVDIFRGKIVDIS  201

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K+ A+ R L  +GI E+ARTG++AL RE
Sbjct  202  EHFLTIEVTGDPGKMAAVLRNLSKFGISELARTGKIALRRE  242



>ref|XP_004250085.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=490

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S+D++ VNQVLDAHWG LYD D +G++SHTLSMLVN++PGVLNL++GVISRRGYN+QSLA
Sbjct  293  SSDEISVNQVLDAHWGYLYDGDLTGIRSHTLSMLVNNAPGVLNLISGVISRRGYNVQSLA  352

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE EGLSRITTV+PGTDETI KL++ F KL+D+HEV+D+T LPFAERELMLIKVA N
Sbjct  353  VGPAETEGLSRITTVVPGTDETIGKLVKQFNKLIDVHEVRDITHLPFAERELMLIKVASN  412

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAKPVDVSDHT+TLELTG FNKLLALQRLLEPYGICEVARTGRVAL
Sbjct  413  AAARRDVLDIASIFRAKPVDVSDHTVTLELTGDFNKLLALQRLLEPYGICEVARTGRVAL  472

Query  155  VRESGVDSTSLRGYCLP  105
            +RESGVDST LRGY LP
Sbjct  473  IRESGVDSTYLRGYALP  489


 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            SS ++SHT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ 
Sbjct  84   SSRVKSHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKV  141

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+DL+R P  ERELMLIK+  +AT + +I+ +  IFR K VD+S
Sbjct  142  LQQVVEQLNKLVNVWKVEDLSREPQVERELMLIKLNADATTKAEIMWLVDIFRGKIVDIS  201

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            DH +T+E+TG   K+ A+ R L  +GI E+ARTG++AL RE
Sbjct  202  DHFLTIEVTGDPGKMAAVLRNLSKFGISELARTGKIALRRE  242



>ref|XP_007028126.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
 gb|EOY08628.1| ACT domain-containing small subunit of acetolactate synthase 
protein isoform 1 [Theobroma cacao]
Length=482

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +NQVLDAHWGVL+DEDSSGLQSHTLSM+VND+PGVLN++TGVISRRGYNIQSLAVG
Sbjct  287  DDFPINQVLDAHWGVLFDEDSSGLQSHTLSMVVNDTPGVLNVVTGVISRRGYNIQSLAVG  346

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAER+ LSRITTV+PGT+ETI KL+Q   KLVD++EVQD+T LPFAERELML+KVAVN  
Sbjct  347  PAERDELSRITTVVPGTNETIGKLVQQLQKLVDLYEVQDMTHLPFAERELMLVKVAVNTA  406

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEV RTGRVALVR
Sbjct  407  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVTRTGRVALVR  466

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDSTSLRGY LP 
Sbjct  467  ESGVDSTSLRGYSLPF  482


 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + +   T V+ GT+  
Sbjct  74   ASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAI--FTIVVSGTEMI  131

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D+++ P  ERELMLIK+  +A  R +++ +  IFRAK VD S
Sbjct  132  LRQVVEQLNKLVNVIKVEDISKEPHVERELMLIKLHADADTRAEVMWLVDIFRAKIVDTS  191

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            +  +T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE    +    G+ 
Sbjct  192  EQFLTIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRREKLGQTAPFWGFS  244



>ref|XP_009351614.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=479

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   N+VLDAHWGVLYDEDSSG++SHTLSM+VNDSPGVLN++TGVISRRGYNIQSLAVG
Sbjct  284  DDFRSNKVLDAHWGVLYDEDSSGVRSHTLSMIVNDSPGVLNIVTGVISRRGYNIQSLAVG  343

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PGT+++I KL+Q  +KL+D+HEV+D+T LPFAERELMLIK+AVNAT
Sbjct  344  PAEKEGLSRITTVVPGTEDSISKLVQQLHKLIDLHEVRDITHLPFAERELMLIKIAVNAT  403

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHT+TLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  404  ARRDVLDIASIFRAKAVDVSDHTVTLELTGDLNKMVALQKLLEPYGICEVARTGRVALER  463

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  464  ESGVDSTYLRGYPLPL  479


 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            SS ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ 
Sbjct  71   SSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKV  128

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D++R P  ERELMLIK+  + + R +I+ +  IFRAK VD+S
Sbjct  129  LRQVVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDIS  188

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            + ++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  189  EQSLTVEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRRE  229



>ref|XP_010242460.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Nelumbo nucifera]
Length=482

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D L V QVLDAHWG L DEDSSGL+SHTLSMLV+DSPGVLNL+TGV +RRGYNIQSLAVG
Sbjct  287  DGLSVKQVLDAHWGALNDEDSSGLRSHTLSMLVSDSPGVLNLVTGVFARRGYNIQSLAVG  346

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTDE+I KL+Q  YKL++IHEVQD+T LPFAERELMLIK+AVN T
Sbjct  347  PAEKEGISRITTVVPGTDESIGKLVQQLYKLINIHEVQDITHLPFAERELMLIKIAVNTT  406

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALVR
Sbjct  407  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVR  466

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LP 
Sbjct  467  ESGVDSTYLRGYSLPF  482


 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  +
Sbjct  76   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVL  133

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D+++ P  ERELML+K+  + + R +I+ +  IFRAK VD+S+
Sbjct  134  QQVVEQLLKLVNVLKVEDISKEPQVERELMLVKLNADPSNRAEIMWLVDIFRAKVVDISE  193

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  194  HSLTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRRE  233



>ref|XP_008371723.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like, 
partial [Malus domestica]
Length=472

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   N+VLDAHWGVLYDEDSSG+QSHTLSM+VNDSPGVLN++TGVISRRGYNIQSLAVG
Sbjct  277  DDFRSNKVLDAHWGVLYDEDSSGVQSHTLSMIVNDSPGVLNIVTGVISRRGYNIQSLAVG  336

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+ GLSRITTV+PGT+++I KL+Q  +KL+D+HEV+D+T  PFAERELMLIK+AVNAT
Sbjct  337  PAEKXGLSRITTVVPGTEDSISKLVQQLHKLIDLHEVRDITHXPFAERELMLIKIAVNAT  396

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHT+TLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  397  ARRDVLDIASIFRAKAVDVSDHTVTLELTGDLNKMVALQKLLEPYGICEVARTGRVALER  456

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  457  ESGVDSTYLRGYPLPL  472


 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            SS ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT + 
Sbjct  64   SSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTGKV  121

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D++R P  ERELMLIK+  + + R +I+ +  IFRAK VD+S
Sbjct  122  LRQVVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDIS  181

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            + ++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  182  EQSLTVEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRRE  222



>ref|XP_006468633.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Citrus sinensis]
Length=484

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   NQVLDAHWG+LYDED SGL+SHTLSMLVN++PGVLN++TGVISRRGYNIQSLAVG
Sbjct  289  DDFSANQVLDAHWGILYDEDPSGLRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVG  348

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PGTDE+I KL+Q  +KL+D+HEVQD+T LPFAEREL+LIK+AVN  
Sbjct  349  PAEKEGLSRITTVVPGTDESIGKLVQLLHKLIDLHEVQDITHLPFAERELILIKIAVNTA  408

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA IFRA+ VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGRVALVR
Sbjct  409  ARRDVLDIAKIFRARAVDVSDHTITLELTGDLNKIIALQRLLEPYGICEVARTGRVALVR  468

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  469  ESGVDSTYLRGYPLPL  484


 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  74   ASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKAL--FTIVVSGTERV  131

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D++  P  ERELMLIK+  + +   +I+ +  IFRAK VD+S
Sbjct  132  LRQVVEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDIS  191

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            +H +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE   D+     + 
Sbjct  192  EHALTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPFWNFS  244



>ref|XP_008225227.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Prunus mume]
Length=479

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +N+VLDAHWGVLYDED SG+QSHTLSM+VND PGVLN++TGV+SRRGYNIQSLAVG
Sbjct  284  DDFRLNKVLDAHWGVLYDEDPSGVQSHTLSMIVNDCPGVLNIVTGVMSRRGYNIQSLAVG  343

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PGTD++I KL+Q  +KL+D+HEV+D+T LPFAERELMLIK+AVN T
Sbjct  344  PAEKEGLSRITTVVPGTDDSITKLVQQLHKLIDLHEVRDITHLPFAERELMLIKIAVNTT  403

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  404  ARRDVLDIASIFRAKAVDVSDHTITLELTGDINKMVALQKLLEPYGICEVARTGRVALER  463

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LP+
Sbjct  464  ESGVDSTYLRGYPLPV  479


 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  72   SKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVL  129

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D+++    ERELMLIK+  + +   +I+ +  IFRAK VD+S+
Sbjct  130  RQVVEQLNKLVNVIKVEDISKEEHVERELMLIKLNADPSTLAEIMWLVDIFRAKIVDISE  189

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI EVARTG++AL RE
Sbjct  190  HSLTIEVTGDPGKVVAVQRNLSKFGIKEVARTGKIALRRE  229



>ref|XP_007212091.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
 gb|EMJ13290.1| hypothetical protein PRUPE_ppa005063mg [Prunus persica]
Length=479

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +N+VLDAHWGVLYDED SG+QSHTLSM+VND PGVLN++TGV+SRRGYNIQSLAVG
Sbjct  284  DDFRLNKVLDAHWGVLYDEDVSGVQSHTLSMIVNDCPGVLNIVTGVMSRRGYNIQSLAVG  343

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PGTD++I KL+Q  +KL+D+HEV+D+T LPFAERELMLIK+AVN T
Sbjct  344  PAEKEGLSRITTVVPGTDDSITKLVQQLHKLIDLHEVRDITHLPFAERELMLIKIAVNTT  403

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  404  ARRDVLDIASIFRAKAVDVSDHTITLELTGDINKMVALQKLLEPYGICEVARTGRVALER  463

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LP+
Sbjct  464  ESGVDSTYLRGYPLPV  479


 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  72   SKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVL  129

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D+++    ERELMLIK+  + +   +I+ +  IFRAK VD+S+
Sbjct  130  RQVVEQLNKLVNVIKVEDISKEEHVERELMLIKLNADPSTLAEIMWLVDIFRAKIVDISE  189

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  190  HSLTIEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRRE  229



>gb|KJB78879.1| hypothetical protein B456_013G024000 [Gossypium raimondii]
Length=249

 Score =   327 bits (837),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   VNQVLDAHWGVLYDEDS GL+SHTL+M+VNDSPGVLN++TGVISRRGYNIQSLAVG
Sbjct  54   DGFPVNQVLDAHWGVLYDEDSCGLRSHTLAMVVNDSPGVLNVVTGVISRRGYNIQSLAVG  113

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE++GLSRITTVIPGTDET+ KL Q   KLVD++EVQD+T  PFAERELMLIKVAV+  
Sbjct  114  PAEKDGLSRITTVIPGTDETLAKLFQQLRKLVDLYEVQDMTHSPFAERELMLIKVAVSPA  173

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRDILDIA+IFRAK VDV DHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVALVR
Sbjct  174  ARRDILDIANIFRAKAVDVCDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALVR  233

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LP 
Sbjct  234  ESGVDSTYLRGYPLPF  249



>ref|XP_002311270.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
 gb|EEE88637.2| hypothetical protein POPTR_0008s07820g [Populus trichocarpa]
Length=490

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +N VLDAHWGVLYDEDS+GL+SHTLSMLVN+ PGVLN++TGVISRRGYNIQSLAVG
Sbjct  295  DDFLMNPVLDAHWGVLYDEDSNGLRSHTLSMLVNNCPGVLNIVTGVISRRGYNIQSLAVG  354

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EGLSRITTVIPGTDE+I KL+Q  +KL+D+HEV+D+T  PFAERELMLIK+A N+ 
Sbjct  355  PAEEEGLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDITHSPFAERELMLIKIAANSA  414

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA IFRAK VDVSDHTITLELTG FNK++ALQR+LEPYGICEVARTGRVALVR
Sbjct  415  ARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILEPYGICEVARTGRVALVR  474

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRG+ LPL
Sbjct  475  ESGVDSTYLRGFPLPL  490


 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S LQ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  75   SRLQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVCGTENVL  132

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V D++R P  ERELMLIK   + + R +++ +  IFRAK VD+S+
Sbjct  133  RQVVEQLNKLVNVIKVDDISREPQVERELMLIKFNADPSTRAEVMWLVDIFRAKIVDISE  192

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +++T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE
Sbjct  193  NSLTIEVTGDPGKMAAIQRNLSKFGIKELARTGKIALRRE  232



>ref|XP_006448525.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61765.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=484

 Score =   334 bits (857),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   NQVLDAHWG+LYDED SGL+SHTLSMLVN++PGVLN++TGVISRRGYNIQSLAVG
Sbjct  289  DDFSANQVLDAHWGILYDEDPSGLRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVG  348

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PGTDE+I KL+Q  +KL+D+HEVQD+T LPFAEREL+LIK+AVN  
Sbjct  349  PAEKEGLSRITTVVPGTDESIGKLVQLLHKLIDLHEVQDITHLPFAERELILIKIAVNTA  408

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LD A IFRA+ VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGRVALVR
Sbjct  409  ARRDVLDTAKIFRARAVDVSDHTITLELTGDLNKIIALQRLLEPYGICEVARTGRVALVR  468

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  469  ESGVDSTYLRGYPLPL  484


 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  74   ASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKAL--FTIVVSGTERV  131

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D++  P  ERELMLIK+  + +   +I+ +  IFRAK VD+S
Sbjct  132  LRQVVEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDIS  191

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            +H +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE   D+     + 
Sbjct  192  EHALTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPFWNFS  244



>ref|XP_006664907.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Oryza brachyantha]
Length=412

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            +NQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVGPAE+
Sbjct  221  MNQVLDAHWGVLDDEDSSGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEK  280

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
             GLSRITTVIPGTDE+I KL+Q  YKLVD+HEVQD+T  PFAERELMLIKV+VN  ARRD
Sbjct  281  AGLSRITTVIPGTDESIEKLVQQLYKLVDVHEVQDITHWPFAERELMLIKVSVNTAARRD  340

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            ILDIA IFRAKPVDVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRESGV
Sbjct  341  ILDIAEIFRAKPVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGV  400

Query  137  DSTSLRGYCLPL  102
            DS  LRGY LPL
Sbjct  401  DSKYLRGYSLPL  412


 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + +   T V+ GTD  + +
Sbjct  5    VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAM--FTIVVSGTDRVLNQ  62

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S++T
Sbjct  63   VIEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVEPYQRPEVMVLVDIFRAKVVDISENT  122

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A+QR L  +GI E+ RTG++AL RE 
Sbjct  123  LTVEVTGDPGKIVAVQRNLSKFGIKEICRTGKIALRREK  161



>ref|XP_011014712.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=467

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            NDD  VNQVLDA+WGVLYDEDS+GL+SHTLSMLVN+ PGVLN+LTGVISRRGYNIQSLAV
Sbjct  271  NDDFLVNQVLDANWGVLYDEDSNGLRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAV  330

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE+EGLSRITTVIPGTDE+I KL+Q  +KL+D HEV+D+T  PFAEREL LIK+A N+
Sbjct  331  GHAEKEGLSRITTVIPGTDESIGKLVQQLHKLIDFHEVRDITHSPFAERELTLIKIAANS  390

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIA IFRAK VDVSDHTITLELTG FNK++ALQR+LEPYGICEVARTGRVAL 
Sbjct  391  AARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILEPYGICEVARTGRVALE  450

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDST LRG+ LPL
Sbjct  451  RESGVDSTHLRGFPLPL  467


 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 97/161 (60%), Gaps = 25/161 (16%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S +Q HT+S+ V D  G++N + GV +RRGY+I+SLAVG  + + L   T V+ GT+E +
Sbjct  75   SKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEEVL  132

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV + +V+D++R P  ERELMLIK+  N + R                   
Sbjct  133  RQVVEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTR-------------------  173

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
                 E+TG   K+ A+QR L  +GI E+ARTG++AL RE+
Sbjct  174  ----AEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRET  210



>ref|XP_011014695.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011014703.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=490

 Score =   332 bits (850),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            NDD  VNQVLDA+WGVLYDEDS+GL+SHTLSMLVN+ PGVLN+LTGVISRRGYNIQSLAV
Sbjct  294  NDDFLVNQVLDANWGVLYDEDSNGLRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAV  353

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE+EGLSRITTVIPGTDE+I KL+Q  +KL+D HEV+D+T  PFAEREL LIK+A N+
Sbjct  354  GHAEKEGLSRITTVIPGTDESIGKLVQQLHKLIDFHEVRDITHSPFAERELTLIKIAANS  413

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIA IFRAK VDVSDHTITLELTG FNK++ALQR+LEPYGICEVARTGRVAL 
Sbjct  414  AARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILEPYGICEVARTGRVALE  473

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDST LRG+ LPL
Sbjct  474  RESGVDSTHLRGFPLPL  490


 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S +Q HT+S+ V D  G++N + GV +RRGY+I+SLAVG  + + L   T V+ GT+E +
Sbjct  75   SKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEEVL  132

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV + +V+D++R P  ERELMLIK+  N + R +I+ +  IFRA  VD+S+
Sbjct  133  RQVVEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLVDIFRATIVDISE  192

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            H++T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE+
Sbjct  193  HSLTIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRET  233



>ref|XP_008383599.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=478

 Score =   331 bits (849),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +N VLDAHWGVLYDEDS+G++SHTLSM+VND PGVLN +TGV+SRRGYNIQSLAVG
Sbjct  283  DDFRLNTVLDAHWGVLYDEDSTGVRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVG  342

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EGLSRITTV+PGTD++I KL+Q  +KL+D+HEV+D++ LPFAERELMLIK+AVN T
Sbjct  343  PAEVEGLSRITTVVPGTDDSISKLVQQLHKLIDLHEVRDISHLPFAERELMLIKIAVNTT  402

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  403  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALQR  462

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  463  ESGVDSTYLRGYPLPL  478


 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 109/166 (66%), Gaps = 11/166 (7%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ 
Sbjct  69   TSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKV  126

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI--LDIASIFRAKPVD  276
            +R++++   KLV++ +V+D++R P  ERELMLIK+  + + R ++    I  IF  K + 
Sbjct  127  LRQVVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEVNFWIIQPIFGYKSI-  185

Query  275  VSDHTITL---ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
               HT  +   ++TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  186  ---HTYKISSSQITGDPGKVVAVQRNLSKFGIKELARTGKIALRRE  228



>gb|KCW59209.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=391

 Score =   328 bits (841),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D    NQVLDAHWGVL DED+SGL+SHTLSM+VND+PGVLN++TGV SRRGYNIQSLAVG
Sbjct  196  DGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVG  255

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT +PFAERELMLIK+AVNA 
Sbjct  256  HSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAA  315

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  316  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  375

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  P+
Sbjct  376  ESGVDSKHLRGYAFPV  391


 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  ++++++   KLV++ +V+
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIKV  N   R +I+ +  IFRAK VD+S+H++T+E+TG   K++A+
Sbjct  59   DLSKEPQVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAV  118

Query  215  QRLLEPYGICEVARTGRVALVRES  144
            QR L  +GI E+ARTG++AL RE 
Sbjct  119  QRNLSKFGIREIARTGKIALRREK  142



>ref|XP_002514772.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF47326.1| acetolactate synthase, putative [Ricinus communis]
Length=531

 Score =   333 bits (853),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  VNQVLDAHWGVLYDEDS+G  SHTLSMLVNDSPGVLN++TGVISRRGYNIQSLAVG
Sbjct  336  DDFSVNQVLDAHWGVLYDEDSTGFWSHTLSMLVNDSPGVLNMITGVISRRGYNIQSLAVG  395

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AEREGLSRITTVIPGT+E+I KL+   +KL+D+HEV+D+T +PFAERELMLIK+AVN  
Sbjct  396  SAEREGLSRITTVIPGTNESIGKLVLQLHKLIDMHEVRDITHVPFAERELMLIKIAVNTA  455

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK+ ALQ +LEPYGICEVARTGRVALVR
Sbjct  456  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMAALQTVLEPYGICEVARTGRVALVR  515

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  516  ESGVDSTYLRGYPLPL  531


 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            +S  +Q+HT+S+ V D  G++N + GV +RRG+NI+SLAV   E + L   T V+ GTD 
Sbjct  119  NSFRVQTHTISVFVGDESGIINRIAGVFARRGFNIESLAVCLNEDKAL--FTIVVRGTDN  176

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             +R++++   KLV + +V+D++R P  ERELMLIK+  +   R +I+ +  IFRAK VD+
Sbjct  177  VLRQVVEQLNKLVSVIKVEDISREPQVERELMLIKLNADPMTRHEIMWLVDIFRAKVVDI  236

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            S+HT+T+E+TG   K+ A+ R L  + I E++RTG++AL RE
Sbjct  237  SEHTLTIEVTGDPGKMAAVLRNLSKFRIKELSRTGKIALRRE  278



>ref|XP_011010159.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Populus euphratica]
Length=490

 Score =   331 bits (849),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  ++ VLDAHWGVLYDEDS+GL+SHTLSMLVN+ PGVLN++TGVISRRGYNIQSLAVG
Sbjct  295  DDFLMSPVLDAHWGVLYDEDSNGLRSHTLSMLVNNCPGVLNIVTGVISRRGYNIQSLAVG  354

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EGLSRITTVIPGTD++I KL+Q  +KL+D+HEV+D+T  PFAERELMLIK+A N+ 
Sbjct  355  PAEEEGLSRITTVIPGTDDSIGKLVQQLHKLIDLHEVRDITHSPFAERELMLIKIAANSA  414

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA IFRAK VDVSDHTITLELTG FNK++ALQR+LEPYGICEVARTGRVALVR
Sbjct  415  ARRDVLDIARIFRAKAVDVSDHTITLELTGDFNKMVALQRILEPYGICEVARTGRVALVR  474

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRG+ LPL
Sbjct  475  ESGVDSTYLRGFPLPL  490


 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S LQ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  75   SKLQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVCGTEKVL  132

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V D++R P  ERELMLIK   +++ R +++ +  IFRAK VD+S+
Sbjct  133  RQVVEQLNKLVNVIKVDDISREPQVERELMLIKFNADSSTRAEVMWLVDIFRAKIVDISE  192

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +++T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE
Sbjct  193  NSLTIEVTGDPGKMAAIQRNLSKFGIKELARTGKIALRRE  232



>gb|KHG18039.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=499

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   VN+VLD HWGVLYDEDSSGL+SHTLSM+VNDSPGVLN++TGVISRRGYNIQSLAVG
Sbjct  304  DGFPVNEVLDPHWGVLYDEDSSGLRSHTLSMIVNDSPGVLNVVTGVISRRGYNIQSLAVG  363

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE++GLSRITTVIPGTDET+ KL Q   KLVD++EVQD+T  PFAERELMLIKVAV+  
Sbjct  364  PAEKDGLSRITTVIPGTDETLAKLFQQLRKLVDLYEVQDMTHSPFAERELMLIKVAVSPP  423

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRDILDIA+IFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVALVR
Sbjct  424  ARRDILDIANIFRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALVR  483

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LP 
Sbjct  484  ESGVDSTYLRGYPLPF  499


 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +R+
Sbjct  78   VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERILRQ  135

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V D++  P  ERELMLIK+  N T R +I+ +  IFRA+ VD S+H 
Sbjct  136  VVEQLNKLVNVIKVDDISMEPHVERELMLIKLNTNPTTRAEIMWLVDIFRARIVDTSEHF  195

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            +T+E+TG   K+ A+QR L  +GI E+ARTG+VAL
Sbjct  196  LTIEVTGDPGKMAAVQRNLSKFGIKELARTGKVAL  230



>gb|KJB27747.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=479

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S D   +NQVLDAHWGVL DED+SG QSHTLSMLVNDSPGVLNL+TGV +RRGYN+QSLA
Sbjct  282  SPDGFTINQVLDAHWGVLTDEDTSGHQSHTLSMLVNDSPGVLNLVTGVFARRGYNLQSLA  341

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT+LPFAERELMLIK+AVN
Sbjct  342  VGHAEVEGLSRITTVVPGTDESISKLVQQLYKLVDMHEVRDLTQLPFAERELMLIKIAVN  401

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIA+IFRAK VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  402  AAARRDVLDIANIFRAKAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRLAL  461

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY LPL
Sbjct  462  VRESGVDSRYLRGYSLPL  479


 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 121/183 (66%), Gaps = 2/183 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S DD   N    A+  V      S ++ HT+S+ V D  G++N + GV +RRGYNI+SLA
Sbjct  49   SVDDKISNSNFLANGPVPSTPTRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLA  108

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG  + + L   T V+ GTD  ++++++   KLV++ +V+DL+  P  ERELMLIKV  +
Sbjct  109  VGLNKDKAL--FTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEPQVERELMLIKVNAD  166

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
               R +I+ +  IFRAK VD+S+H++T+E+TG   K++A+QR L  +GI E+ARTG++AL
Sbjct  167  PKFRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSKFGIKEIARTGKIAL  226

Query  155  VRE  147
             RE
Sbjct  227  RRE  229



>gb|KGN66639.1| hypothetical protein Csa_1G652220 [Cucumis sativus]
Length=218

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            +QVLDAHWGVLYDEDSSG QSHTLSMLVND PGVLN++TG+ISRRGYNIQSLAVG AERE
Sbjct  28   DQVLDAHWGVLYDEDSSGHQSHTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAERE  87

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            GLSRITTVIPGTDE+I KL+Q  +KL+D+HEV+DLT LPFAERELMLIK+A NATARRD+
Sbjct  88   GLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHLPFAERELMLIKIAANATARRDV  147

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IFRAK VDVS HTITL+LTG  NK++ALQRLLEP+GICEVARTGRVAL RESGVD
Sbjct  148  LDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLEPFGICEVARTGRVALERESGVD  207

Query  134  STSLRGYCLPL  102
            S  LRGY LP+
Sbjct  208  SAYLRGYPLPI  218



>ref|XP_011460628.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=479

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   NQVLDAHWGVLYDEDSSG+QSHTL MLV+D PGVLN++TGVISRRGYNIQSLAVG
Sbjct  284  DDCPSNQVLDAHWGVLYDEDSSGVQSHTLCMLVSDVPGVLNIVTGVISRRGYNIQSLAVG  343

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            P+E+EGLSRITTV+PGTD+TI KL+Q   KL+D+HEV+D+T LPFAERELMLIK+AVNA 
Sbjct  344  PSEKEGLSRITTVVPGTDDTITKLVQQLRKLIDLHEVRDITHLPFAERELMLIKIAVNAN  403

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA IFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYG+CE+ARTGRVAL R
Sbjct  404  ARRDVLDIAGIFRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGLCEIARTGRVALER  463

Query  149  ESGVDSTSLRGYCLPL  102
             SGVDSTSLRGY LPL
Sbjct  464  GSGVDSTSLRGYPLPL  479


 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT++ +
Sbjct  73   SKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTEKIL  130

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++R P  ERELMLIK+  + + R +I+ +  IFRAK VD+S+
Sbjct  131  QQVVEQLNKLVNVIKVEDISREPQVERELMLIKLHADPSNRAEIMWLVDIFRAKIVDISE  190

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR    +GI E+ARTG++AL RE
Sbjct  191  HSLTIEVTGDPGKMVAVQRNFSKFGIKELARTGKIALRRE  230



>ref|XP_009352938.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=477

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +N+VLDAHWGVLYDEDSSG++SHTLSM+VND PGVLN +TGV+SRRGYNIQSLAVG
Sbjct  282  DDFRLNKVLDAHWGVLYDEDSSGVRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVG  341

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EGLSRITTV+PGTD++I KL+Q  +KL+D+HEV+D++ LPFAERELMLIK+AVN T
Sbjct  342  PAEMEGLSRITTVVPGTDDSISKLVQQLHKLIDLHEVRDISHLPFAERELMLIKIAVNTT  401

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  402  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALQR  461

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY L L
Sbjct  462  ESGVDSTFLRGYPLQL  477


 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ 
Sbjct  69   TSKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKV  126

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++  V+D++R    ERELMLIK+  + + R +I+ +  IFRAK VD+S
Sbjct  127  LRQVVEQLNKLVNVINVEDISREQQVERELMLIKLDADPSTRAEIMWLVDIFRAKIVDIS  186

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            + ++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  187  EQSLTVEVTGDPGKVVAVQRNLSKFGIKELARTGKIALRRE  227



>gb|EYU17620.1| hypothetical protein MIMGU_mgv1a005378mg [Erythranthe guttata]
Length=486

 Score =   330 bits (846),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S DD+ +NQVLDAHWGVL D+DSSGL SHTLSM+VND PGVLNL+TGV +RRGYNIQSLA
Sbjct  289  SGDDISINQVLDAHWGVLNDDDSSGLSSHTLSMVVNDVPGVLNLVTGVFARRGYNIQSLA  348

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVN
Sbjct  349  VGHSEVEGLSRITTVVPGTDESIGKLVQQLYKLVDLHEVRDLTHLPFAERELMLIKIAVN  408

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  409  AAARRNVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIAL  468

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY  PL
Sbjct  469  VRESGVDSRYLRGYSYPL  486


 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ H +S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  79   SKVKRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVL  136

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
              +++   KLV++ +V+D+++ P  ERELMLIK+  +   R +++ +  IFRAK VD+SD
Sbjct  137  HHVMEQLQKLVNVLKVEDISQDPQVERELMLIKINADPNHRAEVMWLVDIFRAKIVDISD  196

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  197  HSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  236



>gb|KJB78878.1| hypothetical protein B456_013G024000 [Gossypium raimondii]
Length=483

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   VNQVLDAHWGVLYDEDS GL+SHTL+M+VNDSPGVLN++TGVISRRGYNIQSLAVG
Sbjct  288  DGFPVNQVLDAHWGVLYDEDSCGLRSHTLAMVVNDSPGVLNVVTGVISRRGYNIQSLAVG  347

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE++GLSRITTVIPGTDET+ KL Q   KLVD++EVQD+T  PFAERELMLIKVAV+  
Sbjct  348  PAEKDGLSRITTVIPGTDETLAKLFQQLRKLVDLYEVQDMTHSPFAERELMLIKVAVSPA  407

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRDILDIA+IFRAK VDV DHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVALVR
Sbjct  408  ARRDILDIANIFRAKAVDVCDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALVR  467

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LP 
Sbjct  468  ESGVDSTYLRGYPLPF  483


 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 114/170 (67%), Gaps = 2/170 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +R+
Sbjct  78   VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERILRQ  135

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V D++  P  ERELMLIK+  N T R +I+ +  IFRA+ VD S+H 
Sbjct  136  VVEQLNKLVNVIKVDDISMEPHVERELMLIKLNTNPTTRAEIMWLVDIFRARIVDTSEHF  195

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            +T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE   ++    G+ 
Sbjct  196  LTVEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRREKMGETAPFWGFS  245



>ref|XP_004251994.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Solanum lycopersicum]
Length=481

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            VNQVLDAHWGVL DED+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAVG AE 
Sbjct  290  VNQVLDAHWGVLNDEDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVGHAEV  349

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EGLSRITTV+PGTDE++ KL+Q  YKLVDIHEV+D T LPFAERELMLIK+AVNA ARR+
Sbjct  350  EGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDFTHLPFAERELMLIKIAVNAAARRN  409

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            +LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVRESGV
Sbjct  410  VLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRLALVRESGV  469

Query  137  DSTSLRGYCLPL  102
            DS  LRGY  PL
Sbjct  470  DSKYLRGYSYPL  481


 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            + ++ HT+ + V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  74   TNVRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVL  131

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL++ P  ERELMLIK++ +   R +++ +  IFRAK VD+SD
Sbjct  132  QQVMEQLQKLVNVIKVEDLSKEPQVERELMLIKISADPKFRAEVMWLVDIFRAKIVDISD  191

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  192  HSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  231



>emb|CAN61470.1| hypothetical protein VITISV_043824 [Vitis vinifera]
Length=451

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D    N+VLDAHWGVLYDED+SGL+SHTLSM+VN++PGVLNL+TGV +RRGYNIQSLAV
Sbjct  253  SDGFLFNKVLDAHWGVLYDEDTSGLRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAV  312

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q   KL+D+H+V+D+T LPFAERELMLIK+AVNA
Sbjct  313  GHAEVEGLSRITTVVPGTDESINKLVQQLKKLIDLHDVRDITHLPFAERELMLIKIAVNA  372

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK +DVSDHTITLELTGA +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  373  AARRDVLDIASIFRAKAIDVSDHTITLELTGALDKMVALQRLLEPYGICEVARTGRVALV  432

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  433  RESGVDSNYLRGYAFPL  449


 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI SLAVG  + + L   T V+ GT+  +
Sbjct  42   SQVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKAL--FTIVVSGTERVL  99

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++  +KLV++ +V+D++  P  ERELMLIKV  N   R +I+ + +IFRAK VD+S+
Sbjct  100  QQVVEQLHKLVNVLKVEDISTEPHVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISE  159

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE 
Sbjct  160  HSVTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREK  200



>gb|KCW46077.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=391

 Score =   326 bits (835),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
             D    NQVLDAHWGVL DED+SGL+SHTLSM+V D+PGVLN++TGV SRRGYNIQSLAV
Sbjct  195  TDGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAV  254

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT +PFAERELMLIK+AVNA
Sbjct  255  GHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNA  314

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  315  AARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  374

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  P+
Sbjct  375  RESGVDSKHLRGYAFPV  391


 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  ++++++   KLV++ +V+
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIKV      R +I+ +  IFRAK VD+S+H++T+E+TG   K++A+
Sbjct  59   DLSKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAV  118

Query  215  QRLLEPYGICEVARTGRVALVRES  144
            QR L  +GI E+ARTG++AL RE 
Sbjct  119  QRNLSKFGIREIARTGKIALRREK  142



>ref|XP_006353111.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Solanum tuberosum]
Length=481

 Score =   328 bits (842),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++D+  VNQVLDAHWGVL DED+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLA
Sbjct  284  TDDNSGVNQVLDAHWGVLNDEDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLA  343

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE++ KL+Q  YKLVDIHEV+D T  PFAERELMLIK+AVN
Sbjct  344  VGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDFTHHPFAERELMLIKIAVN  403

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  404  AAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRLAL  463

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY  PL
Sbjct  464  VRESGVDSKYLRGYSYPL  481


 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            + ++ HT+ + V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  74   TNVRRHTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTVVVSGTERVL  131

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL++ P  ERELMLIK+  +   R +++ +  +FRAK VD+SD
Sbjct  132  QQVMEQLQKLVNVIKVEDLSKEPQVERELMLIKINADPKYRAEVMWLVDVFRAKIVDISD  191

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  192  HSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  231



>ref|XP_008800993.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=488

 Score =   328 bits (842),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            V+QVLDAHWGVL DEDSSGL SHTLS+LVNDSPGVLN++TGV SRRGYNIQSLAVGP E+
Sbjct  297  VSQVLDAHWGVLDDEDSSGLCSHTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPEEK  356

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EG+SRITTV+PGTDE+I KL+Q  YKLVD+HEVQD+T LPFAERELMLIKVAVN  ARRD
Sbjct  357  EGISRITTVVPGTDESIGKLVQQLYKLVDVHEVQDITHLPFAERELMLIKVAVNTAARRD  416

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            ILDIA IFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRESGV
Sbjct  417  ILDIADIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGV  476

Query  137  DSTSLRGYCLPL  102
            DS  LRGY LP+
Sbjct  477  DSKHLRGYSLPV  488


 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 114/155 (74%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  +R++++
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLRQVVE  145

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              +KLV++ +V+DL++ P  ERELMLIK+ V    R++++ +  IFRAK VD+S+H++T+
Sbjct  146  QLHKLVNVLKVEDLSKEPQVERELMLIKLNVGPERRQEVMGLVDIFRAKIVDISEHSLTI  205

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K++A++R L  +GI E+ARTG++AL RE
Sbjct  206  EVTGDPGKVVAVRRNLNKFGIKEIARTGKIALRRE  240



>ref|XP_002279286.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI24729.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D    N+VLDAHWGVLYDED+SGL+SHTLSM+VN++PGVLNL+TGV +RRGYNIQSLAV
Sbjct  284  SDGFLFNKVLDAHWGVLYDEDTSGLRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAV  343

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q   KL+D+H+V+D+T LPFAERELMLIK+AVNA
Sbjct  344  GHAEVEGLSRITTVVPGTDESINKLVQQLKKLIDLHDVRDITHLPFAERELMLIKIAVNA  403

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK +DVSDHTITLELTGA +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  404  AARRDVLDIASIFRAKAIDVSDHTITLELTGALDKMVALQRLLEPYGICEVARTGRVALV  463

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  464  RESGVDSNYLRGYAFPL  480


 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 115/160 (72%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI SLAVG  + + L   T V+ GT+  +
Sbjct  73   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKAL--FTIVVSGTERVL  130

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++  +KLV++ +V+D++  P  ERELMLIKV  N   R +I+ + +IFRAK VD+S+
Sbjct  131  QQVVEQLHKLVNVLKVEDISTEPHVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISE  190

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  191  HSVTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  230



>ref|XP_010650733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=480

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D    N+VLDAHWGVLYDED+SGL+SHTLSM+VN++PGVLNL+TGV +RRGYNIQSLAV
Sbjct  282  SDGFLFNKVLDAHWGVLYDEDTSGLRSHTLSMVVNNAPGVLNLVTGVFARRGYNIQSLAV  341

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q   KL+D+H+V+D+T LPFAERELMLIK+AVNA
Sbjct  342  GHAEVEGLSRITTVVPGTDESINKLVQQLKKLIDLHDVRDITHLPFAERELMLIKIAVNA  401

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK +DVSDHTITLELTGA +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  402  AARRDVLDIASIFRAKAIDVSDHTITLELTGALDKMVALQRLLEPYGICEVARTGRVALV  461

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  462  RESGVDSNYLRGYAFPL  478


 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI SLAVG  + + L   T V+ GT+  +++
Sbjct  73   VRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNKDKAL--FTIVVSGTERVLQQ  130

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++  +KLV++ +V+D++  P  ERELMLIKV  N   R +I+ + +IFRAK VD+S+H+
Sbjct  131  VVEQLHKLVNVLKVEDISTEPHVERELMLIKVNANPQYRAEIMWLVNIFRAKIVDISEHS  190

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  191  VTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  228



>ref|XP_006470698.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Citrus sinensis]
Length=488

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D L VNQVLD HWGVL D+D+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAV
Sbjct  292  SDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAV  351

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+P TDE+I KL+Q  YKL+D+HEV+DLT LPFAERELMLIKVAVN 
Sbjct  352  GHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNT  411

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            TARRD+LDIA+IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  412  TARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALV  471

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  472  RESGVDSKYLRGYSFPL  488


 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + + ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  80   NRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDK  137

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             ++++++   KLV++ +V+DL+  P  ERELMLIKV  +   R +I  +  IFRAK VD+
Sbjct  138  VLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDI  197

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            S++++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  198  SEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  239



>ref|XP_006446199.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59439.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=488

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D L VNQVLD HWGVL D+D+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAV
Sbjct  292  SDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAV  351

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+P TDE+I KL+Q  YKL+D+HEV+DLT LPFAERELMLIKVAVN 
Sbjct  352  GHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNT  411

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            TARRD+LDIA+IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  412  TARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALV  471

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  472  RESGVDSKYLRGYSFPL  488


 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + + ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  80   NRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDK  137

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             ++++++   KLV++ +V+DL+  P  ERELMLIKV  +   R +I  +  IFRAK VD+
Sbjct  138  VLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDI  197

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            S++++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  198  SEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  239



>ref|XP_010070426.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW59208.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D    NQVLDAHWGVL DED+SGL+SHTLSM+VND+PGVLN++TGV SRRGYNIQSLAVG
Sbjct  292  DGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVG  351

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT +PFAERELMLIK+AVNA 
Sbjct  352  HSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAA  411

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  412  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  471

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  P+
Sbjct  472  ESGVDSKHLRGYAFPV  487


 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  +++
Sbjct  82   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQ  139

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIKV  N   R +I+ +  IFRAK VD+S+H+
Sbjct  140  VMEQLQKLVNVLKVEDLSKEPQVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHS  199

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  200  VTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  237



>ref|XP_008800984.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=502

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            V+QVLDAHWGVL DEDSSGL SHTLS+LVNDSPGVLN++TGV SRRGYNIQSLAVGP E+
Sbjct  311  VSQVLDAHWGVLDDEDSSGLCSHTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPEEK  370

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EG+SRITTV+PGTDE+I KL+Q  YKLVD+HEVQD+T LPFAERELMLIKVAVN  ARRD
Sbjct  371  EGISRITTVVPGTDESIGKLVQQLYKLVDVHEVQDITHLPFAERELMLIKVAVNTAARRD  430

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            ILDIA IFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRESGV
Sbjct  431  ILDIADIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGV  490

Query  137  DSTSLRGYCLPL  102
            DS  LRGY LP+
Sbjct  491  DSKHLRGYSLPV  502


 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 114/169 (67%), Gaps = 16/169 (9%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  +R++++
Sbjct  88   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLRQVVE  145

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              +KLV++ +V+DL++ P  ERELMLIK+ V    R++++ +  IFRAK VD+S+H++T+
Sbjct  146  QLHKLVNVLKVEDLSKEPQVERELMLIKLNVGPERRQEVMGLVDIFRAKIVDISEHSLTI  205

Query  251  E--------------LTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E              +TG   K++A++R L  +GI E+ARTG++AL RE
Sbjct  206  EVTPVEPSLIDNRMQVTGDPGKVVAVRRNLNKFGIKEIARTGKIALRRE  254



>ref|XP_009404280.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            +   VNQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV SRRGYNIQSLAVG
Sbjct  265  NGFVVNQVLDAHWGVLDDEDSSGLRSHTLSILVNDIPGVLNIVTGVFSRRGYNIQSLAVG  324

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTDETI KL+Q  YKL+D+HEV D+T LPFAERELMLIKVAVN  
Sbjct  325  PAEKEGISRITTVVPGTDETIEKLVQQIYKLIDVHEVHDITHLPFAERELMLIKVAVNTA  384

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRDILDIA IFRAK VDVS HTI LELTG  NK++ALQRLLEPYGICEVARTGR+AL+R
Sbjct  385  ARRDILDIAEIFRAKAVDVSGHTIALELTGDLNKMVALQRLLEPYGICEVARTGRIALIR  444

Query  149  ESGVDSTSLRGYCLPL  102
            ESGV+S  LRGY LP+
Sbjct  445  ESGVNSNYLRGYALPI  460


 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 95/158 (60%), Gaps = 30/158 (19%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T  + GT++ +++
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNTDKAL--FTISVSGTEKVLQQ  141

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++  YKLV++ +V                            L +  IFRAK VD+S+++
Sbjct  142  VVEQLYKLVNVLKV----------------------------LGLVDIFRAKVVDISENS  173

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            IT+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  174  ITIEVTGDPGKIVAVQRSLSKFGIKEIARTGKIALRRE  211



>gb|KCW59207.1| hypothetical protein EUGRSUZ_H01869 [Eucalyptus grandis]
Length=487

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D    NQVLDAHWGVL DED+SGL+SHTLSM+VND+PGVLN++TGV SRRGYNIQSLAVG
Sbjct  292  DGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVNDAPGVLNIITGVFSRRGYNIQSLAVG  351

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT +PFAERELMLIK+AVNA 
Sbjct  352  HSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAA  411

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  412  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  471

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  P+
Sbjct  472  ESGVDSKHLRGYAFPV  487


 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  +++
Sbjct  82   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQ  139

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIKV  N   R +I+ +  IFRAK VD+S+H+
Sbjct  140  VMEQLQKLVNVLKVEDLSKEPQVERELMLIKVGANPEHRAEIMYLVDIFRAKIVDISEHS  199

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  200  VTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  237



>ref|XP_006446198.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59438.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=471

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D L VNQVLD HWGVL D+D+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAV
Sbjct  275  SDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAV  334

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+P TDE+I KL+Q  YKL+D+HEV+DLT LPFAERELMLIKVAVN 
Sbjct  335  GHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNT  394

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            TARRD+LDIA+IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  395  TARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALV  454

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  455  RESGVDSKYLRGYSFPL  471


 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 103/162 (64%), Gaps = 19/162 (12%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + + ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  80   NRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDK  137

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
                             V+DL+  P  ERELMLIKV  +   R +I  +  IFRAK VD+
Sbjct  138  -----------------VEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDI  180

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            S++++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  181  SEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  222



>dbj|BAD19594.1| putative acetolactate synthase small subunit [Oryza sativa Japonica 
Group]
 dbj|BAD20154.1| putative acetolactate synthase small subunit [Oryza sativa Japonica 
Group]
Length=323

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            +NQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVGPAE+
Sbjct  132  MNQVLDAHWGVLDDEDSSGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEK  191

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
             GLSRITTV PGTDE+I KL+Q   KLVD+HEVQD+T LPFAERELMLIKV+VN  ARRD
Sbjct  192  SGLSRITTVAPGTDESIEKLVQQLNKLVDVHEVQDITHLPFAERELMLIKVSVNTAARRD  251

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRESGV
Sbjct  252  ILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGV  311

Query  137  DSTSLRGYCLPL  102
            DS  LRGY  PL
Sbjct  312  DSKYLRGYSFPL  323


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -1

Query  359  MLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEV  180
            MLIK+ V    R +++ +  IFRAK VD+S++T+T+E+TG   K++A+QR L  +GI E+
Sbjct  1    MLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAVQRNLSKFGIKEI  60

Query  179  ARTGRVALVRE  147
             RTG++AL RE
Sbjct  61   CRTGKIALRRE  71



>ref|NP_001047389.2| Os02g0608600 [Oryza sativa Japonica Group]
 dbj|BAF09303.2| Os02g0608600, partial [Oryza sativa Japonica Group]
Length=340

 Score =   322 bits (826),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            +NQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVGPAE+
Sbjct  149  MNQVLDAHWGVLDDEDSSGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEK  208

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
             GLSRITTV PGTDE+I KL+Q   KLVD+HEVQD+T LPFAERELMLIKV+VN  ARRD
Sbjct  209  SGLSRITTVAPGTDESIEKLVQQLNKLVDVHEVQDITHLPFAERELMLIKVSVNTAARRD  268

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRESGV
Sbjct  269  ILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGV  328

Query  137  DSTSLRGYCLPL  102
            DS  LRGY  PL
Sbjct  329  DSKYLRGYSFPL  340


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  404  EVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKL  225
            +V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S++T+T+E+TG   K+
Sbjct  3    QVEDLSKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKI  62

Query  224  LALQRLLEPYGICEVARTGRVALVRE  147
            +A+QR L  +GI E+ RTG++AL RE
Sbjct  63   VAVQRNLSKFGIKEICRTGKIALRRE  88



>ref|XP_008349232.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Malus domestica]
Length=412

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD  +N VLDAHWGVLYDEDSSG++SHTLSM+VND PGVLN +TGV+SRRGYNIQSLAVG
Sbjct  217  DDFRLNTVLDAHWGVLYDEDSSGVRSHTLSMIVNDYPGVLNTVTGVLSRRGYNIQSLAVG  276

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EGLSRITTV+PGTD++I KL+Q  +KL+D+HEV+D++ LPFAERELMLIK+    T
Sbjct  277  PAEMEGLSRITTVVPGTDDSISKLVQQLHKLIDLHEVRDISHLPFAERELMLIKIXXXXT  336

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGICEVARTGRVAL R
Sbjct  337  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGICEVARTGRVALQR  396

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  397  ESGVDSTYLRGYPLPL  412


 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 115/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +R+
Sbjct  7    VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLRQ  64

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D++R P  ERELMLIK+  + + R +I+ +  IFRAK VD+S+ +
Sbjct  65   VVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPSTRAEIMWLVDIFRAKIVDISEQS  124

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE 
Sbjct  125  LTVEITGDPGKVVAVQRNLSKFGIKELARTGKIALRREK  163



>ref|XP_010039380.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Eucalyptus grandis]
Length=423

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
             D    NQVLDAHWGVL DED+SGL+SHTLSM+V D+PGVLN++TGV SRRGYNIQSLAV
Sbjct  227  TDGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAV  286

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT +PFAERELMLIK+AVNA
Sbjct  287  GHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNA  346

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  347  AARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  406

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  P+
Sbjct  407  RESGVDSKHLRGYAFPV  423


 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            D S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+ 
Sbjct  14   DDSRVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTER  71

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             ++++++   KLV++ +V+DL++ P  ERELMLIKV      R +I+ +  IFRAK VD+
Sbjct  72   VLQQVMEQLQKLVNVLKVEDLSKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDI  131

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            S+H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE 
Sbjct  132  SEHSVTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREK  174



>ref|XP_002266924.2| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646454.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 ref|XP_010646455.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Vitis vinifera]
 emb|CBI23353.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            +D  VN VLD HWG L DEDSSGL+SHTLSMLVND+PGVLN++TGVISRR YNIQSLAVG
Sbjct  281  NDFSVNPVLDPHWGALNDEDSSGLRSHTLSMLVNDTPGVLNIVTGVISRRSYNIQSLAVG  340

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE EG S ITTV+PGTDE+I KL+Q   KL+D+HEV+D+T +PFAERELMLIK+AVN  
Sbjct  341  PAEMEGRSHITTVVPGTDESISKLVQQLQKLIDLHEVRDITHMPFAERELMLIKIAVNTA  400

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGRVALVR
Sbjct  401  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRVALVR  460

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDST LRGY LPL
Sbjct  461  ESGVDSTYLRGYALPL  476


 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 116/160 (73%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GT+  +
Sbjct  69   SKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVSGTETVL  126

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+DL+R P  ERELMLIK+  + + R +I+ +  IFRAK VD+S+
Sbjct  127  RQVVEQLNKLVNVLKVKDLSREPQVERELMLIKLNADPSKRAEIMWLVDIFRAKIVDISE  186

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  187  HSLTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRRE  226



>ref|XP_011005277.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Populus euphratica]
Length=475

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++DD  +NQ+LDAHWGVL DED++GLQSHTLS+LVND PGVLN++TGV +RRGYNIQSLA
Sbjct  278  ASDDFTLNQILDAHWGVLTDEDTAGLQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLA  337

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE+I KL+Q  YKLV+IHEV+DLT +PFAERELMLIK+AVN
Sbjct  338  VGHAETEGLSRITTVVPGTDESITKLVQQLYKLVEIHEVRDLTHVPFAERELMLIKIAVN  397

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRA  VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  398  AAARRDVLDIASIFRANAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRIAL  457

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRGY  P+
Sbjct  458  TRESGVDSKYLRGYSFPV  475


 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S  + HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + +   T V+ GT+  +
Sbjct  68   SKARRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAI--FTIVVSGTERVL  125

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I+ +  IFRAK VD+S+
Sbjct  126  QQVVEQLQKLVNVLKVEDLSNEPQVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISE  185

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            HT+T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE
Sbjct  186  HTVTIEVTGDPGKIAAVQRNLSKFGIREIARTGKIALRRE  225



>ref|XP_002310395.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
 gb|EEE90845.2| hypothetical protein POPTR_0007s00700g [Populus trichocarpa]
Length=490

 Score =   327 bits (838),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++DD  +NQ+LDAHWGVL DED++GLQSHTLS+LVND PGVLN++TGV +RRGYNIQSLA
Sbjct  293  ASDDFTLNQILDAHWGVLTDEDTAGLQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLA  352

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE+I KL+Q  YKLV+IHEV+DLT +PFAERELMLIK+AVN
Sbjct  353  VGHAETEGLSRITTVVPGTDESITKLVQQLYKLVEIHEVRDLTHVPFAERELMLIKIAVN  412

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRA  VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  413  AAARRDVLDIASIFRANAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRIAL  472

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRGY  P+
Sbjct  473  TRESGVDSKYLRGYSFPV  490


 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S  + HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + +   T V+ GT+  +
Sbjct  80   SKARRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAM--FTIVVSGTERVL  137

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I+ +  IFRAK VD+S+
Sbjct  138  QQVVEQLQKLVNVLKVEDLSNEPQVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISE  197

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            HT+T+E+TG   K+ A+QR L  +GI E+ARTG+V L+
Sbjct  198  HTVTIEVTGDPGKIAAVQRNLSKFGIREIARTGKVVLI  235



>ref|XP_003524233.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=476

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED+SG++SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAV
Sbjct  280  SDGFTVNQVLDAHWGVLNDEDTSGIRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAV  339

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSR+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T LPFAERELMLIK+AVNA
Sbjct  340  GHAEVEGLSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNA  399

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  400  AARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  459

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  460  RESGVDSKYLRGYSYPL  476


 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E   L   T V+ GTD+ +
Sbjct  69   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVL  126

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+DL+R P  ERELMLIKV  +     ++  +  IFRAK VD+S+
Sbjct  127  RQVMEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISE  186

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K+ A+QR    +GI E+ARTG++AL RE
Sbjct  187  HSVTIEVTGDPGKMAAVQRNFSKFGIKEIARTGKIALRRE  226



>ref|XP_009404279.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=488

 Score =   327 bits (837),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            +   VNQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV SRRGYNIQSLAVG
Sbjct  293  NGFVVNQVLDAHWGVLDDEDSSGLRSHTLSILVNDIPGVLNIVTGVFSRRGYNIQSLAVG  352

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTDETI KL+Q  YKL+D+HEV D+T LPFAERELMLIKVAVN  
Sbjct  353  PAEKEGISRITTVVPGTDETIEKLVQQIYKLIDVHEVHDITHLPFAERELMLIKVAVNTA  412

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRDILDIA IFRAK VDVS HTI LELTG  NK++ALQRLLEPYGICEVARTGR+AL+R
Sbjct  413  ARRDILDIAEIFRAKAVDVSGHTIALELTGDLNKMVALQRLLEPYGICEVARTGRIALIR  472

Query  149  ESGVDSTSLRGYCLPL  102
            ESGV+S  LRGY LP+
Sbjct  473  ESGVNSNYLRGYALPI  488


 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T  + GT++ +++
Sbjct  84   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNTDKAL--FTISVSGTEKVLQQ  141

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++  YKLV++ +V+DL+R P  ERELMLIK++V+   R ++L +  IFRAK VD+S+++
Sbjct  142  VVEQLYKLVNVLKVEDLSREPQVERELMLIKLSVDHHRRPEVLGLVDIFRAKVVDISENS  201

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            IT+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  202  ITIEVTGDPGKIVAVQRSLSKFGIKEIARTGKIALRRE  239



>gb|KDO50434.1| hypothetical protein CISIN_1g047033mg, partial [Citrus sinensis]
Length=514

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D L VNQVLD HWGVL D+D+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAV
Sbjct  318  SDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAV  377

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+P TDE+I KL+Q  YKL+D+HEV+DLT LPFAERELMLIKVAVN 
Sbjct  378  GHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNT  437

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            TARRD+LDIA+IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  438  TARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALV  497

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  498  RESGVDSKYLRGYSFPL  514


 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 115/174 (66%), Gaps = 14/174 (8%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + + ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  94   NRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDK  151

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDIL------------D  309
             ++++++   KLV++ +V+DL+  P  ERELMLIKV  +   R +I              
Sbjct  152  VLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIFLFPCLGVHLQIRW  211

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +  IFRAK VD+S++++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  212  LVDIFRAKIVDISEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  265



>ref|XP_002316167.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
 gb|EEF02338.1| hypothetical protein POPTR_0010s18560g [Populus trichocarpa]
Length=414

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   NQVLDAHWGVLYDEDS+GL+SHTLSMLVN+ PGVLN+LTGVISRRGYNIQSLAVG
Sbjct  219  DDFLANQVLDAHWGVLYDEDSNGLRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAVG  278

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE+EGLSRITTVIPGTDE+I KL+Q  +K +D HEV+D+T  PFAEREL LIK+A N+ 
Sbjct  279  HAEKEGLSRITTVIPGTDESIGKLVQQLHKSIDFHEVRDITHSPFAERELTLIKIAANSA  338

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA IFRAK VD SDHTITLELTG  NK++ALQR+LEPYGICEVARTGRVALVR
Sbjct  339  ARRDVLDIARIFRAKAVDFSDHTITLELTGDLNKMVALQRILEPYGICEVARTGRVALVR  398

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS+ LRG+ LPL
Sbjct  399  ESGVDSSHLRGFPLPL  414


 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            +Q HT+S+ V D  G++N + GV +RRGY+I+SLAVG  + + L   T V+ GT++ +R+
Sbjct  1    MQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEKVLRQ  58

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D++R P  ERELMLIK+  N + R +I+ +  IFRAK VD+S+H+
Sbjct  59   VVEQLNKLVNVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLVDIFRAKIVDISEHS  118

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            +T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE+  ++    G+ 
Sbjct  119  LTIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALKRETMGETAPFWGFS  168



>ref|XP_002529819.1| acetolactate synthase, putative [Ricinus communis]
 gb|EEF32568.1| acetolactate synthase, putative [Ricinus communis]
Length=493

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++D   + QVLDAHWGVL +ED++GL+SHTLSMLVNDSPGVLN++TG+ +RRGYN+QSLA
Sbjct  296  TSDSFMLTQVLDAHWGVLNEEDTTGLRSHTLSMLVNDSPGVLNIVTGIFARRGYNVQSLA  355

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG +E EGLSRITTV+PGTDE+I KL+Q  YKL+D+HEV+DLT LPFAERELMLIK+AVN
Sbjct  356  VGHSETEGLSRITTVVPGTDESISKLVQQLYKLIDLHEVRDLTHLPFAERELMLIKIAVN  415

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  416  AAARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIAL  475

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY  P+
Sbjct  476  VRESGVDSKYLRGYSFPI  493


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 118/175 (67%), Gaps = 9/175 (5%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  86   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVL  143

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL+  P  ERELMLIKV  + + R +I+ +  IFRAK VD+S+
Sbjct  144  QQVVEQLQKLVNVMKVEDLSSEPQVERELMLIKVNADPSYRAEIMWLVGIFRAKIVDISE  203

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            H++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE         G C P 
Sbjct  204  HSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRREK-------MGECAPF  251



>ref|XP_010557052.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=417

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL VN VLDAHWG+L +ED SGL+SHTLS+LVND+PGVLNL+TGV +RRGYNIQSLAVG 
Sbjct  223  DLMVNHVLDAHWGLLNEEDMSGLRSHTLSLLVNDAPGVLNLVTGVFARRGYNIQSLAVGH  282

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG SRITTVIP TDE+I KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVN  A
Sbjct  283  AETEGRSRITTVIPATDESISKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNTVA  342

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALVRE
Sbjct  343  RRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  402

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  403  SGVDSKYLRGYSFPL  417


 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = -1

Query  596  LVNDSPGVL-NLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYK  420
            L N SP +L  L   + +RRGYNI+SLAVG    + L   T V+ GT+  ++++++   K
Sbjct  19   LTNRSPPLLLQLKNQIFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQK  76

Query  419  LVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTG  240
            LV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FR+K VD+S+H +T+E+TG
Sbjct  77   LVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRSKIVDISEHALTIEVTG  136

Query  239  AFNKLLALQRLLEPYGICEVARTGRVALVRE  147
               K+ A++R L  +GI E+ARTG++AL RE
Sbjct  137  DPGKMNAVERNLRKFGIREIARTGKIALRRE  167



>ref|XP_008243055.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Prunus mume]
Length=494

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED+SGL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAV
Sbjct  298  SDTFTVNQVLDAHWGVLNDEDTSGLRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAV  357

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q  YKL DIH+VQDLT LPFAERELMLIK+A NA
Sbjct  358  GHAEVEGLSRITTVVPGTDESISKLVQQLYKLADIHDVQDLTNLPFAERELMLIKIAANA  417

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI +IFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGR+ALV
Sbjct  418  VARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRIALV  477

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  478  RESGVDSKHLRGYSFPL  494


 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ H +S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  87   SKVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVL  144

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+DL+  P  ERELMLIKV  + + R +I  + +IFRAK VD+S+
Sbjct  145  RQVIEQLNKLVNVLKVEDLSNEPQVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISE  204

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQR    +GI EVARTG++AL RE
Sbjct  205  HSVTIEVTGDPGKMVALQRNFSKFGIKEVARTGKIALRRE  244



>ref|XP_007033634.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
 gb|EOY04560.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Theobroma cacao]
Length=478

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   ++QVLDAHWGV+ DED+SG QSHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAVG
Sbjct  283  DGFMIDQVLDAHWGVVNDEDTSGFQSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAVG  342

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA 
Sbjct  343  HAETEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVRDLTYLPFAERELMLIKIAVNAA  402

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA+IFRAK VDVS HTITLELTG  +K++ALQRLLEPYGICEVARTGRVALVR
Sbjct  403  ARRDVLDIANIFRAKAVDVSGHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVR  462

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  P+
Sbjct  463  ESGVDSKYLRGYSFPV  478


 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 118/183 (64%), Gaps = 2/183 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S D    N    A+  V      S ++ HT+S+ V D  G++N + GV +RRGYNI+SLA
Sbjct  48   SVDKKISNNTFSANGPVPSTPTRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLA  107

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG  + + L   T V+ GT+  ++++++   KLV++ +V+DL+  P  ERELMLIKV  +
Sbjct  108  VGLNKDKAL--FTIVVSGTERVLQQVVEQLQKLVNVWKVEDLSNEPQVERELMLIKVNAD  165

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
                 +I  +  IFRA+ VD+S+H++T+E+TG   K++A+QR L  +GI E+ARTG++AL
Sbjct  166  PKFGAEIKWLVDIFRAQIVDISEHSLTIEVTGDPGKMVAVQRNLSKFGIKEIARTGKIAL  225

Query  155  VRE  147
             RE
Sbjct  226  RRE  228



>ref|XP_007201965.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
 gb|EMJ03164.1| hypothetical protein PRUPE_ppa004716mg [Prunus persica]
Length=494

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED+SGL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAV
Sbjct  298  SDTFTVNQVLDAHWGVLNDEDTSGLRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAV  357

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q  YKL DIH+VQDLT LPFAERELMLIK+A NA
Sbjct  358  GHAEVEGLSRITTVVPGTDESISKLVQQLYKLADIHDVQDLTNLPFAERELMLIKIAANA  417

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI +IFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGR+ALV
Sbjct  418  VARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRIALV  477

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  478  RESGVDSKHLRGYSFPL  494


 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ H +S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  87   SKVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVL  144

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+DL+  P  ERELMLIKV  + + R +I  + +IFRAK VD+S+
Sbjct  145  RQVIEQLNKLVNVLKVEDLSNEPQVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDISE  204

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQR    +GI EVARTG++AL RE
Sbjct  205  HSVTIEVTGDPGKMVALQRNFSKFGIKEVARTGKIALRRE  244



>ref|XP_008243054.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Prunus mume]
Length=495

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED+SGL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAV
Sbjct  299  SDTFTVNQVLDAHWGVLNDEDTSGLRSHTLSMLVNDVPGVLYIVTGVFARRGYNIQSLAV  358

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q  YKL DIH+VQDLT LPFAERELMLIK+A NA
Sbjct  359  GHAEVEGLSRITTVVPGTDESISKLVQQLYKLADIHDVQDLTNLPFAERELMLIKIAANA  418

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI +IFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGR+ALV
Sbjct  419  VARRDVLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRIALV  478

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  479  RESGVDSKHLRGYSFPL  495


 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            S+ ++ H +S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  
Sbjct  87   SNRVRRHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETV  144

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+DL+  P  ERELMLIKV  + + R +I  + +IFRAK VD+S
Sbjct  145  LRQVIEQLNKLVNVLKVEDLSNEPQVERELMLIKVNADPSYRAEIKWLVNIFRAKIVDIS  204

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H++T+E+TG   K++ALQR    +GI EVARTG++AL RE
Sbjct  205  EHSVTIEVTGDPGKMVALQRNFSKFGIKEVARTGKIALRRE  245



>ref|XP_011047624.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Populus euphratica]
Length=521

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++DD  +NQ+LDAHWGVL DED++GLQSHTLS+LVND PGVLN++TGV +RRGYNIQSLA
Sbjct  324  ASDDFTLNQILDAHWGVLTDEDTAGLQSHTLSLLVNDHPGVLNIVTGVFARRGYNIQSLA  383

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE+I KL+Q  YKLV+IHEV+DLT +PFAERELMLIK+AVN
Sbjct  384  VGHAETEGLSRITTVVPGTDESITKLVQQLYKLVEIHEVRDLTHVPFAERELMLIKIAVN  443

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRA  VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  444  AAARRDVLDIASIFRANAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRIAL  503

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRGY  P+
Sbjct  504  TRESGVDSKYLRGYSFPV  521


 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S  + HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + +   T V+ GT+  +
Sbjct  114  SKARRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAI--FTIVVSGTERVL  171

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I+ +  IFRAK VD+S+
Sbjct  172  QQVVEQLQKLVNVLKVEDLSNEPQVERELMLVKVNTDPKDRAEIMWLVGIFRAKIVDISE  231

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            HT+T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE
Sbjct  232  HTVTIEVTGDPGKIAAVQRNLSKFGIREIARTGKIALRRE  271



>ref|XP_004139096.1| PREDICTED: uncharacterized protein LOC101208212 [Cucumis sativus]
Length=480

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            +QVLDAHWGVLYDEDSSG QSHTLSMLVND PGVLN++TG+ISRRGYNIQSLAVG AERE
Sbjct  290  DQVLDAHWGVLYDEDSSGHQSHTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAERE  349

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            GLSRITTVIPGTDE+I KL+Q  +KL+D+HEV+DLT LPFAERELMLIK+A NATARRD+
Sbjct  350  GLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHLPFAERELMLIKIAANATARRDV  409

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IFRAK VDVS HTITL+LTG  NK++ALQRLLEP+GICEVARTGRVAL RESGVD
Sbjct  410  LDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLEPFGICEVARTGRVALERESGVD  469

Query  134  STSLRGYCLPL  102
            S  LRGY LP+
Sbjct  470  SAYLRGYPLPI  480


 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 117/175 (67%), Gaps = 9/175 (5%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S +  HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  74   STVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVTGTENVL  131

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D++R P  EREL+L+K+  +++ R +I+ +  IFR K VD+S+
Sbjct  132  RQVVEQLNKLVNVIKVEDISRQPQVERELVLMKLNADSSTRAEIMWLVDIFRGKIVDISE  191

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            H++T+E+TG   KL+A++R    +GI E+ARTG++AL RE        RG   P 
Sbjct  192  HSVTIEVTGDPGKLVAVERNFSKFGIRELARTGKIALRREK-------RGETAPF  239



>ref|XP_009406425.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=487

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            +   VNQVLDAHWG+L DED SGL SHTLS+LVND PGVLNL+TGV +RRGYNIQSLAVG
Sbjct  292  EGFLVNQVLDAHWGILDDEDPSGLCSHTLSILVNDFPGVLNLVTGVFARRGYNIQSLAVG  351

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTD +I KL+Q  YKL+D+HEVQD+T LPFAERELMLIKVAVN T
Sbjct  352  PAEKEGISRITTVVPGTDGSIGKLVQQLYKLIDVHEVQDITHLPFAERELMLIKVAVNTT  411

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRDILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVR
Sbjct  412  ARRDILDIADIFRAKAVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVR  471

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY LP 
Sbjct  472  ESGVDSKYLRGYSLPF  487


 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  81   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTNKVLQQ  138

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL+R P  ERELMLIK+ V+   R +++ +  +FRAK VD+S+H+
Sbjct  139  VMEQLNKLVNVLKVEDLSREPQVERELMLIKLNVDPDKRPEVMGLVDVFRAKVVDISEHS  198

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE 
Sbjct  199  LTIEVTGDPGKMVAVQRNLSKFGINEIARTGKIALRREK  237



>ref|XP_009782832.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=483

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++D+  V+QVLDAHWGVL DED+SGL+SHTLSMLVND+PGVLN++TGV +RRGYNIQSLA
Sbjct  286  TDDNSGVSQVLDAHWGVLNDEDTSGLRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLA  345

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE++ KL+Q  YKLVDIHEV+D+T  PFAERELMLIK+AVN
Sbjct  346  VGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHHPFAERELMLIKIAVN  405

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  406  AAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRLAL  465

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY  PL
Sbjct  466  VRESGVDSKYLRGYSYPL  483


 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+ + V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  ++++++
Sbjct  81   HTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVME  138

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV++ +V+DL++ P  ERELMLIK++ +   R +++ +  +FRAK VD+SDH++T+
Sbjct  139  QLQKLVNVIKVEDLSKDPQVERELMLIKISADPKYRTEVMWLVDVFRAKIVDISDHSLTI  198

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  199  EVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  233



>ref|XP_009366239.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Pyrus x bretschneideri]
Length=489

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED++GL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAV
Sbjct  293  SDTFTVNQVLDAHWGVLNDEDTNGLRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAV  352

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q  YKLVDIH+VQDLT LPFAERELMLIK+A NA
Sbjct  353  GHAEAEGLSRITTVVPGTDESISKLVQQLYKLVDIHDVQDLTNLPFAERELMLIKIAANA  412

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI +IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  413  AARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  472

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  473  RESGVDSKYLRGYSFPL  489


 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  82   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R +++   KLV++ +V+DL+  P  ERELMLIKV  + +   +I  + SIFRAK VD+S+
Sbjct  140  RLVIEQLNKLVNVMKVEDLSIEPQVERELMLIKVNADPSYHAEIKWLVSIFRAKIVDISE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQR    +GI EVARTG++AL RE
Sbjct  200  HSVTIEVTGDPGKMVALQRNFSKFGIREVARTGKIALRRE  239



>ref|XP_010557051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=489

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL VN VLDAHWG+L +ED SGL+SHTLS+LVND+PGVLNL+TGV +RRGYNIQSLAVG 
Sbjct  295  DLMVNHVLDAHWGLLNEEDMSGLRSHTLSLLVNDAPGVLNLVTGVFARRGYNIQSLAVGH  354

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG SRITTVIP TDE+I KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVN  A
Sbjct  355  AETEGRSRITTVIPATDESISKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNTVA  414

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALVRE
Sbjct  415  RRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRVALVRE  474

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  475  SGVDSKYLRGYSFPL  489


 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 110/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ H +S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  82   SKVKKHAISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FR+K VD+S+
Sbjct  140  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRSKIVDISE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K+ A++R L  +GI E+ARTG++AL RE
Sbjct  200  HALTIEVTGDPGKMNAVERNLRKFGIREIARTGKIALRRE  239



>gb|EPS72034.1| hypothetical protein M569_02723, partial [Genlisea aurea]
Length=408

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++D    NQVLDAHWG+L D+D+SGL+SHTLSMLVND+PGVLNL+TGV +RRGYNIQSLA
Sbjct  208  ADDTTSFNQVLDAHWGMLIDDDTSGLRSHTLSMLVNDAPGVLNLITGVFARRGYNIQSLA  267

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE +GLSRITTV+PGTDE+I KLL+   KL+D+H V+DLT LPFAERELMLIKVAVN
Sbjct  268  VGHAETDGLSRITTVVPGTDESIAKLLKQLNKLIDLHAVEDLTHLPFAERELMLIKVAVN  327

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAK VDVSDHTITLELTG F+K++ALQRLLEPYGICEVARTGRVAL
Sbjct  328  AAARRDVLDIASIFRAKAVDVSDHTITLELTGDFDKMVALQRLLEPYGICEVARTGRVAL  387

Query  155  VRESGVDSTSLRGYCLPL  102
            +RESGVDS  LRGY  PL
Sbjct  388  LRESGVDSRYLRGYSYPL  405


 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 111/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +  
Sbjct  1    VKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLHH  58

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D++R P  ERELMLIK+  +   R +++ +  IFRAK VD++D +
Sbjct  59   VMEQLKKLVNVLKVEDISREPQVERELMLIKINADPAYRAEVMWLVDIFRAKIVDIADMS  118

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A+QR L  +G+ E+ARTG++AL RE 
Sbjct  119  LTIEVTGDPGKMVAVQRNLSKFGVREIARTGKIALRREK  157



>gb|KDP35124.1| hypothetical protein JCGZ_10658 [Jatropha curcas]
Length=483

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +DD  V QVLDAHWGVL ++D++GL+SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAV
Sbjct  287  SDDFKVAQVLDAHWGVLNEDDTTGLRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAV  346

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EG+SRITTV+PGTDE+I KL+Q  YKLV++HEVQDLT LPFAERELMLIK+AVNA
Sbjct  347  GHSETEGISRITTVVPGTDESISKLVQQLYKLVELHEVQDLTHLPFAERELMLIKIAVNA  406

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRA+ VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  407  AARRDVLDIASIFRARAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  466

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  P+
Sbjct  467  RESGVDSKHLRGYAFPI  483


 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  78   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVLQQ  135

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL+  P  ERELMLIKV  +   R +I  +  IFRAK VD+S+H+
Sbjct  136  VVEQLQKLVNVLKVEDLSSEPQVERELMLIKVNADPNYRAEIKWLVEIFRAKIVDISEHS  195

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L+ +GI E+ARTG++AL RE
Sbjct  196  VTIEVTGDPGKMVAVQRNLKKFGIREIARTGKIALRRE  233



>ref|XP_010109954.1| hypothetical protein L484_011796 [Morus notabilis]
 gb|EXC24930.1| hypothetical protein L484_011796 [Morus notabilis]
Length=512

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 181/208 (87%), Gaps = 12/208 (6%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DDL +NQVLDAHWGVLYDEDS+GL+SHTLSMLVND PGVLN++TGVISRRGYNIQSL VG
Sbjct  303  DDLSMNQVLDAHWGVLYDEDSTGLRSHTLSMLVNDYPGVLNIVTGVISRRGYNIQSLTVG  362

Query  509  PAEREGLSRITTVIPGTDETIRKLLQ---HFYK---------LVDIHEVQDLTRLPFAER  366
             AE EGLSRITTVIPGTDE+I KL+Q   +F K         L+D+HEV+D+T LPFAER
Sbjct  363  HAEVEGLSRITTVIPGTDESIGKLVQEVLNFLKAAQVQQLPGLIDLHEVRDITHLPFAER  422

Query  365  ELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGIC  186
            ELMLIK+AVN  ARRD+LDIA+IFRAK VDVSDHTITLELTG  NK++ALQ+LLEPYGIC
Sbjct  423  ELMLIKIAVNTAARRDVLDIATIFRAKAVDVSDHTITLELTGDLNKMVALQKLLEPYGIC  482

Query  185  EVARTGRVALVRESGVDSTSLRGYCLPL  102
            EVARTGRVALVRESGVDST LRGY LPL
Sbjct  483  EVARTGRVALVRESGVDSTYLRGYSLPL  510


 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 113/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S +Q HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  92   SKVQRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVL  149

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D++R P  ERELMLIK+  +   R +I+ +  IFR + VD+S+
Sbjct  150  RQVVEQLNKLVNVIKVEDISREPQVERELMLIKLNADPNTRAEIMWLVDIFRGRIVDISE  209

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
             T+T+E+TG   K++A+ R L  +GI E+ARTG++AL RE
Sbjct  210  STLTIEVTGDPGKMVAVLRNLMKFGIKEIARTGKIALRRE  249



>ref|XP_008383971.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED++GL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAV
Sbjct  293  SDTFTVNQVLDAHWGVLDDEDTNGLRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAV  352

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q  YKLVD+H+VQDLT LPFAERELMLIK+A NA
Sbjct  353  GXAEAEGLSRITTVVPGTDESISKLVQQLYKLVDVHDVQDLTNLPFAERELMLIKIAANA  412

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI +IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  413  VARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  472

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  473  RESGVDSKYLRGYSFPL  489


 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  82   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R +++   KLV++ +V+DL+  P  ERELMLIKV  + +   +I  +  IFRAK VD+S+
Sbjct  140  RLVIEQLNKLVNVMKVEDLSIEPQVERELMLIKVNADPSYHAEIKWLVXIFRAKIVDISE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQR L  +GI E+ARTG++AL RE
Sbjct  200  HSVTIEVTGDPGKMVALQRNLSKFGIREIARTGKIALRRE  239



>ref|XP_008354318.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=489

 Score =   323 bits (829),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/197 (79%), Positives = 174/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL DED++GL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAV
Sbjct  293  SDTFTVNQVLDAHWGVLDDEDTNGLRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAV  352

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+PGTDE+I KL+Q  YKLVD+H+VQDLT LPFAERELMLIK+A NA
Sbjct  353  GHAEAEGLSRITTVVPGTDESISKLVQQLYKLVDVHDVQDLTNLPFAERELMLIKIAANA  412

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI +IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  413  VARRDVLDIGNIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  472

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  473  RESGVDSKYLRGYSFPL  489


 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  82   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTETVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R +++   KLV++ +V+DL+  P  ERELMLIKV  + +   +I  +  IFRAK VD+S+
Sbjct  140  RLVIEQLNKLVNVMKVEDLSIEPQVERELMLIKVNADPSYHAEIKWLVXIFRAKIVDISE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQR L  +GI E+ARTG++AL RE
Sbjct  200  HSVTIEVTGDPGKMVALQRNLSKFGIREIARTGKIALRRE  239



>gb|EYU36664.1| hypothetical protein MIMGU_mgv1a005401mg [Erythranthe guttata]
Length=485

 Score =   322 bits (826),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D++  NQVLDAHWGVL +ED+SGL+SHTLSMLVND+PGVLNL+TGV +RRGYNIQSLAVG
Sbjct  290  DEISFNQVLDAHWGVLNEEDTSGLRSHTLSMLVNDAPGVLNLVTGVFARRGYNIQSLAVG  349

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE EGLSRITTV+PGTDE+I KLLQ   KL D+HEV+D T LPFAERELMLIK+AVNA 
Sbjct  350  HAEIEGLSRITTVVPGTDESISKLLQQLRKLNDLHEVRDFTHLPFAERELMLIKIAVNAA  409

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALVR
Sbjct  410  ARRNVLDIASIFRAKAVDVSDHTITLELTGDLDKMIALQRLLEPYGICEVARTGRVALVR  469

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  470  ESGVDSRYLRGYSYPL  485


 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ I++
Sbjct  81   VKRHTVSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVIQQ  138

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D+++ P  ERELMLIK+  +   R +++ +  IFRA+ VD SDH+
Sbjct  139  VMEQLKKLVNVLKVEDISKEPQVERELMLIKINADPQHRAEVMWLMDIFRAQIVDTSDHS  198

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  199  LTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  236



>gb|KHN48087.1| Acetolactate synthase small subunit [Glycine soja]
Length=471

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   VNQVLDAHWGVL +ED+SG++SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAVG
Sbjct  276  DGFTVNQVLDAHWGVLNEEDTSGIRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVG  335

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE EGLSR+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T LPFAERELMLIK+AVNA 
Sbjct  336  HAEVEGLSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNAA  395

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVS HTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  396  ARRDVLDIASIFRAKAVDVSGHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  455

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  456  ESGVDSKYLRGYSYPL  471


 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 110/161 (68%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            S  ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E   L   T V+ GTD+ 
Sbjct  63   SKQVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKV  120

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+DL+R P  ERELMLIKV  +     ++  +  IFRAK VD+S
Sbjct  121  LRQVMEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDIS  180

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
             H++T+E+TG   K+ A+QR    +GI E+ARTG++AL RE
Sbjct  181  QHSVTIEVTGDPGKMAAVQRNFSKFGIKEIARTGKIALRRE  221



>ref|XP_008443657.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Cucumis melo]
Length=480

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  671  QVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREG  492
            QVLDAHWGVLYDEDSSG QSHTLSMLVND PGVLN++TG+ISRRGYNIQSLAVG AER+G
Sbjct  291  QVLDAHWGVLYDEDSSGHQSHTLSMLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAERQG  350

Query  491  LSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDIL  312
            LSRITTVIPGTDE+I KL+Q  +KL+D+HEV+DLT LPFAERELMLIK+A NA ARRD+L
Sbjct  351  LSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHLPFAERELMLIKIAANAAARRDVL  410

Query  311  DIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDS  132
            DIA IFRAK VDVS HTITL+LTG  NK++ALQRLLEP+GICEVARTGRVAL RESGVDS
Sbjct  411  DIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLEPFGICEVARTGRVALERESGVDS  470

Query  131  TSLRGYCLPL  102
              LRGY LP+
Sbjct  471  AYLRGYPLPI  480


 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S +  HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  +
Sbjct  74   STVMRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVTGTENVL  131

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D++R P  EREL+L+K+  +++ R +I+ +  IFR K VD+S+
Sbjct  132  RQVVEQLNKLVNVIKVEDISRQPQVERELVLMKLNADSSTRAEIMWLVDIFRGKIVDISE  191

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   KL+A++R    +GI E+ARTG++AL RE
Sbjct  192  HSVTIEVTGDPGKLVAVERNFSKFGIRELARTGKIALRRE  231



>ref|XP_003532793.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Glycine max]
Length=474

 Score =   321 bits (822),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   VNQVLDAHWGVL +ED+SG++SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAVG
Sbjct  279  DGFTVNQVLDAHWGVLNEEDTSGIRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAVG  338

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE EGLSR+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T LPFAERELMLIK+AVNA 
Sbjct  339  HAEVEGLSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNAA  398

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVS HTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  399  ARRDVLDIASIFRAKAVDVSGHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  458

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  459  ESGVDSKYLRGYSYPL  474


 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 112/172 (65%), Gaps = 2/172 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E   L   T V+ GTD+ +
Sbjct  67   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVL  124

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+DL+R P  ERELMLIKV  +     ++  +  IFRAK VD+S 
Sbjct  125  RQVMEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISQ  184

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            H++T+E+TG   K+ A+QR    +GI E+ARTG++AL RE    S     Y 
Sbjct  185  HSVTIEVTGDPGKMAAVQRNFSKFGIKEIARTGKIALRREKMGASAPFWRYS  236



>emb|CDY15367.1| BnaC04g42560D [Brassica napus]
Length=487

 Score =   321 bits (823),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V++VLDAHWG+L +ED+SGL+SHTLS+LVND PGVLNL+TGV SRRGYNIQSLAVG 
Sbjct  291  DLMVHRVLDAHWGLLTEEDTSGLRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQSLAVGH  350

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV DLT +PFAERELMLIK+AVNA A
Sbjct  351  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHMPFAERELMLIKIAVNAAA  410

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  411  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  470

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  471  SGVDSKYLRGYSFPL  485


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  78   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVL  135

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R  I+ +   FRA+ VD+++
Sbjct  136  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAE  195

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  196  HALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  235



>ref|XP_010673855.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=477

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D+  VNQVLDAHWGVL+D DSSGL+SHTLSMLVN+  GVLN +TGVISRRGYNIQSLAVG
Sbjct  280  DNPMVNQVLDAHWGVLHDGDSSGLRSHTLSMLVNNVSGVLNTVTGVISRRGYNIQSLAVG  339

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PG DE+I KL+Q   KLVD+HE+QDLT LPFAERELMLIKVA N +
Sbjct  340  PAEKEGLSRITTVVPGNDESIGKLVQQLSKLVDLHEIQDLTHLPFAERELMLIKVAANTS  399

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIA+IFRAK VDVSDHTITL+L+G  +K++ALQRLLEPYGICEVARTGRVAL R
Sbjct  400  ARRDVLDIANIFRAKAVDVSDHTITLQLSGDLDKMVALQRLLEPYGICEVARTGRVALTR  459

Query  149  ESGVDSTSLRGYCLPL  102
            ES VDS  LRGY LPL
Sbjct  460  ESRVDSALLRGYALPL  475


 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+S+ V D  G++N + GVISRRGYNI+SLAVG  + + L   T V+ GTD+ +R++++
Sbjct  74   HTISVFVGDESGIINRIAGVISRRGYNIESLAVGLNKDKAL--FTIVVCGTDKVLRQVME  131

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV + +V+DL+R P  ERELML+K+  +A    +I  +  IFRAK VDVSD  +T+
Sbjct  132  QLNKLVSVLKVEDLSREPQVERELMLVKLNADANTHTEIKWLVEIFRAKIVDVSDSLVTV  191

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K+ A+ R    +GI EVARTG++AL RE
Sbjct  192  EVTGDPGKMAAVLRNFSKFGIKEVARTGKIALRRE  226



>gb|AFK41430.1| unknown [Lotus japonicus]
Length=478

 Score =   321 bits (822),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   V QVLDAHWGVL DED+SG++SHTLSMLVND PGVLN++TGV SRRGYNIQSLAVG
Sbjct  283  DSFTVTQVLDAHWGVLNDEDTSGIRSHTLSMLVNDVPGVLNVVTGVFSRRGYNIQSLAVG  342

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             +E EG+SR+TTV+PGTDE+I KLLQ  YKL+D HEV+DLT +PFAERELMLIK+AVNA 
Sbjct  343  HSEVEGISRLTTVVPGTDESIGKLLQQLYKLIDQHEVRDLTHMPFAERELMLIKIAVNAA  402

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDI SIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  403  ARRDVLDIGSIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  462

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  463  ESGVDSKYLRGYSFPL  478


 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 106/155 (68%), Gaps = 2/155 (1%)
 Frame = -1

Query  608  TLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQH  429
            T+S+ V D  G++N + GV +RRG+NI+SLAVG  E + L   T V+ GT   +R++++ 
Sbjct  77   TISVFVGDESGMINRIAGVFARRGFNIESLAVGLNEDKAL--FTIVVSGTGTVLRQVVEQ  134

Query  428  FYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLE  249
              KL ++ +V+DL+  P  ERELMLIKV      R ++  +  IFRAK VD+S+H++T+E
Sbjct  135  LQKLANVLKVEDLSNEPQVERELMLIKVHAEPQNRAELKWLVDIFRAKIVDISEHSVTIE  194

Query  248  LTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +TG   KL+A+QR L  +GI E+ARTG++AL RE 
Sbjct  195  VTGDPGKLVAVQRNLSKFGIKEIARTGKIALRREK  229



>gb|EEC73569.1| hypothetical protein OsI_08011 [Oryza sativa Indica Group]
Length=554

 Score =   323 bits (828),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            +NQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVGPAE+
Sbjct  363  MNQVLDAHWGVLDDEDSSGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGPAEK  422

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
             GLSRITTV PGTDE+I KL+Q  YKLVD+HEVQD+T LPFAERELMLIKV+VN  ARRD
Sbjct  423  SGLSRITTVAPGTDESIEKLVQQLYKLVDVHEVQDITHLPFAERELMLIKVSVNTAARRD  482

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRESGV
Sbjct  483  ILDIAEIFRAKSVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESGV  542

Query  137  DSTSLRGYCLPL  102
            DS  LRGY   L
Sbjct  543  DSKYLRGYSFSL  554


 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  + + +   T V+ GTD  + ++++   KLV++  V+
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKAM--FTIVVSGTDRVLNQVIEQLNKLVNVLNVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S++T+T+E+TG   K++A+
Sbjct  59   DLSKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAV  118

Query  215  QRLLEPYGICEVARTGRVALVRE  147
            QR L  +GI E+ RTG++AL RE
Sbjct  119  QRNLSKFGIKEICRTGKIALRRE  141


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = -1

Query  473  VIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIF  294
            V P    ++ ++L   + ++D  +V+DL++ P  ERELMLIK+ V    R +++ +  IF
Sbjct  194  VEPYEGSSMNQVLDAHWGVLDDEDVEDLSKEPQVERELMLIKINVEPDQRPEVMVLVDIF  253

Query  293  RAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RAK VD+S++T+T+E+TG   K++A+QR L  +GI E+ RTG++AL RE
Sbjct  254  RAKVVDISENTLTIEVTGDPGKIVAVQRNLSKFGIKEICRTGKIALRRE  302



>ref|XP_004504413.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=424

 Score =   318 bits (816),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL +ED+SG++SHTLSMLVND+PGVLN +TGV +RRGYNIQSLAV
Sbjct  228  SDSFTVNQVLDAHWGVLNEEDTSGIRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAV  287

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EG+SR+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T +PFAERELMLIK+AVNA
Sbjct  288  GHSEVEGVSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNA  347

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRA+ VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  348  AARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  407

Query  152  RESGVDSTSLRGYCLPL  102
            R+SGVDS  LRGY  PL
Sbjct  408  RDSGVDSRYLRGYSFPL  424


 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 86/131 (66%), Gaps = 2/131 (2%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L  I  V+ GT+  +
Sbjct  68   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRALFSI--VVSGTNRVL  125

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I  +   FR K VD+S+
Sbjct  126  QQVVEQLQKLVNVLKVEDLSNEPQVERELMLLKVHADPQNRAEIKWLVDTFRGKIVDISE  185

Query  266  HTITLELTGAF  234
            +++T+E+   F
Sbjct  186  NSVTIEVILEF  196



>ref|XP_011085048.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Sesamum indicum]
Length=476

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            + D+ VNQVLDAHWGVL DED++GL+SHTL ++VND+PGVLNL+TGV +RRGYNIQSLAV
Sbjct  280  SSDISVNQVLDAHWGVLNDEDTTGLRSHTLFLVVNDAPGVLNLVTGVFARRGYNIQSLAV  339

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG SRITTV+PGTDE+IRKL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA
Sbjct  340  GHAEVEGHSRITTVVPGTDESIRKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNA  399

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARR++LDIASIFRAK VDVS HTITLELTG  +K++ALQRLLEPYGICEVARTGR+AL+
Sbjct  400  AARRNVLDIASIFRAKAVDVSGHTITLELTGDLDKMVALQRLLEPYGICEVARTGRLALI  459

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  460  RESGVDSRYLRGYSYPL  476


 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +++
Sbjct  72   VKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVLQQ  129

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D+++ P  ERELMLIK+  +   R +++ +  IFRAK VD+SDH+
Sbjct  130  VMEQLQKLVNVLKVEDISKEPQVERELMLIKINADPKYRAEVMWLVDIFRAKIVDISDHS  189

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  190  LTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  227



>ref|XP_007159564.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
 gb|ESW31558.1| hypothetical protein PHAVU_002G248000g [Phaseolus vulgaris]
Length=473

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            ++   VNQVLDAHWGVL D++ +G++SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAV
Sbjct  277  SEGFTVNQVLDAHWGVLIDDEVTGIRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAV  336

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSR+TTV+PGTDETI KL+Q  YKLV++HEV+D+T LPFAERELMLIK+AVNA
Sbjct  337  GHAEVEGLSRLTTVVPGTDETISKLVQQLYKLVELHEVRDITHLPFAERELMLIKIAVNA  396

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRA+ VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+AL+
Sbjct  397  AARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALI  456

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  P+
Sbjct  457  RESGVDSKYLRGYAYPV  473


 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E   L   T V+ GTD+ +
Sbjct  66   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDRAL--FTIVVSGTDKVL  123

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
             ++++   KLV++ +V+DL+R P  ERELMLIKV  +     ++  +  IFRAK VD+S+
Sbjct  124  LQVMEQLQKLVNVLKVEDLSREPQVERELMLIKVHADPKHHAELKWLVDIFRAKIVDISE  183

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            H++T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE 
Sbjct  184  HSVTIEVTGDPGKMAAVQRNLSKFGIKEIARTGKIALRREK  224



>ref|XP_009132818.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=480

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 174/198 (88%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S  DL V +VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL+TGV +RRGYNIQSLA
Sbjct  281  STSDLKVQRVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLA  340

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE +G+SRITTV+P TDE++ KL+Q  YKLVD+HEV DLT LPF+ERELMLIK+AVN
Sbjct  341  VGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVN  400

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL
Sbjct  401  AAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVAL  460

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRGY  PL
Sbjct  461  ARESGVDSKYLRGYSFPL  478


 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  70   TSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERV  127

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +   R +I+ +   FRAK VD++
Sbjct  128  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPEYRAEIMWLVDTFRAKVVDIA  187

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  188  EHALTIEVTGDPGKMIAVERNLKKFEIREIVRTGKIALRRE  228



>ref|XP_009141188.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brassica rapa]
Length=487

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V++VLDAHWG+L +ED+SGL+SHTLS+LVND PGVLNL+TGV +RRGYNIQSLAVG 
Sbjct  291  DLMVHRVLDAHWGLLTEEDTSGLRSHTLSLLVNDVPGVLNLITGVFARRGYNIQSLAVGH  350

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKL+D+HEV DLT +PFAERELMLIK+AVNA A
Sbjct  351  AETEGISRITTVVPATDESVSKLVQQLYKLIDVHEVHDLTHMPFAERELMLIKIAVNAAA  410

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  411  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  470

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  471  SGVDSKYLRGYSFPL  485


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  78   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVL  135

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R  I+ +   FRA+ VD+++
Sbjct  136  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAE  195

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  196  HALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  235



>ref|XP_008394266.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=492

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   V QVLDAHWGVL DED++GL+SHTLSMLVND PGVL +LTGV +RRGYNIQSLAV
Sbjct  296  SDTFTVKQVLDAHWGVLNDEDTNGLRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAV  355

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG SRITTV+PGTDE+I KL+Q  YKLVDIH VQDLT LPFAERELMLIK+A +A
Sbjct  356  GHAEVEGQSRITTVVPGTDESISKLVQQLYKLVDIHNVQDLTNLPFAERELMLIKIAXDA  415

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI  IFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGR+ALV
Sbjct  416  VARRDVLDIGKIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRIALV  475

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY LPL
Sbjct  476  RESGVDSKHLRGYSLPL  492


 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  85   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVL  142

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D++  P  EREL+LIKV  +     +I  + SIFRAK VD+S+
Sbjct  143  RQVIEQLNKLVNVXKVEDISNEPQVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISE  202

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQ  L  +GI EVARTG++AL RE
Sbjct  203  HSVTIEVTGDPGKMVALQXNLSKFGIREVARTGKIALRRE  242



>ref|XP_004159602.1| PREDICTED: uncharacterized LOC101212902 [Cucumis sativus]
Length=412

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +DD  +  VLDAHWGVL DED  GL+SHTLSMLVNDSPGVL ++TG+ +RRGYNIQSLAV
Sbjct  216  SDDFTIKPVLDAHWGVLNDEDVDGLRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAV  275

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG+SRITTV+PGTDE+I KL+QH Y+L D+HEV+DLT +PF+ERELMLIK+A N 
Sbjct  276  GHAEAEGISRITTVVPGTDESIYKLVQHLYRLADVHEVRDLTHIPFSERELMLIKIAANP  335

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRD+LDIA IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  336  SARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALV  395

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  396  RESGVDSKYLRGYSFPL  412


 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = -1

Query  623  GLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIR  444
            G++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L  +T V+ GT++ + 
Sbjct  82   GVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--LTIVVSGTEKVLE  139

Query  443  KLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDH  264
            ++++  +KLV++ +V+DL+ +   ERELMLIK+    T R +I  +  +FRAK VD+SD 
Sbjct  140  QVIEQLHKLVNVLKVEDLSSVQQVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDD  199

Query  263  TITLE  249
            ++T+E
Sbjct  200  SVTIE  204



>ref|XP_008367825.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=492

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/197 (79%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   V QVLDAHWGVL DED++GL+SHTLSMLVND PGVL +LTGV +RRGYNIQSLAV
Sbjct  296  SDTFTVKQVLDAHWGVLNDEDTNGLRSHTLSMLVNDVPGVLYILTGVFARRGYNIQSLAV  355

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG SRITTV+PGTDE+I KL+Q  YKLVDIH VQDLT LPFAERELMLIK+A +A
Sbjct  356  GHAEVEGQSRITTVVPGTDESISKLVQQLYKLVDIHNVQDLTNLPFAERELMLIKIAXDA  415

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDI  IFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGR+ALV
Sbjct  416  VARRDVLDIGKIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRIALV  475

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY LPL
Sbjct  476  RESGVDSKHLRGYSLPL  492


 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 112/160 (70%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  85   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVL  142

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV++ +V+D++  P  EREL+LIKV  +     +I  + SIFRAK VD+S+
Sbjct  143  RQVIEQLNKLVNVIKVEDISNEPQVERELVLIKVNSDPRYHAEIKWLVSIFRAKIVDISE  202

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H++T+E+TG   K++ALQR L  +GI EVARTG++AL RE
Sbjct  203  HSVTIEVTGDPGKMVALQRNLSKFGIREVARTGKIALRRE  242



>ref|XP_004490063.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=475

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 177/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL +ED+SG++SHTLSMLVND+PGVLN +TGV +RRGYNIQSLAV
Sbjct  279  SDSFTVNQVLDAHWGVLNEEDTSGIRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAV  338

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EG+SR+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T +PFAERELMLIK+AVNA
Sbjct  339  GHSEVEGVSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNA  398

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRA+ VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  399  AARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  458

Query  152  RESGVDSTSLRGYCLPL  102
            R+SGVDS  LRGY  PL
Sbjct  459  RDSGVDSRYLRGYSFPL  475


 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = -1

Query  650  GVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTV  471
            G +     S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L  I  V
Sbjct  60   GPVTSPSRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRALFSI--V  117

Query  470  IPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFR  291
            + GT+  ++++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I  +   FR
Sbjct  118  VSGTNRVLQQVVEQLQKLVNVLKVEDLSNEPQVERELMLLKVNADPQNRAEIKWLVDTFR  177

Query  290  AKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
             K VD+S++++T+E+TG   K++A+QR L  +GI E++RTG++AL RE
Sbjct  178  GKIVDISENSVTIEVTGDPGKMVAVQRSLSKFGIKEISRTGKIALRRE  225



>emb|CAX48742.1| acetohydroxyacid synthase regulatory subunit 1 precursor [Eupatorium 
cannabinum]
Length=475

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S DD   NQVLDAHWGVL +ED++GL+SHTLS++VNDSPGVLN++TGV +RRGYNIQSLA
Sbjct  278  SRDDYSFNQVLDAHWGVLNEEDTTGLRSHTLSIVVNDSPGVLNIVTGVFTRRGYNIQSLA  337

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EG SRITTV+PGTDE+IRKL+Q  YKL+D+HEV DLT +PFAERELMLIKVAVN
Sbjct  338  VGHAEVEGRSRITTVVPGTDESIRKLVQQLYKLIDVHEVIDLTLMPFAERELMLIKVAVN  397

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            + ARR++LDIASIFRAK VDVSDHTITLE+TG  NK++ALQRLLEP GICEVARTGRVAL
Sbjct  398  SMARRNVLDIASIFRAKAVDVSDHTITLEVTGDVNKMVALQRLLEPCGICEVARTGRVAL  457

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS+ LRGY  P+
Sbjct  458  TRESGVDSSYLRGYSYPV  475


 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  + +
Sbjct  71   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLEQ  128

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D+++ P  ERELMLIK+  +   R ++  +  IFRAK VD+SDH+
Sbjct  129  VMKQLLKLVNVLKVEDISKEPQVERELMLIKINADPRYRLEVKWLVDIFRAKIVDISDHS  188

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            IT+E+TG   K++A+QR L  +GI EVARTG++AL RE
Sbjct  189  ITIEVTGDPGKMVAVQRNLSKFGIQEVARTGKIALRRE  226



>ref|XP_003629945.1| Acetolactate synthase small subunit [Medicago truncatula]
 gb|AET04421.1| acetolactate synthase, small subunit [Medicago truncatula]
Length=478

 Score =   318 bits (814),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDA WG L DED+SG++SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAV
Sbjct  282  SDSFTVNQVLDAQWGFLNDEDTSGIRSHTLSMLVNDAPGVLNIVTGVFARRGYNIQSLAV  341

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EG+SR+TTV+PGTDE+I KL+Q  YKLV++ EV+D+T LPFAERELMLIK+AVNA
Sbjct  342  GHSEVEGISRLTTVVPGTDESISKLVQQLYKLVELREVRDITHLPFAERELMLIKIAVNA  401

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ LV
Sbjct  402  AARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIGLV  461

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY LPL
Sbjct  462  RESGVDSKHLRGYSLPL  478


 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L   T V+ GTD  +R+
Sbjct  73   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRAL--FTIVVSGTDRVLRQ  130

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL+R P  ERELML+KV  +   R +I  +   FRAK VD+S+H+
Sbjct  131  VVEQLQKLVNVLKVEDLSREPQVERELMLVKVHADPQNRAEIKWLVDTFRAKIVDISEHS  190

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR    +GI E+ARTG++AL RE
Sbjct  191  VTIEVTGDPGKMVAVQRNFGKFGIKEIARTGKIALRRE  228



>ref|XP_006410309.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
 gb|ESQ51762.1| hypothetical protein EUTSA_v10016569mg [Eutrema salsugineum]
Length=491

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V++VLDAHWG+L DED++GL+SHTLS+LVND+PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  295  DLMVHRVLDAHWGLLTDEDTTGLRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGH  354

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV DLT LPFAERELMLIK+AVNA A
Sbjct  355  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFAERELMLIKIAVNAAA  414

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRA  VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  415  RRDVLDIASIFRAIAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  474

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  475  SGVDSKYLRGYSFPL  489


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 110/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  82   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRA+ VD+++
Sbjct  140  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRPEIMWLVDTFRARIVDIAE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  200  HALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  239



>gb|KGN49589.1| hypothetical protein Csa_5G013280 [Cucumis sativus]
Length=436

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +DD  +  VLDAHWGVL DED  GL+SHTLSMLVNDSPGVL ++TG+ +RRGYNIQSLAV
Sbjct  240  SDDFTIKPVLDAHWGVLNDEDVDGLRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAV  299

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG+SRITTV+PGTDE+I KL+QH Y+L D+HEV+DLT +PF+ERELMLIK+A N 
Sbjct  300  GHAEAEGISRITTVVPGTDESIYKLVQHLYRLADVHEVRDLTHIPFSERELMLIKIAANP  359

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRD+LDIA IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  360  SARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALV  419

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  420  RESGVDSKYLRGYSFPL  436


 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L  +T V+ GT++ + +
Sbjct  30   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--LTIVVSGTEKVLEQ  87

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++  +KLV++ +V+DL+ +   ERELMLIK+    T R +I  +  +FRAK VD+SD +
Sbjct  88   VIEQLHKLVNVLKVEDLSSVQQVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDDS  147

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A QR L  +GI E+ARTG++AL RE 
Sbjct  148  VTIEVTGDPGKMVAFQRNLSKFGIREIARTGKIALRREK  186



>ref|XP_006858758.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
 gb|ERN20225.1| hypothetical protein AMTR_s00066p00141740 [Amborella trichopoda]
Length=496

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 175/195 (90%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D+++NQVLDAHWG+L DEDSSGL+SHTLS+LVND PGVLN++TG  SRRGYNIQSLAVGP
Sbjct  302  DVWMNQVLDAHWGILDDEDSSGLRSHTLSLLVNDCPGVLNIVTGCFSRRGYNIQSLAVGP  361

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            +EREG+SRI TV+P TDE+I KL++  YKL+D+HEV+D+T LPFA+RELMLIK+AVN  A
Sbjct  362  SEREGISRIMTVVPATDESISKLVRQLYKLIDVHEVRDITHLPFAQRELMLIKIAVNTAA  421

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RR++L+IASIFRAK VDVSDHTITLELTG   KL+A+QRLLEPYGICEVARTGR+AL RE
Sbjct  422  RREVLEIASIFRAKAVDVSDHTITLELTGDLGKLVAIQRLLEPYGICEVARTGRIALARE  481

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRG+ +PL
Sbjct  482  SGVDSRYLRGFSIPL  496


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            +Q HT+S+ V D  G++N + GV +RRGYNI SLAVG    + L   T V+ GT+  +R+
Sbjct  88   VQRHTISVFVGDESGMINRIAGVFARRGYNIDSLAVGLNSDKAL--FTIVVSGTERVLRQ  145

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +    YKLV++ +V+DL++ P  ERELMLIKV V+   R ++L +  IFRA+ VDVSD  
Sbjct  146  VTNQLYKLVNVLKVEDLSKEPQVERELMLIKVNVDHNKRAEVLGLVDIFRARVVDVSDDL  205

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A++R+L  +GI E+ARTG++AL RE
Sbjct  206  LTIEVTGDPGKIVAVERILRKFGIREIARTGKIALRRE  243



>ref|XP_004149627.1| PREDICTED: uncharacterized protein LOC101212902 [Cucumis sativus]
Length=489

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +DD  +  VLDAHWGVL DED  GL+SHTLSMLVNDSPGVL ++TG+ +RRGYNIQSLAV
Sbjct  293  SDDFTIKPVLDAHWGVLNDEDVDGLRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAV  352

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG+SRITTV+PGTDE+I KL+QH Y+L D+HEV+DLT +PF+ERELMLIK+A N 
Sbjct  353  GHAEAEGISRITTVVPGTDESIYKLVQHLYRLADVHEVRDLTHIPFSERELMLIKIAANP  412

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRD+LDIA IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  413  SARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALV  472

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  473  RESGVDSKYLRGYSFPL  489


 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  623  GLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIR  444
            G++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L  +T V+ GT++ + 
Sbjct  82   GVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--LTIVVSGTEKVLE  139

Query  443  KLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDH  264
            ++++  +KLV++ +V+DL+ +   ERELMLIK+    T R +I  +  +FRAK VD+SD 
Sbjct  140  QVIEQLHKLVNVLKVEDLSSVQQVERELMLIKINAEPTYRAEIKRLVDVFRAKIVDISDD  199

Query  263  TITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            ++T+E+TG   K++A QR L  +GI E+ARTG++AL RE
Sbjct  200  SVTIEVTGDPGKMVAFQRNLSKFGIREIARTGKIALRRE  238



>ref|XP_008450270.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=443

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +DD  +  VLDAHWGVL DED  GL+SHTLSMLVNDSPGVL ++TG+ +RRGYNIQSLAV
Sbjct  247  SDDFTIKPVLDAHWGVLNDEDVDGLRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAV  306

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG+SRITTV+PGTDE+I KL+Q  Y+L D+HEV+DLT LPF+ERELMLIK+A N 
Sbjct  307  GHAEAEGISRITTVVPGTDESIYKLVQQLYRLADVHEVRDLTHLPFSERELMLIKIAANP  366

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRD+LDIA IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  367  SARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALV  426

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  427  RESGVDSKYLRGYSFPL  443


 Score =   139 bits (350),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 109/154 (71%), Gaps = 2/154 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            SG++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  87   SGVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVL  144

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
             ++++  +KLV++ +V+DL+ +   ERELMLIK+  + T R +I  +  +FRAK VD+SD
Sbjct  145  EQVIEQLHKLVNVLKVEDLSSVQQVERELMLIKINADPTYRAEIKRLVDVFRAKIVDISD  204

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGR  165
             ++T+E+TG   K++A QR L  +GI E+ARTG+
Sbjct  205  DSVTIEVTGDPGKMVAFQRNLSKFGIREIARTGK  238



>emb|CDP08089.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD +++ VLDAHWGVL D+D+SGL+SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAVG
Sbjct  311  DDFYISPVLDAHWGVLDDDDTSGLRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVG  370

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE EGLSRITTV+PGTD +I KL+Q   KLV++HEV+DLT +PFAERELMLIK+AVNA 
Sbjct  371  HAEVEGLSRITTVVPGTDASISKLVQQLSKLVELHEVRDLTHMPFAERELMLIKIAVNAA  430

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVR
Sbjct  431  ARRNVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVR  490

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  P+
Sbjct  491  ESGVDSRYLRGYSYPV  506


 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  +++
Sbjct  101  VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVCGTDTVLQQ  158

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D+++ P  ERELML+K+  +   R +++ +   FRAK VD+SD++
Sbjct  159  VMEQLQKLVNVIKVEDISKEPQVERELMLVKINSDPDYRAEVMWLVDTFRAKIVDLSDYS  218

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   KL+A+QR L  +GI E+ARTG++AL RE
Sbjct  219  LTIEVTGDPGKLVAVQRNLSKFGIREIARTGKIALRRE  256



>gb|KFK31180.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=491

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V+ VLDAHWG+L DED+SGL+SHTLS+LVND+PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  295  DHMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGH  354

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTVIP TDE++ KL+Q  YKLVD+HEV DLT  PFAERELMLIK+AVNA A
Sbjct  355  AETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHFPFAERELMLIKIAVNAAA  414

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRA  VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  415  RRDVLDIASIFRAIAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  474

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS SLRGY  PL
Sbjct  475  SGVDSKSLRGYSFPL  489


 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +++
Sbjct  84   VRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQ  141

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD+++H 
Sbjct  142  VIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLLDTFRAKIVDIAEHA  201

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  202  LTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  239



>ref|XP_010414082.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   316 bits (809),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V++VLDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  296  DHMVHRVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGH  355

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTV+P TDE++ KL+Q   KLVD+HEV DLT LPFAERELMLIK+AVNATA
Sbjct  356  AETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNATA  415

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  416  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  476  SGVDSKYLRGYSFPL  490


 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  82   NSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERV  139

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD++
Sbjct  140  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIA  199

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  200  EHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  240



>emb|CDY19107.1| BnaA04g18470D [Brassica napus]
Length=488

 Score =   316 bits (809),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQS-LAVG  510
            DL V++VLDAHWG+L +ED+SGL+SHTLS+LVND PGVLNL+TGV SRRGYNIQ+ LAVG
Sbjct  291  DLMVHRVLDAHWGLLTEEDTSGLRSHTLSLLVNDVPGVLNLVTGVFSRRGYNIQAFLAVG  350

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV DLT +PFAERELMLIK+AVNA 
Sbjct  351  HAETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHMPFAERELMLIKIAVNAA  410

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL R
Sbjct  411  ARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALAR  470

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  471  ESGVDSKYLRGYSFPL  486


 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 109/161 (68%), Gaps = 2/161 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  78   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERVL  135

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R  I+ +   FRA+ VD+++
Sbjct  136  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAQIMWLVDTFRARIVDIAE  195

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            H +T+E+TG   K++A++R L  + I E+ RTG++AL RE 
Sbjct  196  HALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRREK  236



>ref|NP_001151166.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|ACG41837.1| acetolactate synthase/ amino acid binding protein [Zea mays]
 gb|AFW62901.1| acetolactate synthase/ amino acid binding protein [Zea mays]
Length=483

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 175/198 (88%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S + L VN VLDAHWGVL D+D++GL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLA
Sbjct  286  SYESLSVNHVLDAHWGVLDDDDATGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLA  345

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE+EG+SRITTV+PGT E+I KL+Q  YKL+D+HEV D+T  PFAERELMLIKV+VN
Sbjct  346  VGPAEKEGISRITTVVPGTVESIEKLVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVN  405

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
              AR++ILDIA IFRAKPVDVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVAL
Sbjct  406  TAARKEILDIAEIFRAKPVDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVAL  465

Query  155  VRESGVDSTSLRGYCLPL  102
            VRES VDS  LRGY LPL
Sbjct  466  VRESKVDSKYLRGYSLPL  483


 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  + +
Sbjct  77   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLNQ  134

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S+ T
Sbjct  135  VIEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKT  194

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+ G   K+ A+QR L  +GI E+ RTG++AL RE
Sbjct  195  LTMEVAGDPGKIAAVQRNLWKFGIKEICRTGKIALRRE  232



>ref|XP_008450269.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cucumis melo]
Length=495

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +DD  +  VLDAHWGVL DED  GL+SHTLSMLVNDSPGVL ++TG+ +RRGYNIQSLAV
Sbjct  299  SDDFTIKPVLDAHWGVLNDEDVDGLRSHTLSMLVNDSPGVLYIITGLFARRGYNIQSLAV  358

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EG+SRITTV+PGTDE+I KL+Q  Y+L D+HEV+DLT LPF+ERELMLIK+A N 
Sbjct  359  GHAEAEGISRITTVVPGTDESIYKLVQQLYRLADVHEVRDLTHLPFSERELMLIKIAANP  418

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRD+LDIA IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGRVALV
Sbjct  419  SARRDVLDIAQIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRVALV  478

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  PL
Sbjct  479  RESGVDSKYLRGYSFPL  495


 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            SG++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  87   SGVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKVL  144

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
             ++++  +KLV++ +V+DL+ +   ERELMLIK+  + T R +I  +  +FRAK VD+SD
Sbjct  145  EQVIEQLHKLVNVLKVEDLSSVQQVERELMLIKINADPTYRAEIKRLVDVFRAKIVDISD  204

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
             ++T+E+TG   K++A QR L  +GI E+ARTG++AL RE
Sbjct  205  DSVTIEVTGDPGKMVAFQRNLSKFGIREIARTGKIALRRE  244



>ref|NP_850172.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 sp|Q93YZ7.1|ILVH2_ARATH RecName: Full=Acetolactate synthase small subunit 2, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24267.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AAM65359.1| At2g31810/F20M17.15 [Arabidopsis thaliana]
 gb|AEC08586.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=491

 Score =   315 bits (807),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 173/195 (89%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V+++LDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  295  DPKVHRILDAHWGLLTDEDTSGLRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGH  354

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTVIP TDE++ KL+Q  YKLVD+HEV DLT LPF+ERELMLIK+AVNA A
Sbjct  355  AETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAA  414

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  415  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  474

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  475  SGVDSKYLRGYSFPL  489


 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  82   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRA+ VD+++
Sbjct  140  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  200  HALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  239



>gb|KFK31179.1| hypothetical protein AALP_AA6G079200 [Arabis alpina]
Length=521

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V+ VLDAHWG+L DED+SGL+SHTLS+LVND+PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  325  DHMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDAPGVLNIVTGVFARRGYNIQSLAVGH  384

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTVIP TDE++ KL+Q  YKLVD+HEV DLT  PFAERELMLIK+AVNA A
Sbjct  385  AETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHFPFAERELMLIKIAVNAAA  444

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRA  VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  445  RRDVLDIASIFRAIAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  504

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS SLRGY  PL
Sbjct  505  SGVDSKSLRGYSFPL  519


 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +++
Sbjct  114  VRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQ  171

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD+++H 
Sbjct  172  VIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLLDTFRAKIVDIAEHA  231

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  232  LTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  269



>ref|NP_001168069.1| uncharacterized protein LOC100381801 [Zea mays]
 gb|ACN26993.1| unknown [Zea mays]
Length=353

 Score =   310 bits (794),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            NQVLDAHWGVL D+D++GL SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG AE+E
Sbjct  163  NQVLDAHWGVLDDDDATGLCSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGSAEKE  222

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            G+SRITTV+PGT E+I KL+Q  YKL+D+HEV D+T  PFAERELMLIKV+VN  ARR+I
Sbjct  223  GISRITTVVPGTVESIGKLVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARREI  282

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IFRAKP+DVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRES VD
Sbjct  283  LDIAEIFRAKPIDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESKVD  342

Query  134  STSLRGYCLPL  102
            S  LRGY LPL
Sbjct  343  SKYLRGYSLPL  353


 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -1

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            + ++++   KLV++H V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S
Sbjct  3    LNQVIEQLNKLVNVHSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDIS  62

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            + T+T+E+ G   K+ A+QR L  +GI E+ RTG++AL RE 
Sbjct  63   EKTLTIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREK  104



>ref|XP_004953051.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Setaria italica]
Length=488

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDED-SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            + L +NQVLDAHWGVL D+D S+GL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAV
Sbjct  292  ESLSMNQVLDAHWGVLDDDDDSTGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAV  351

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            GPAE+EG+SRITTV+PGT+E+I KL+Q  YKL+D+HEV D+T LPF+ERELMLIKV+VN 
Sbjct  352  GPAEKEGISRITTVVPGTNESIEKLVQQLYKLIDVHEVHDITHLPFSERELMLIKVSVNT  411

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARR+ILDIA IFRAKPVDVSDHT+TL+L+G  NK++ALQRLLE YGICEVARTGRVALV
Sbjct  412  AARREILDIAEIFRAKPVDVSDHTVTLQLSGDLNKMVALQRLLEHYGICEVARTGRVALV  471

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRG+ LPL
Sbjct  472  RESGVDSKYLRGFSLPL  488


 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  81   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKVLNQ  138

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+SD T
Sbjct  139  VIEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVKPDQRPEVMVLVDIFRAKVVDISDTT  198

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +TLE+ G   K+ A+QR L  +GI E+ RTG++AL RE 
Sbjct  199  LTLEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREK  237



>ref|XP_002879344.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55603.1| hypothetical protein ARALYDRAFT_482103 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQS-LAVG  510
            D  V++VLDAHWG+L DED+SGL+SHTLS+LVND+PGVLN++TGV +RRGYNIQ+ LAVG
Sbjct  295  DPMVHRVLDAHWGLLTDEDTSGLRSHTLSLLVNDTPGVLNIVTGVFARRGYNIQAYLAVG  354

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE +G+SRITTV+P TDE+I KL+Q  YKLVD+HEV DLT LPFAERELMLIK+AVNA 
Sbjct  355  HAETKGISRITTVVPATDESISKLVQQLYKLVDVHEVHDLTHLPFAERELMLIKIAVNAA  414

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL R
Sbjct  415  ARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALAR  474

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  475  ESGVDSKYLRGYSFPL  490


 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  82   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +   R +I+ +   FRA+ VD+++
Sbjct  140  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPEFRAEIMWLVDTFRARVVDIAE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  200  HALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  239



>ref|XP_010672487.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=486

 Score =   313 bits (802),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D   V QVLDAHWGVL D D+SG QSHTLSMLVND PGVLN +TG  +RRGYNIQSLAVG
Sbjct  292  DGFAVPQVLDAHWGVLND-DTSGFQSHTLSMLVNDRPGVLNFVTGAFARRGYNIQSLAVG  350

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE +GLSRITTV+ GTDE+I KL+Q  YKLVDIHEV+DLT LPFAERELML+KVAVN  
Sbjct  351  HAETKGLSRITTVVTGTDESISKLVQQIYKLVDIHEVKDLTHLPFAERELMLVKVAVNTA  410

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARR++LDIASIFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGRVAL R
Sbjct  411  ARREVLDIASIFRAKAVDVSDHTITLELTGDVNKMVALQRLLEPYGICEVARTGRVALAR  470

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  P+
Sbjct  471  ESGVDSRYLRGYSFPV  486


 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ + ++++
Sbjct  84   HTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVSGTDKVLHQVME  141

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL+++ +V+D++R P  ERELML+KV  + ++R +++ +  IFRAK VD+S+  +T+
Sbjct  142  QLQKLLNVLKVEDISREPQVERELMLVKVGADQSSRGELMWLVDIFRAKIVDISEEYLTV  201

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K++A+ R L  +GI E+ARTG++AL RE
Sbjct  202  EVTGDPGKMVAVLRNLSKFGIREIARTGKIALRRE  236



>ref|XP_002452423.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
 gb|EES05399.1| hypothetical protein SORBIDRAFT_04g025560 [Sorghum bicolor]
Length=492

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDED-SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSL  519
            S + L  N VLDAHWGVL D+D ++GL+SHTLS+LVND PGVLN++TGV +RRGYNIQSL
Sbjct  294  SYESLSANHVLDAHWGVLDDDDDATGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSL  353

Query  518  AVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAV  339
            AVGPAE+EG+SRITTV+PGT E+I KL+Q  YKLVD+HEV D+T  PFAERELMLIKV+V
Sbjct  354  AVGPAEKEGISRITTVVPGTVESIEKLVQQLYKLVDVHEVHDITPSPFAERELMLIKVSV  413

Query  338  NATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVA  159
            N  ARR+ILDIA IFRAKPVDVSDHT+TL+LTG F+K++ALQRLLEPYGICEVARTGRVA
Sbjct  414  NTAARREILDIAEIFRAKPVDVSDHTVTLQLTGDFDKMVALQRLLEPYGICEVARTGRVA  473

Query  158  LVRESGVDSTSLRGYCLPL  102
            LVRES VDS  LRGY LPL
Sbjct  474  LVRESKVDSKYLRGYSLPL  492


 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  + +
Sbjct  85   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLNQ  142

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S+ T
Sbjct  143  VIEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKT  202

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+ G   K+ A+QR L  +GI E+ RTG++AL RE
Sbjct  203  LTIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRRE  240



>ref|XP_004288733.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=510

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            VNQ+L+A+WGVL DED+SGL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAVG AE 
Sbjct  319  VNQILNANWGVLNDEDTSGLRSHTLSMLVNDVPGVLYIITGVFARRGYNIQSLAVGRAEV  378

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EG SRITTV+P TDE+I KL+Q  YKLVD+H+V+DLT LPFAERELMLIK+A NA ARRD
Sbjct  379  EGQSRITTVVPATDESISKLVQQLYKLVDVHDVRDLTNLPFAERELMLIKIAANAVARRD  438

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            +LDI +IFRAK VDVSDHTITLELTG  NK++ALQRLLEPYGICEVARTGR+ALVRESGV
Sbjct  439  VLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPYGICEVARTGRIALVRESGV  498

Query  137  DSTSLRGYCLPL  102
            DS  LRGY LPL
Sbjct  499  DSRYLRGYSLPL  510


 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = -1

Query  650  GVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTV  471
            G L      G++ H +S+ V D  G++N ++GV +RRGYNI+SLAVG  + + L   T V
Sbjct  95   GSLPPSTPKGVRRHAISVFVGDESGMINRISGVFARRGYNIESLAVGLNKDKAL--FTIV  152

Query  470  IPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFR  291
            + GTD  +R++++  +KLV++ +V+DL+  P  ERELMLIKV  +     +I  I +IFR
Sbjct  153  VSGTDTVLRQVIEQLHKLVNVLKVEDLSSEPQVERELMLIKVTAHPDYLAEIRWIVNIFR  212

Query  290  AKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            AK VD+SDH++T+E+TG   K++ALQR L  +GI E+ARTG++AL RE
Sbjct  213  AKIVDISDHSVTIEVTGDPGKMVALQRNLSKFGIREIARTGKIALRRE  260



>ref|XP_010469676.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=491

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 171/195 (88%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V++VLDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  295  DHMVHRVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGH  354

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTV+P TDE++ KL+Q   KLVD+HEV DLT LPFAERELMLIK+AVNA A
Sbjct  355  AETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNAAA  414

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQR LEPYGICEVARTGRVAL RE
Sbjct  415  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRFLEPYGICEVARTGRVALARE  474

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  475  SGVDSKYLRGYSFPL  489


 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  81   TSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERV  138

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD++
Sbjct  139  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIA  198

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  199  EHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  239



>ref|XP_010469674.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010469675.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=492

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 171/195 (88%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V++VLDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  296  DHMVHRVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGH  355

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTV+P TDE++ KL+Q   KLVD+HEV DLT LPFAERELMLIK+AVNA A
Sbjct  356  AETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNAAA  415

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQR LEPYGICEVARTGRVAL RE
Sbjct  416  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRFLEPYGICEVARTGRVALARE  475

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  476  SGVDSKYLRGYSFPL  490


 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            S+ ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  82   SNRVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERV  139

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD++
Sbjct  140  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIA  199

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  200  EHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  240



>ref|XP_010414083.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=415

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQS-LAVG  510
            D  V++VLDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQ+ LAVG
Sbjct  218  DHMVHRVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQAYLAVG  277

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE +G+SRITTV+P TDE++ KL+Q   KLVD+HEV DLT LPFAERELMLIK+AVNAT
Sbjct  278  HAETKGISRITTVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFAERELMLIKIAVNAT  337

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL R
Sbjct  338  ARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALAR  397

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  398  ESGVDSKYLRGYSFPL  413


 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -1

Query  554  VISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPF  375
            V +RRGYNI+SLAVG    + L   T V+ GT+  ++++++   KLV++ +V+D++  P 
Sbjct  29   VFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQ  86

Query  374  AERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPY  195
             ERELML+KV  +  +R +I+ +   FRAK VD+++H +T+E+TG   K++A++R L+ +
Sbjct  87   VERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIAEHALTIEVTGDPGKMIAVERNLKKF  146

Query  194  GICEVARTGRVALVRES  144
             I E+ RTG++AL RE 
Sbjct  147  QIREIVRTGKIALRREK  163



>ref|XP_010510152.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
 ref|XP_010510153.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
[Camelina sativa]
Length=492

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 171/195 (88%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V++VLDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  296  DHMVHRVLDAHWGLLSDEDTSGLRSHTLSLLVNDVPGVLNIVTGVFARRGYNIQSLAVGH  355

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTV+P TDE++ KL+Q   KLVD+H V DLT LPFAERELMLIK+AVNA A
Sbjct  356  AETKGISRITTVVPATDESVSKLVQQLNKLVDVHAVHDLTHLPFAERELMLIKIAVNAAA  415

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  416  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  476  SGVDSKYLRGYSFPL  490


 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  82   NSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERV  139

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD++
Sbjct  140  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRAKVVDIA  199

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  200  EHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  240



>ref|NP_850173.2| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08587.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=421

 Score =   308 bits (790),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQS-LAVG  510
            D  V+++LDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQ+ LAVG
Sbjct  224  DPKVHRILDAHWGLLTDEDTSGLRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQAYLAVG  283

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE +G+SRITTVIP TDE++ KL+Q  YKLVD+HEV DLT LPF+ERELMLIK+AVNA 
Sbjct  284  HAETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAA  343

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL R
Sbjct  344  ARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALAR  403

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  404  ESGVDSKYLRGYSFPL  419


 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = -1

Query  554  VISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPF  375
            V +RRGYNI+SLAVG    + L   T V+ GT+  ++++++   KLV++ +V+D++  P 
Sbjct  35   VFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQ  92

Query  374  AERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPY  195
             ERELML+KV  +  +R +I+ +   FRA+ VD+++H +T+E+TG   K++A++R L+ +
Sbjct  93   VERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKKF  152

Query  194  GICEVARTGRVALVRES  144
             I E+ RTG++AL RE 
Sbjct  153  QIREIVRTGKIALRREK  169



>ref|XP_006663345.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=425

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            NQ+LDAHWGV+ D D +G  SHTLS+LVND PGVLN++TGV SRRGYNIQSLAVGPAE+E
Sbjct  235  NQILDAHWGVMADGDPTGFCSHTLSILVNDFPGVLNVVTGVFSRRGYNIQSLAVGPAEKE  294

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            G SRITTV+PGTDE+I KL+   YKL+D++EVQDLT LPFA RELM+IK+AVN TARR I
Sbjct  295  GTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIKIAVNTTARRAI  354

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IFRAK VDVSDHT+TL+LTG  +K++ALQR+LEPYGICEVARTGRVAL RESGVD
Sbjct  355  LDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEVARTGRVALRRESGVD  414

Query  134  STSLRGYCLPL  102
            S  LRG+ LPL
Sbjct  415  SKYLRGFSLPL  425


 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  20   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQ  77

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+SDHT
Sbjct  78   VVEQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHT  137

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  138  LTIEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRRE  175



>gb|AAX96859.1| acetolactate synthase, small subunit, putative [Oryza sativa 
Japonica Group]
 gb|ABA92419.1| acetolactate synthase small subunit, putative, expressed [Oryza 
sativa Japonica Group]
Length=476

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S ++   NQ+LDAHWGV+ D D +GL SH+LS+LVND PGVLN++TGV SRRGYNIQSLA
Sbjct  279  SYENFTTNQILDAHWGVMADGDPTGLCSHSLSILVNDFPGVLNVVTGVFSRRGYNIQSLA  338

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE+EG SRITTV+PGTDE+I KL+   YKL+D++EVQDLT LPFA RELM+IK+AVN
Sbjct  339  VGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIKIAVN  398

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
             TARR ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQR+LEPYGICEVARTGRVAL
Sbjct  399  TTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEVARTGRVAL  458

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRG+ LPL
Sbjct  459  RRESGVDSKYLRGFSLPL  476


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  71   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQ  128

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+SDHT
Sbjct  129  VVEQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHT  188

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  189  LTIEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRRE  226



>ref|XP_004504201.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Cicer arietinum]
Length=475

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL +ED+SG +SHTLS+LVND PGVL+ +TGV +RRGYNIQSL V
Sbjct  279  SDSFTVNQVLDAHWGVLNEEDTSGTRSHTLSILVNDVPGVLSCVTGVFARRGYNIQSLVV  338

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EG+ R+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T +PFAERELMLIK+AVNA
Sbjct  339  GHSEVEGIYRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNA  398

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRA+ VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  399  AARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  458

Query  152  RESGVDSTSLRGYCLPL  102
            R+SGVDS  LRGY  PL
Sbjct  459  RDSGVDSRYLRGYSFPL  475


 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = -1

Query  650  GVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTV  471
            G +     S ++ HT+S+ V D  G++N + GV+++RGYNI+SLAVG  + + L  ++ V
Sbjct  60   GSVTSPSRSKVRRHTISVFVGDESGMINRIAGVLAKRGYNIESLAVGLNQDKAL--LSIV  117

Query  470  IPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFR  291
            + GTD  ++++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I  +   FR
Sbjct  118  VSGTDRGLQQVVEQLQKLVNVLKVEDLSYEPQVERELMLLKVHADPQNRAEIKWLVDTFR  177

Query  290  AKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
               VDVS++++T+E+TG   K++A+QR L  +GI EV+RTG++AL RE
Sbjct  178  GNIVDVSENSVTIEVTGDPGKMVAVQRSLRRFGIKEVSRTGKIALRRE  225



>gb|EEE57346.1| hypothetical protein OsJ_07472 [Oryza sativa Japonica Group]
Length=422

 Score =   307 bits (786),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 172/221 (78%), Gaps = 29/221 (13%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQ---------  525
            +NQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV +RRGYNIQ         
Sbjct  202  MNQVLDAHWGVLDDEDSSGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQGDVYPVEPY  261

Query  524  --------------------SLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIH  405
                                SLAVGPAE+ GLSRITTV PGTDE+I KL+Q   KLVD+H
Sbjct  262  EGSSMNQVLDAHWGVLDDEDSLAVGPAEKSGLSRITTVAPGTDESIEKLVQQLNKLVDVH  321

Query  404  EVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKL  225
            EVQD+T LPFAERELMLIKV+VN  ARRDILDIA IFRAK VDVSDHT+TL+LTG  +K+
Sbjct  322  EVQDITHLPFAERELMLIKVSVNTAARRDILDIAEIFRAKSVDVSDHTVTLQLTGDLDKM  381

Query  224  LALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            +ALQRLLEPYGICEVARTGRVALVRESGVDS  LRGY  PL
Sbjct  382  VALQRLLEPYGICEVARTGRVALVRESGVDSKYLRGYSFPL  422


 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  + + +   T V+ GTD  + ++++   KLV++  V+
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDKAM--FTIVVSGTDRVLNQVIEQLNKLVNVLNVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S++T+T+E+TG   K++A+
Sbjct  59   DLSKEPQVERELMLIKINVEPDQRPEVMVLVDIFRAKVVDISENTLTIEVTGDPGKIVAV  118

Query  215  QRLLEPYGICEVARTGRVALVRE  147
            QR L  +GI E+ RTG++AL RE
Sbjct  119  QRNLSKFGIKEICRTGKIALRRE  141



>ref|XP_008643958.1| PREDICTED: uncharacterized protein LOC100381801 isoform X1 [Zea 
mays]
 gb|AFW72257.1| hypothetical protein ZEAMMB73_990877 [Zea mays]
Length=486

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            NQVLDAHWGVL D+D++GL SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG AE+E
Sbjct  296  NQVLDAHWGVLDDDDATGLCSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLAVGSAEKE  355

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            G+SRITTV+PGT E+I KL+Q  YKL+D+HEV D+T  PFAERELMLIKV+VN  ARR+I
Sbjct  356  GISRITTVVPGTVESIGKLVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVNTAARREI  415

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IFRAKP+DVSDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGRVALVRES VD
Sbjct  416  LDIAEIFRAKPIDVSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRVALVRESKVD  475

Query  134  STSLRGYCLPL  102
            S  LRGY LPL
Sbjct  476  SKYLRGYSLPL  486


 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  + +
Sbjct  81   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDMVLNQ  138

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++H V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S+ T
Sbjct  139  VIEQLNKLVNVHSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKT  198

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+ G   K+ A+QR L  +GI E+ RTG++AL RE 
Sbjct  199  LTIEVAGDPGKIAAVQRNLRKFGIKEICRTGKIALRREK  237



>ref|XP_003572704.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=481

 Score =   308 bits (788),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            + L +NQVLDAHWGVL DEDSSGL SHTLS+LVND PGVLN++TGV +RRGY+IQSLAVG
Sbjct  286  ESLSMNQVLDAHWGVLDDEDSSGLCSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVG  345

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             AE+EG+SRITTV+PGTDE+I KL+Q  YKL+D+H+V DLT LPFAERELMLIKV+ N  
Sbjct  346  RAEKEGISRITTVVPGTDESIEKLVQQLYKLIDVHKVHDLTHLPFAERELMLIKVSGNTA  405

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARR+ILDI  IFRAK VD+SDHT+TL+LTG F K++ALQ LLEPYGICEVARTGRVALVR
Sbjct  406  ARREILDIGEIFRAKCVDLSDHTVTLQLTGDFAKMVALQGLLEPYGICEVARTGRVALVR  465

Query  149  ESGVDSTSLRGYCLPL  102
            ESGVDS  LRGY  PL
Sbjct  466  ESGVDSKYLRGYSHPL  481


 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  +++
Sbjct  74   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQ  131

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R D++ +A +FRA+ VD+S+++
Sbjct  132  VIEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVGPDQRADVMFVADVFRARVVDISENS  191

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +TLE+TG   K++A QR L  +GI E+ RTG++AL RE
Sbjct  192  LTLEVTGDPGKIVAAQRNLSKFGIEEICRTGKIALTRE  229



>dbj|BAJ92239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=473

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            + L +NQVLDAHWGVL DEDSSGL+SHTLS+LVND PGVLN++TGV +RRGY+IQSLAVG
Sbjct  278  ESLSMNQVLDAHWGVLDDEDSSGLRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVG  337

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTDE+I KL+Q  YKL+D+H+V DLT LPFAERELM+IKV+ N  
Sbjct  338  PAEKEGISRITTVVPGTDESIGKLVQQLYKLIDVHKVDDLTDLPFAERELMVIKVSGNTA  397

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARR+ILDI +IFRA+ VD+SDHT+TL+LTG  +K++ALQRLLEPYGICEVARTGR AL+R
Sbjct  398  ARREILDIGNIFRAECVDLSDHTVTLQLTGDLDKMVALQRLLEPYGICEVARTGRAALLR  457

Query  149  ESGVDSTSLRGYCLPL  102
            ES VDS  LRGY LPL
Sbjct  458  ESRVDSKYLRGYSLPL  473


 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = -1

Query  650  GVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTV  471
            G   D     ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V
Sbjct  57   GAKRDPRDCRVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIV  114

Query  470  IPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFR  291
            + GTD  ++++++   KLV++  V+DL++    ERELMLIK+ V    R D++ +A++FR
Sbjct  115  VSGTDRVLKQVIEQLNKLVNVLNVEDLSKEAQVERELMLIKLNVEPDQRADVMFVATVFR  174

Query  290  AKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            AK VD+S++++TLE+TG   K++A QR L  +GI E+ RTG++AL RE
Sbjct  175  AKVVDISENSLTLEVTGDPGKIVAAQRNLSKFGIKEICRTGKIALRRE  222



>ref|XP_006294093.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
 gb|EOA26991.1| hypothetical protein CARUB_v10023086mg [Capsella rubella]
Length=492

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  ++ VLDAHWG+L DED+SGL+SHTLS+LV+D PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  296  DHMIHHVLDAHWGLLTDEDTSGLRSHTLSLLVSDVPGVLNIVTGVFARRGYNIQSLAVGH  355

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRIT V+P TDE++ KL+Q   KLVD+HEV DLT LPF+ERELMLIK+AVNA A
Sbjct  356  AETKGISRITLVVPATDESVSKLVQQLNKLVDVHEVHDLTHLPFSERELMLIKIAVNAAA  415

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  416  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  475

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  476  SGVDSKYLRGYSFPL  490


 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  83   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  140

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  N  +R +I+ +   FRAK VD+++
Sbjct  141  QQVIEQLLKLVNVLKVEDISSEPQVERELMLVKVNANPESRAEIMWLVDTFRAKVVDIAE  200

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R LE + I E+ RTG++AL RE
Sbjct  201  HALTIEVTGDPGKMIAVERNLEKFQIREIVRTGKIALRRE  240



>ref|XP_010524340.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=489

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG +YDEDS+G +S TLS+LVN+SPGVLN +TGVISRRGYNIQSLAVGPAE+EG+
Sbjct  301  VLDAHWGAVYDEDSTGKRSRTLSILVNNSPGVLNEITGVISRRGYNIQSLAVGPAEKEGI  360

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIP TDE I KL++  +KLVD+HEV+D+T LPFAERELMLIKVA N +ARRD+LD
Sbjct  361  SRITTVIPATDEMISKLVRQLHKLVDLHEVRDMTNLPFAERELMLIKVAANTSARRDVLD  420

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK VDVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  421  IAQVFRAKAVDVSDHTITLEVTGDLRKMAALQTQLEAYGICEVARTGRVALVRESGVDST  480

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  481  YLRGYSLPL  489


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  84   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVIGTDKVLQQ  141

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+D+++ P  ERELMLIK+  + T R +I+ +  IFRAK VD S+ +
Sbjct  142  VVEQLNKLVNVIKVEDISKEPQVERELMLIKLNADPTTRTEIMWLIDIFRAKIVDTSERS  201

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++ALQR LE +GI E+ARTG++AL RE
Sbjct  202  LTIEVTGDPGKMVALQRNLEKFGIKEIARTGKIALRRE  239



>ref|XP_007028127.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
 gb|EOY08629.1| Valine-tolerant 1 isoform 2 [Theobroma cacao]
Length=402

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            SSGLQSHTLSM+VND+PGVLN++TGVISRRGYNIQSLAVGPAER+ LSRITTV+PGT+ET
Sbjct  227  SSGLQSHTLSMVVNDTPGVLNVVTGVISRRGYNIQSLAVGPAERDELSRITTVVPGTNET  286

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            I KL+Q   KLVD++EVQD+T LPFAERELML+KVAVN  ARRD+LDIASIFRAK VDVS
Sbjct  287  IGKLVQQLQKLVDLYEVQDMTHLPFAERELMLVKVAVNTAARRDVLDIASIFRAKAVDVS  346

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            DHTITLELTG  NK++ALQRLLEPYGICEV RTGRVALVRESGVDSTSLRGY LP 
Sbjct  347  DHTITLELTGDLNKMVALQRLLEPYGICEVTRTGRVALVRESGVDSTSLRGYSLPF  402


 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 114/169 (67%), Gaps = 7/169 (4%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + +   T V+ GT+  
Sbjct  74   ASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNKDKAI--FTIVVSGTEMI  131

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D+++ P  ERELMLIK+  +A  R +++ +  IFRAK VD S
Sbjct  132  LRQVVEQLNKLVNVIKVEDISKEPHVERELMLIKLHADADTRAEVMWLVDIFRAKIVDTS  191

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSL  123
            +  +T+E+TG   K+ A+QR L  +GI E+ARTG     + SG+ S +L
Sbjct  192  EQFLTIEVTGDPGKMAAVQRNLSKFGIKELARTG-----KSSGLQSHTL  235



>ref|XP_006286863.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
 gb|EOA19761.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
Length=246

 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++YDEDSSG++SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  58   VLDAHWGMVYDEDSSGIRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  117

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTD+ I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  118  SRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLD  177

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YG+CEVARTGRVALVRESGVDST
Sbjct  178  IAQVFRAKAIDVSDHTITLEVTGDLRKMAALQTQLEVYGLCEVARTGRVALVRESGVDST  237

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  238  YLRGYSLPL  246



>ref|XP_009126106.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Brassica rapa]
Length=475

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWGV+YDEDS GL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  287  VLDAHWGVVYDEDSDGLRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  346

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  347  SRITTVIPGTDENIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLD  406

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  407  IAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  466

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  467  YLRGYSLPL  475


 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + +   T V+ GTD+ +++
Sbjct  71   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQ  128

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + T R +I+ +  IFRAK VD SDHT
Sbjct  129  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHT  188

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI EVARTG++AL RE
Sbjct  189  LTIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRRE  226



>gb|KHG22544.1| Acetolactate synthase small subunit [Gossypium arboreum]
Length=469

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 170/198 (86%), Gaps = 10/198 (5%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S D   +NQVLDAHWGVL D+D+SG QSHTLSMLVNDSPGVLNL+TG          SLA
Sbjct  282  SPDGFTINQVLDAHWGVLTDDDTSGHQSHTLSMLVNDSPGVLNLVTG----------SLA  331

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT+LPFAERELMLIK+AVN
Sbjct  332  VGHAEVEGLSRITTVVPGTDESISKLVQQLYKLVDMHEVRDLTQLPFAERELMLIKIAVN  391

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            ATARRD+LDIA+IFRAK VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+AL
Sbjct  392  ATARRDVLDIANIFRAKAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRLAL  451

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY  PL
Sbjct  452  VRESGVDSKYLRGYSFPL  469


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 121/183 (66%), Gaps = 2/183 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S DD   N    A+  V      S ++ HT+S+ V D  G++N + GV +RRGYNI+SLA
Sbjct  49   SVDDKISNSNFLANGPVPSTPTRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLA  108

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG  + + L   T V+ GTD  ++++++   KLV++ +V+DL+  P  ERELMLIKV  +
Sbjct  109  VGLNKDKAL--FTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEPQVERELMLIKVNAD  166

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
               R +I+ +  IFRAK VD+S+H++T+E+TG   K++A+QR L  +GI E+ARTG++AL
Sbjct  167  PKFRAEIMWLVDIFRAKIVDISEHSLTIEVTGDPGKMVAVQRNLSKFGIKEIARTGKIAL  226

Query  155  VRE  147
             RE
Sbjct  227  RRE  229



>emb|CDX85509.1| BnaA02g03040D [Brassica napus]
Length=475

 Score =   305 bits (781),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWGV+YDEDS GL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  287  VLDAHWGVVYDEDSDGLRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  346

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  347  SRITTVIPGTDENIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLD  406

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  407  IAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  466

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  467  YLRGYSLPL  475


 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + +   T V+ GTD+ +++
Sbjct  71   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQ  128

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + T R +I+ +  IFRAK VD SDHT
Sbjct  129  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHT  188

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI EVARTG++AL RE
Sbjct  189  LTIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRRE  226



>gb|EEC67965.1| hypothetical protein OsI_35716 [Oryza sativa Indica Group]
Length=476

 Score =   305 bits (781),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 170/198 (86%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S ++   NQ+LDAHWGV+ D D +GL SH+LS+LVND  GVLN++TGV SRRGYNIQSLA
Sbjct  279  SYENFTTNQILDAHWGVMADGDPTGLCSHSLSILVNDFTGVLNVVTGVFSRRGYNIQSLA  338

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE+EG SRITTV+PGTDE+I KL+   YKL+D++EVQDLT LPFA RELM+IK+AVN
Sbjct  339  VGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIKIAVN  398

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
             TARR ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQR+LEPYGICEVARTGRVAL
Sbjct  399  TTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEVARTGRVAL  458

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRG+ LPL
Sbjct  459  RRESGVDSKYLRGFSLPL  476


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  71   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQ  128

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+SDHT
Sbjct  129  VVEQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHT  188

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  189  LTIEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRRE  226



>ref|XP_010558579.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=421

 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG +YDEDS+G++SHTLS+LVN+SPGVLN + GVISRRGYNIQSLAVGPAE+EGL
Sbjct  233  VLDAHWGAVYDEDSTGMRSHTLSILVNNSPGVLNEIAGVISRRGYNIQSLAVGPAEKEGL  292

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIP TDE   +L+   +KLVDIHEV+D+T LPFAERELMLIKVA N  ARRD+LD
Sbjct  293  SRITTVIPATDEKTSQLVGQLHKLVDIHEVRDMTHLPFAERELMLIKVAANTAARRDLLD  352

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK VDVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  353  IAQVFRAKAVDVSDHTITLEVTGDLRKMAALQNQLETYGICEVARTGRVALVRESGVDST  412

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  413  YLRGYSLPL  421


 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GTD  +
Sbjct  14   SRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNADKAL--FTIVVIGTDRVL  71

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D+++ P  ERELMLIK+    + R +I+ +  IFRAK VD S+
Sbjct  72   QQVVEQLNKLVNVIKVEDISKEPQVERELMLIKLNAGPSTRTEIMWLVDIFRAKIVDTSE  131

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            H++T+E+TG   K+ ALQR LE +GI E+ARTG++AL RE 
Sbjct  132  HSLTIEVTGDPGKMAALQRNLEKFGIKEIARTGKIALRREK  172



>emb|CDY38123.1| BnaC02g06500D [Brassica napus]
Length=475

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWGV+YDEDS GL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  287  VLDAHWGVVYDEDSDGLRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  346

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  347  SRITTVIPGTDENIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLD  406

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  407  IAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  466

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  467  YLRGYSLPL  475


 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + +   T V+ GTD+ +++
Sbjct  71   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQ  128

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + T R +I+ +  IFRAK VD SDHT
Sbjct  129  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKVVDTSDHT  188

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI EVARTG++AL RE
Sbjct  189  LTIEVTGDPGKMVALTANLEKFGIKEVARTGKIALRRE  226



>ref|XP_003576101.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Brachypodium distachyon]
Length=474

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S + + +NQ+LDAHWG + D D +G  SHTLS+LVND PGVLN++TGV SRRGYNIQSLA
Sbjct  277  SYESISMNQILDAHWGDMTDGDHTGFCSHTLSILVNDVPGVLNVVTGVFSRRGYNIQSLA  336

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE+ G+SRITTV+PG DE+I KL+   YKL+D+HEVQDLT LPFA RELM+IKVAVN
Sbjct  337  VGPAEKLGISRITTVVPGNDESIAKLVHQLYKLIDVHEVQDLTHLPFAARELMIIKVAVN  396

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
             TARR ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQR+LEPYGICE+ARTGRVAL
Sbjct  397  TTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEIARTGRVAL  456

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRG+ LPL
Sbjct  457  SRESGVDSKYLRGFSLPL  474


 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  70   VKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQ  127

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V DL++ P  ERELMLIK+ V +  R +++ +  IFRAK VD+S+ T
Sbjct  128  VVEQLNKLVNVIQVDDLSKEPQVERELMLIKLNVESDRRLEVMGLVDIFRAKVVDLSERT  187

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  188  LTIEVTGDPGKMVAVQRNLSKFGIKEIARTGKIALRRE  225



>ref|NP_197133.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 ref|NP_850829.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 sp|Q9FFF4.1|ILVH1_ARATH RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; AltName: Full=Protein valine-tolerant 
1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09596.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AAY25401.1| At5g16290 [Arabidopsis thaliana]
 dbj|BAE98982.1| acetolactate synthase-like protein [Arabidopsis thaliana]
 gb|AED92272.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
 gb|AED92273.1| acetolactate synthase small subunit 1 [Arabidopsis thaliana]
Length=477

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++YDEDSSGL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  289  VLDAHWGMVYDEDSSGLRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  348

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+ E+Q++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  349  SRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLD  408

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  409  IAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLEAYGICEVARTGRVALVRESGVDST  468

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  469  YLRGYSLPL  477


 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  74   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQ  131

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+ +
Sbjct  132  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQS  191

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI E+ARTG++AL RE
Sbjct  192  LTIEVTGDPGKMVALTTNLEKFGIKEIARTGKIALRRE  229



>dbj|BAH19535.1| AT5G16290 [Arabidopsis thaliana]
Length=477

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++YDEDSSGL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  289  VLDAHWGMVYDEDSSGLRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  348

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+ E+Q++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  349  SRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLD  408

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  409  IAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLEAYGICEVARTGRVALVRESGVDST  468

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  469  YLRGYSLPL  477


 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  74   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQ  131

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+ +
Sbjct  132  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQS  191

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI E+ARTG++AL RE
Sbjct  192  LTIEVTGDPGKMVALTTNLEKFGIQEIARTGKIALRRE  229



>ref|XP_009625350.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=483

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++D+  V+QVLDAHWGVL DED+SGL SHTLSMLVND+PGVLN++TGV +RRGYNIQSLA
Sbjct  286  TDDNSGVSQVLDAHWGVLNDEDTSGLHSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLA  345

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE++ KL+Q  YKLVDIHEV+D+T  PFAERELMLIK+A N
Sbjct  346  VGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHHPFAERELMLIKIAAN  405

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEP GICEVARTGR+AL
Sbjct  406  AAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVALQRLLEPCGICEVARTGRLAL  465

Query  155  VRESGVDSTSLRGYCLPL  102
            VRESGVDS  LRGY  PL
Sbjct  466  VRESGVDSKYLRGYSYPL  483


 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+ + V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  ++++++
Sbjct  81   HTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVME  138

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV++ +V+DL++ P  ERELMLIK++ +   R +++ +  +FRAK VD+SDH++T+
Sbjct  139  QLQKLVNVIKVEDLSKEPQVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDHSLTI  198

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  199  EVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  233



>ref|XP_006400166.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
 gb|ESQ41619.1| hypothetical protein EUTSA_v10016107mg [Eutrema salsugineum]
Length=479

 Score =   303 bits (775),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWGV+YDEDSSGL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVG AE+EGL
Sbjct  291  VLDAHWGVVYDEDSSGLRSHTLSILVTNVPGVLNLITGAISRRGYNIQSLAVGHAEKEGL  350

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+HEV+++T +PFAERELMLIKVA + TARRD+LD
Sbjct  351  SRITTVIPGTDENIDKLVRQLQKLIDLHEVKNITHMPFAERELMLIKVAAHTTARRDVLD  410

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  411  IAQVFRAKAIDVSDHTITLEVTGDIRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  470

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  471  YLRGYSLPL  479


 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + +   T V+ GTD+ +++
Sbjct  76   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAM--FTIVVLGTDKVLQQ  133

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + T R +I+ +  IFRAK VD S+HT
Sbjct  134  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPTTRSEIMWLVDIFRAKIVDTSEHT  193

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL+  LE +GI E+ARTG++AL RE
Sbjct  194  LTIEVTGDPGKMVALKTNLEKFGILEIARTGKIALRRE  231



>ref|XP_002871713.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47972.1| hypothetical protein ARALYDRAFT_488480 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++YDEDSSGL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  288  VLDAHWGMVYDEDSSGLRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  347

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+ E+Q++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  348  SRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLD  407

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YG+CEVARTGRVALVRESGVDST
Sbjct  408  IAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLEAYGLCEVARTGRVALVRESGVDST  467

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  468  YLRGYSLPL  476


 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  72   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQ  129

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+H+
Sbjct  130  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHS  189

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI E+ARTG++AL RE
Sbjct  190  LTIEVTGDPGKMVALTTNLEKFGIKEIARTGKIALRRE  227



>gb|KJB27748.1| hypothetical protein B456_005G007600 [Gossypium raimondii]
Length=371

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 171/195 (88%), Gaps = 1/195 (1%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D+F  +++D     L  E +SG QSHTLSMLVNDSPGVLNL+TGV +RRGYN+QSLAVG 
Sbjct  178  DIFRAKIVDISEHSLTIE-TSGHQSHTLSMLVNDSPGVLNLVTGVFARRGYNLQSLAVGH  236

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT+LPFAERELMLIK+AVNA A
Sbjct  237  AEVEGLSRITTVVPGTDESISKLVQQLYKLVDMHEVRDLTQLPFAERELMLIKIAVNAAA  296

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIA+IFRAK VDVSDHT+TLELTG  +K++ALQRLLEPYGICEVARTGR+ALVRE
Sbjct  297  RRDVLDIANIFRAKAVDVSDHTVTLELTGDLDKMVALQRLLEPYGICEVARTGRLALVRE  356

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY LPL
Sbjct  357  SGVDSRYLRGYSLPL  371


 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 101/160 (63%), Gaps = 2/160 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S DD   N    A+  V      S ++ HT+S+ V D  G++N + GV +RRGYNI+SLA
Sbjct  49   SVDDKISNSNFLANGPVPSTPTRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLA  108

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG  + + L   T V+ GTD  ++++++   KLV++ +V+DL+  P  ERELMLIKV  +
Sbjct  109  VGLNKDKAL--FTIVVSGTDRVLQQVVEQLQKLVNVWKVEDLSNEPQVERELMLIKVNAD  166

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
               R +I+ +  IFRAK VD+S+H++T+E +G  +  L++
Sbjct  167  PKFRAEIMWLVDIFRAKIVDISEHSLTIETSGHQSHTLSM  206



>ref|XP_006286862.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
 gb|EOA19760.1| hypothetical protein CARUB_v10003921mg [Capsella rubella]
Length=476

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++YDEDSSG++SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  288  VLDAHWGMVYDEDSSGIRSHTLSILVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  347

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTD+ I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  348  SRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSARRDVLD  407

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YG+CEVARTGRVALVRESGVDST
Sbjct  408  IAQVFRAKAIDVSDHTITLEVTGDLRKMAALQTQLEVYGLCEVARTGRVALVRESGVDST  467

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  468  YLRGYSLPL  476


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 118/166 (71%), Gaps = 2/166 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            S  ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ 
Sbjct  71   SDRVRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKV  128

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S
Sbjct  129  LQQVVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTS  188

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDS  132
            +H++T+E+TG   KL+AL+  LE +GI E+ARTG++AL RE   D+
Sbjct  189  EHSLTIEVTGDPGKLVALETNLEKFGIREIARTGKIALRREKMGDT  234



>gb|EMT17230.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=472

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 167/198 (84%), Gaps = 1/198 (1%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S +   +NQ+LDAHWG + D D +G  SHTLS+LVNDSPGVLN++TGV +RRGYNIQSLA
Sbjct  274  SYESFSMNQILDAHWGAMTDSDPTGFCSHTLSILVNDSPGVLNVVTGVFARRGYNIQSLA  333

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE+ G SRITTV+PG DE+I KL+Q  YKL+D++EVQDLT LPFA RELM+IKVA N
Sbjct  334  VGPAEKTGTSRITTVVPGNDESIAKLVQQLYKLIDVYEVQDLTHLPFAARELMIIKVAGN  393

Query  335  ATARRDILDIAS-IFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVA  159
             +ARR+ILDIA  +FRAK VDVS HTITL+LTG  +K++ALQRLLEPYGICE+ARTGRVA
Sbjct  394  TSARREILDIAEDVFRAKTVDVSGHTITLQLTGDLDKMVALQRLLEPYGICEIARTGRVA  453

Query  158  LVRESGVDSTSLRGYCLP  105
            L RESGVDS  LRGY LP
Sbjct  454  LCRESGVDSKYLRGYSLP  471


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 114/160 (71%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +
Sbjct  65   SVVKRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKIL  122

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
             ++++  YKLV++ +V DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+SD
Sbjct  123  TQVVEQLYKLVNVIQVDDLSKEPQVERELMLIKLNVEPEQRLEVMGLVDIFRAKVVDLSD  182

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            HT+T+E+TG   K+ A+QR L  +GI EVARTG++AL RE
Sbjct  183  HTLTVEVTGDPGKIAAVQRNLNKFGIKEVARTGKIALRRE  222



>ref|XP_008667813.1| PREDICTED: uncharacterized protein LOC100279727 isoform X1 [Zea 
mays]
Length=407

 Score =   296 bits (758),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            +Q+LDAHWGV+ D D +G  SHTLS+LVND PGVLNL+TGV SRRGYNIQSLAVGPAE+E
Sbjct  217  SQILDAHWGVMTDGDPTGFCSHTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKE  276

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            G SRITTV+PGTDE+I KL+   YKL+D++EVQD T LPFA RELM+IKVA NATARRD+
Sbjct  277  GTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDFTHLPFAARELMIIKVAANATARRDV  336

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IF A+ VD+SDHTITL LTG  ++++ LQ++LE YGICEVARTGR+AL+RESGVD
Sbjct  337  LDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLEQYGICEVARTGRIALLRESGVD  396

Query  134  STSLRGYCLPL  102
            S  LRG+ LPL
Sbjct  397  SKYLRGFSLPL  407


 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+ + +
Sbjct  1    MKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDKILNQ  58

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V DL+  P  ERELMLIKV        +I+ +  IF+A+ VD+SD+T
Sbjct  59   VVEQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDLSDYT  118

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A+Q+ L  YGI E+ARTG++AL RE 
Sbjct  119  LTIEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRREK  157



>ref|XP_008344057.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
[Malus domestica]
Length=251

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  641  YDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPG  462
            Y   ++GL+SHTLSMLVND PGVL ++TGV +RRGYNIQSLAVG AE EGLSRITTV+PG
Sbjct  72   YAFQTNGLRSHTLSMLVNDIPGVLYIITGVFARRGYNIQSLAVGXAEAEGLSRITTVVPG  131

Query  461  TDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKP  282
            TDE+I KL+Q  YKLVD+H+VQDLT LPFAERELMLIK+A NA ARRD+LDI +IFRAK 
Sbjct  132  TDESISKLVQQLYKLVDVHDVQDLTNLPFAERELMLIKIAANAVARRDVLDIGNIFRAKA  191

Query  281  VDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVRESGVDS  LRGY  PL
Sbjct  192  VDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALVRESGVDSKYLRGYSFPL  251



>tpg|DAA41907.1| TPA: hypothetical protein ZEAMMB73_831035 [Zea mays]
Length=476

 Score =   296 bits (757),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            +Q+LDAHWGV+ D D +G  SHTLS+LVND PGVLNL+TGV SRRGYNIQSLAVGPAE+E
Sbjct  286  SQILDAHWGVMTDGDPTGFCSHTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKE  345

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            G SRITTV+PGTDE+I KL+   YKL+D++EVQD T LPFA RELM+IKVA NATARRD+
Sbjct  346  GTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDFTHLPFAARELMIIKVAANATARRDV  405

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IF A+ VD+SDHTITL LTG  ++++ LQ++LE YGICEVARTGR+AL+RESGVD
Sbjct  406  LDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLEQYGICEVARTGRIALLRESGVD  465

Query  134  STSLRGYCLPL  102
            S  LRG+ LPL
Sbjct  466  SKYLRGFSLPL  476


 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + S ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  66   NRSVMKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDK  123

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             + ++++   KLV++ +V DL+  P  ERELMLIKV        +I+ +  IF+A+ VD+
Sbjct  124  ILNQVVEQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDL  183

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            SD+T+T+E+TG   K++A+Q+ L  YGI E+ARTG++AL RE
Sbjct  184  SDYTLTIEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRRE  225



>ref|NP_001146158.1| uncharacterized protein LOC100279727 [Zea mays]
 gb|ACL53373.1| unknown [Zea mays]
Length=476

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 0/191 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            +Q+LDAHWGV+ D D +G  SHTLS+LVND PGVLNL+TGV SRRGYNIQSLAVGPAE+E
Sbjct  286  SQILDAHWGVMTDGDPTGFCSHTLSILVNDVPGVLNLVTGVFSRRGYNIQSLAVGPAEKE  345

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            G SRITTV+PGTDE+I KL+   YKL+D++EVQD T LPFA RELM+IKVA NATARRD+
Sbjct  346  GTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDFTHLPFAARELMIIKVAANATARRDV  405

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVD  135
            LDIA IF A+ VD+SDHTITL LTG  ++++ LQ++LE YGICEVARTGR+AL+RESGVD
Sbjct  406  LDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLEQYGICEVARTGRIALLRESGVD  465

Query  134  STSLRGYCLPL  102
            S  LRG+ LPL
Sbjct  466  SKYLRGFSLPL  476


 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + S ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  66   NRSVMKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDK  123

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             + ++++   KLV++ +V DL+  P  ERELMLIKV        +I+ +  IF+A+ VD+
Sbjct  124  ILNQVVEQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDL  183

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            SD+T+T+E+TG   K++A+Q+ L  YGI E+ARTG++AL RE
Sbjct  184  SDYTLTIEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRRE  225



>ref|XP_010420316.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=481

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++Y+EDSSG +SHTLS+LV ++PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  293  VLDAHWGMVYEEDSSGNRSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  352

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTD+ I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + + RRDILD
Sbjct  353  SRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSTRRDILD  412

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+ G   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  413  IAHVFRAKAIDVSDHTITLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  472

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  473  YLRGYSLPL  481


 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAV   E + L   T V+ GTD+ +++
Sbjct  78   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVALNEDKAL--FTIVVLGTDKVLQQ  135

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   K+V++ +V+D+++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+H+
Sbjct  136  VVEQLNKIVNVIKVEDISKEPHVERELMLIKLNADPSTRSEIMWLMDIFRAKIVDTSEHS  195

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL+R LE +GI E+ARTG++AL RE
Sbjct  196  LTIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRRE  233



>ref|XP_009782836.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=454

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            ++SGL+SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAVG AE EGLSRITTV+PGTDE
Sbjct  278  ETSGLRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDE  337

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
            ++ KL+Q  YKLVDIHEV+D+T  PFAERELMLIK+AVNA ARR++LDIASIFRAK VDV
Sbjct  338  SVSKLVQQLYKLVDIHEVRDITHHPFAERELMLIKIAVNAAARRNVLDIASIFRAKAVDV  397

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            SDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALVRESGVDS  LRGY  PL
Sbjct  398  SDHTITLELTGDLHKMVALQRLLEPYGICEVARTGRLALVRESGVDSKYLRGYSYPL  454


 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+ + V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  ++++++
Sbjct  81   HTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVME  138

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV++ +V+DL++ P  ERELMLIK++ +   R +++ +  +FRAK VD+SDH++T+
Sbjct  139  QLQKLVNVIKVEDLSKDPQVERELMLIKISADPKYRTEVMWLVDVFRAKIVDISDHSLTI  198

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  199  EVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  233



>ref|XP_010453787.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic 
[Camelina sativa]
Length=479

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 165/189 (87%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++Y+EDSSG +SHTLS+LV ++PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  291  VLDAHWGMVYEEDSSGNRSHTLSILVANAPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  350

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTD+ I KL++   KL+D+HEVQ++T +PFAERELMLIKVA + + RRDILD
Sbjct  351  SRITTVIPGTDDHIDKLVRQLQKLIDLHEVQNITHMPFAERELMLIKVAAHTSTRRDILD  410

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+ G   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  411  IAHVFRAKAIDVSDHTITLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  470

Query  128  SLRGYCLPL  102
             LRG+ LPL
Sbjct  471  YLRGFSLPL  479


 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  76   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQ  133

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   K+V++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+H+
Sbjct  134  VVEQLNKIVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEHS  193

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL+R LE +GI E+ARTG++AL RE
Sbjct  194  LTIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRRE  231



>dbj|BAM75181.1| B3-type transcription factor [Ricinus communis]
Length=767

 Score =   301 bits (772),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++YDEDSSGL+SHTLS+LV + PGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  289  VLDAHWGMVYDEDSSGLRSHTLSLLVANVPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  348

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTDE I KL++   KL+D+ E+Q++T +PFAERELMLIKVA + +ARRD+LD
Sbjct  349  SRITTVIPGTDENIDKLVRQLQKLIDLQEIQNITHMPFAERELMLIKVAADTSARRDVLD  408

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+TG   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  409  IAQVFRAKAIDVSDHTITLEVTGDLRKMSALQTQLEAYGICEVARTGRVALVRESGVDST  468

Query  128  SLRGYCLPL  102
             LRGY LPL
Sbjct  469  YLRGYSLPL  477


 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  74   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQ  131

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+ +
Sbjct  132  VVEQLNKLVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLVDIFRAKIVDTSEQS  191

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL   LE +GI E+ARTG++AL RE
Sbjct  192  LTIEVTGDPGKMVALTTNLEKFGIKEIARTGKIALRRE  229



>ref|XP_010492512.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Camelina sativa]
Length=479

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  668  VLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGL  489
            VLDAHWG++Y+EDSSG +SHTLS+LV +SPGVLNL+TG ISRRGYNIQSLAVGPAE+EGL
Sbjct  291  VLDAHWGMVYEEDSSGNRSHTLSILVANSPGVLNLITGAISRRGYNIQSLAVGPAEKEGL  350

Query  488  SRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILD  309
            SRITTVIPGTD+ I KL++   KL+D+HEV ++T +PFAERELMLIKVA   + RRDILD
Sbjct  351  SRITTVIPGTDDHIDKLVRQLQKLIDLHEVHNITHMPFAERELMLIKVAAQTSTRRDILD  410

Query  308  IASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDST  129
            IA +FRAK +DVSDHTITLE+ G   K+ ALQ  LE YGICEVARTGRVALVRESGVDST
Sbjct  411  IAQVFRAKAIDVSDHTITLEVAGDLRKMAALQTQLEVYGICEVARTGRVALVRESGVDST  470

Query  128  SLRGYCLPL  102
             LRG+ LPL
Sbjct  471  YLRGFSLPL  479


 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  E + L   T V+ GTD+ +++
Sbjct  76   VRRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNEDKAL--FTIVVLGTDKVLQQ  133

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   K+V++ +V+DL++ P  ERELMLIK+  + + R +I+ +  IFRAK VD S+H+
Sbjct  134  VVEQLNKIVNVIKVEDLSKEPHVERELMLIKLNADPSTRSEIMWLMDIFRAKIVDTSEHS  193

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K++AL+R LE +GI E+ARTG++AL RE
Sbjct  194  LTIEVTGDPGKMVALERNLEKFGIKEIARTGKIALRRE  231



>sp|Q9SMC2.1|ILVH_NICPL RecName: Full=Acetolactate synthase small subunit 1, chloroplastic; 
AltName: Full=Acetohydroxy-acid synthase small subunit; 
Short=AHAS; Short=ALS; Flags: Precursor [Nicotiana plumbaginifolia]
 emb|CAB56614.1| acetolactate synthase small subunit [Nicotiana plumbaginifolia]
Length=449

 Score =   289 bits (740),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            ++D+  V+QVLDAHWGVL DED+SGL+SHTLSMLVND+PGVLN++TGV +RRGYNIQSLA
Sbjct  230  TDDNSGVSQVLDAHWGVLNDEDTSGLRSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLA  289

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE EGLSRITTV+PGTDE++ KL+Q  YKLVDIHEV+D+T LPFAERELMLIK+AVN
Sbjct  290  VGHAEVEGLSRITTVVPGTDESVSKLVQQLYKLVDIHEVRDITHLPFAERELMLIKIAVN  349

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVART  171
            A ARR++LDIASIFRAK VDVSDHTITLELTG  +K++ LQRLLEPYGICEVART
Sbjct  350  AAARRNVLDIASIFRAKAVDVSDHTITLELTGDLHKMVRLQRLLEPYGICEVART  404


 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 104/143 (73%), Gaps = 2/143 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  ++++++   KLV++ +V+
Sbjct  37   MINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVMEQLQKLVNVIKVE  94

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIK++ +   R +++ +  +FRAK VD+SD ++T+E+TG   K++A+
Sbjct  95   DLSKEPQVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDQSLTIEVTGDPGKMVAV  154

Query  215  QRLLEPYGICEVARTGRVALVRE  147
            QR L  +GI E+ARTG++AL RE
Sbjct  155  QRNLSKFGIREIARTGKIALRRE  177



>ref|XP_002449227.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
 gb|EES08215.1| hypothetical protein SORBIDRAFT_05g006620 [Sorghum bicolor]
Length=476

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S +    +Q+LDAHWGV+ D D +G  SHTLS+LVND PGVLN++TGV SRRGYNIQSLA
Sbjct  279  SYESFSSSQILDAHWGVMTDGDPTGFCSHTLSILVNDVPGVLNVVTGVFSRRGYNIQSLA  338

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPA +EG SRITTV+PG DE+I KL+   YKL+D+HEVQD T LPF  RELM+IKVA N
Sbjct  339  VGPAAKEGTSRITTVVPGNDESIAKLVHQLYKLIDVHEVQDFTHLPFVGRELMIIKVAAN  398

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            ATARRD+LDIA IF A+ VD+SDHTITL LTG  ++++ LQ++LE YGICEVARTGRVAL
Sbjct  399  ATARRDVLDIAQIFEAQKVDISDHTITLLLTGDIDRMVRLQKMLEQYGICEVARTGRVAL  458

Query  155  VRESGVDSTSLRGYCLPL  102
            +RESGVDS  LRG+ LPL
Sbjct  459  LRESGVDSKYLRGFSLPL  476


 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + S ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  67   NHSVIKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDK  124

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             + ++++   KLV++ +V DL+  P  ERELMLIKV        +I+ +  IF+A+ VD+
Sbjct  125  ILNQVVEQLNKLVNVIKVDDLSMEPQVERELMLIKVNAEREKLPEIMGLVRIFKAEVVDL  184

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            SDHT+T+E+TG   K++A+Q+ L  YGI E+ARTG++AL RE
Sbjct  185  SDHTLTIEVTGDPGKMVAIQKTLSKYGIREIARTGKIALRRE  226



>emb|CDX79442.1| BnaC03g17780D [Brassica napus]
Length=471

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 162/198 (82%), Gaps = 13/198 (7%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S  DL V +VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL             SLA
Sbjct  285  STSDLKVQRVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNL-------------SLA  331

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE +G+SRITTV+P TDE++ KL+Q  YKLVD+HEV DLT LPFAERELMLIK+AVN
Sbjct  332  VGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFAERELMLIKIAVN  391

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL
Sbjct  392  AAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVAL  451

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRGY  PL
Sbjct  452  ARESGVDSKYLRGYSFPL  469


 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  74   TSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERV  131

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRAK VD++
Sbjct  132  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNADPESRAEIMWLVDTFRAKVVDIA  191

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  192  EHALTIEVTGDPGKMIAVERNLKNFEIREIVRTGKIALRRE  232



>ref|XP_004169905.1| PREDICTED: acetolactate synthase small subunit-like, partial 
[Cucumis sativus]
Length=178

 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -1

Query  674  NQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAERE  495
            +QVLDAHWGVLYDEDSSG QSHTLS+LVND PGVLN++TG+ISRRGYNIQSLAVG AERE
Sbjct  15   DQVLDAHWGVLYDEDSSGHQSHTLSVLVNDYPGVLNVVTGIISRRGYNIQSLAVGHAERE  74

Query  494  GLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDI  315
            GLSRITTVIPGTDE+I KL+Q  +KL+D+HEV+DLT LPFAERELMLIK+A NATARRD+
Sbjct  75   GLSRITTVIPGTDESIGKLVQQLHKLIDLHEVRDLTHLPFAERELMLIKIAANATARRDV  134

Query  314  LDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICE  183
            LDIA IFRAK VDVS HTITL+LTG  NK++ALQRLLEP+GICE
Sbjct  135  LDIADIFRAKAVDVSGHTITLQLTGDLNKMVALQRLLEPFGICE  178



>emb|CDY34514.1| BnaC04g12850D [Brassica napus]
Length=468

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 162/195 (83%), Gaps = 13/195 (7%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V+ VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL             SLAVG 
Sbjct  285  DLMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNL-------------SLAVGH  331

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA A
Sbjct  332  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAA  391

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIAS+FRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  392  RRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  451

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  452  SGVDSNYLRGYSFPL  466


 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNIQSLAVG    + L   T V+ GT+  
Sbjct  71   NSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERV  128

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ + + FRA+ VD+S
Sbjct  129  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDIS  188

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  189  EHALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  229



>gb|AAD32291.1| putative acetolactate synthase [Arabidopsis thaliana]
Length=484

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 164/195 (84%), Gaps = 10/195 (5%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V+++LDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TG          SLAVG 
Sbjct  298  DPKVHRILDAHWGLLTDEDTSGLRSHTLSLLVNDIPGVLNIVTG----------SLAVGH  347

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTVIP TDE++ KL+Q  YKLVD+HEV DLT LPF+ERELMLIK+AVNA A
Sbjct  348  AETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAA  407

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  408  RRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  467

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  468  SGVDSKYLRGYSFPL  482


 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  82   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRA+ VD+++
Sbjct  140  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRV---ALVRE  147
            H +T+E+TG   K++A++R L+ + I E+ RTG+V   AL RE
Sbjct  200  HALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKVVYIALRRE  242



>emb|CDX84757.1| BnaA03g14730D [Brassica napus]
Length=467

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 162/198 (82%), Gaps = 13/198 (7%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S  DL V +VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL             SLA
Sbjct  281  STSDLKVQRVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNL-------------SLA  327

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VG AE +G+SRITTV+P TDE++ KL+Q  YKLVD+HEV DLT LPF+ERELMLIK+AVN
Sbjct  328  VGHAEAQGISRITTVVPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVN  387

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVAL  156
            A ARRD+LDIASIFRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL
Sbjct  388  AAARRDVLDIASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVAL  447

Query  155  VRESGVDSTSLRGYCLPL  102
             RESGVDS  LRGY  PL
Sbjct  448  ARESGVDSKYLRGYSFPL  465


 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  70   TSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVSGTERV  127

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +   R +I+ +   FRAK VD++
Sbjct  128  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPEYRAEIMWLVDTFRAKVVDIA  187

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  188  EHALTIEVTGDPGKMIAVERNLKKFEIREIVRTGKIALRRE  228



>emb|CDY42070.1| BnaA05g11160D [Brassica napus]
Length=469

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 162/195 (83%), Gaps = 13/195 (7%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D+ V+ VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL             SLAVG 
Sbjct  286  DVMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNL-------------SLAVGH  332

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA A
Sbjct  333  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAA  392

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIAS+FRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEVARTGRVAL RE
Sbjct  393  RRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARE  452

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  453  SGVDSNYLRGYSFPL  467


 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 112/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNIQSLAVG    + L   T V+ GT+  
Sbjct  72   NSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERV  129

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ + + FRA+ VD+S
Sbjct  130  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDIS  189

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L  + I E+ RTG++AL RE
Sbjct  190  EHALTIEVTGDPGKMIAVERNLRKFQIREIVRTGKIALRRE  230



>ref|XP_006448524.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
 gb|ESR61764.1| hypothetical protein CICLE_v10015040mg [Citrus clementina]
Length=489

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            DD   NQVLDAHWG+LYDED SGL+SHTLSMLVN++PGVLN++TGVISRRGYNIQSLAVG
Sbjct  289  DDFSANQVLDAHWGILYDEDPSGLRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQSLAVG  348

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EGLSRITTV+PGTDE+I KL+Q  +KL+D+HEVQD+T LPFAEREL+LIK+AVN  
Sbjct  349  PAEKEGLSRITTVVPGTDESIGKLVQLLHKLIDLHEVQDITHLPFAERELILIKIAVNTA  408

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEV  180
            ARRD+LD A IFRA+ VDVSDHTITLELTG  NK++ALQRLLEPYGICE+
Sbjct  409  ARRDVLDTAKIFRARAVDVSDHTITLELTGDLNKIIALQRLLEPYGICEL  458


 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 116/173 (67%), Gaps = 2/173 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  
Sbjct  74   ASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKAL--FTIVVSGTERV  131

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            +R++++   KLV++ +V+D++  P  ERELMLIK+  + +   +I+ +  IFRAK VD+S
Sbjct  132  LRQVVEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDIS  191

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYC  111
            +H +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE   D+     + 
Sbjct  192  EHALTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPFWNFS  244



>gb|KCW46078.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 158/197 (80%), Gaps = 18/197 (9%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
             D    NQVLDAHWGVL DED+SGL+SHTLSM+V D+PGVLN++TGV SRRGYNIQSLAV
Sbjct  195  TDGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAV  254

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HE                  +AVNA
Sbjct  255  GHSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHE------------------IAVNA  296

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
             ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEVARTGR+ALV
Sbjct  297  AARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVARTGRIALV  356

Query  152  RESGVDSTSLRGYCLPL  102
            RESGVDS  LRGY  P+
Sbjct  357  RESGVDSKHLRGYAFPV  373


 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  ++++++   KLV++ +V+
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIKV      R +I+ +  IFRAK VD+S+H++T+E+TG   K++A+
Sbjct  59   DLSKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAV  118

Query  215  QRLLEPYGICEVARTGRVALVRES  144
            QR L  +GI E+ARTG++AL RE 
Sbjct  119  QRNLSKFGIREIARTGKIALRREK  142



>ref|XP_006446200.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
 gb|ESR59440.1| hypothetical protein CICLE_v10015044mg [Citrus clementina]
Length=469

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D L VNQVLD HWGVL D+D+SGL+SHTLSMLVNDSPGVLN++TGV +RRGYNIQSLAV
Sbjct  292  SDGLTVNQVLDPHWGVLNDDDTSGLRSHTLSMLVNDSPGVLNIVTGVFARRGYNIQSLAV  351

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE EGLSRITTV+P TDE+I KL+Q  YKL+D+HEV+DLT LPFAERELMLIKVAVN 
Sbjct  352  GHAETEGLSRITTVVPATDESISKLMQQLYKLIDLHEVRDLTHLPFAERELMLIKVAVNT  411

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVA  177
            TARRD+LDIA+IFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGICEV 
Sbjct  412  TARRDVLDIATIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVC  463


 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 115/162 (71%), Gaps = 2/162 (1%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            + + ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD+
Sbjct  80   NRTNVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVYGTDK  137

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
             ++++++   KLV++ +V+DL+  P  ERELMLIKV  +   R +I  +  IFRAK VD+
Sbjct  138  VLQQVMEQLQKLVNVLKVEDLSNEPQVERELMLIKVNADPKFRAEIRWLVDIFRAKIVDI  197

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            S++++T+E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  198  SEYSLTIEVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  239



>gb|KCW46079.1| hypothetical protein EUGRSUZ_L00052 [Eucalyptus grandis]
Length=373

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            D    NQVLDAHWGVL DED+SGL+SHTLSM+V D+PGVLN++TGV SRRGYNIQSLAVG
Sbjct  196  DGFSFNQVLDAHWGVLNDEDTSGLRSHTLSMIVKDAPGVLNIITGVFSRRGYNIQSLAVG  255

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
             +E EGLSRITTV+PGTDE+I KL+Q  YKLVD+HEV+DLT +PFAERELMLIK+AVNA 
Sbjct  256  HSEVEGLSRITTVVPGTDESISKLVQQLYKLVDLHEVKDLTHIPFAERELMLIKIAVNAA  315

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGIC  186
            ARRD+LDIASIFRAK VDVSDHTITLELTG  +K++ALQRLLEPYGIC
Sbjct  316  ARRDVLDIASIFRAKAVDVSDHTITLELTGDLDKMVALQRLLEPYGIC  363


 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 102/143 (71%), Gaps = 2/143 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNI+SLAVG  +   L   T V+ GT+  ++++++   KLV++ +V+
Sbjct  1    MINRIAGVFARRGYNIESLAVGLNKDRAL--FTIVVSGTERVLQQVMEQLQKLVNVLKVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            DL++ P  ERELMLIKV      R +I+ +  IFRAK VD+S+H++T+E+TG   K++A+
Sbjct  59   DLSKEPQVERELMLIKVGAKPEHRAEIMYLVDIFRAKIVDISEHSVTIEVTGDPGKMVAV  118

Query  215  QRLLEPYGICEVARTGRVALVRE  147
            QR L  +GI E+ARTG++AL RE
Sbjct  119  QRNLSKFGIREIARTGKIALRRE  141



>ref|XP_009144046.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X2 [Brassica rapa]
Length=379

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V+ VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL+TGV +RRGYNIQSLAVG 
Sbjct  197  DLMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGH  256

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA A
Sbjct  257  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAA  316

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVA  177
            RRD+LDIAS+FRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEV+
Sbjct  317  RRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVS  366


 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N + GV +RRGYNIQSLAVG    + L   T V+ GT+  ++++++   KLV++ +V+
Sbjct  1    MINRIAGVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERVLQQVIEQLQKLVNVLKVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLAL  216
            D++  P  ERELML+KV  +  +R +I+ + + FRA+ VD+S+H +T+E+TG   K++A+
Sbjct  59   DISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDISEHALTIEVTGDPGKMIAV  118

Query  215  QRLLEPYGICEVARTGRVALVRES  144
            +R L+ + I E+ RTG++AL RE 
Sbjct  119  ERNLKKFQIREIVRTGKIALRREK  142



>ref|XP_009144045.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=457

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V+ VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL+TGV +RRGYNIQSLAVG 
Sbjct  275  DLMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGH  334

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA A
Sbjct  335  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAA  394

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVA  177
            RRD+LDIAS+FRAK VDVSDHTITL+LTG  +K++ALQRLLEPYGICEV+
Sbjct  395  RRDVLDIASVFRAKTVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVS  444


 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNIQSLAVG    + L   T V+ GT+  
Sbjct  61   NSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERV  118

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ + + FRA+ VD+S
Sbjct  119  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDIS  178

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  179  EHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  219



>ref|XP_004490062.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=564

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 155/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            +D   VNQVLDAHWGVL +ED+SG++SHTLSMLVND+PGVLN +TGV +RRGYNIQSLAV
Sbjct  279  SDSFTVNQVLDAHWGVLNEEDTSGIRSHTLSMLVNDAPGVLNCVTGVFARRGYNIQSLAV  338

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +E EG+SR+TTV+PGTDE+I KL+Q  YKLV++HEV+D+T +PFAERELMLIK+AVNA
Sbjct  339  GHSEVEGVSRLTTVVPGTDESISKLVQQLYKLVELHEVRDITHVPFAERELMLIKIAVNA  398

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVA  177
             ARRD+LDIASIFRA+ VDVSDHTITLELTG  +K++ALQRLLEPYGICEV 
Sbjct  399  AARRDVLDIASIFRARAVDVSDHTITLELTGDLDKMVALQRLLEPYGICEVC  450


 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 112/168 (67%), Gaps = 2/168 (1%)
 Frame = -1

Query  650  GVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTV  471
            G +     S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  +   L  I  V
Sbjct  60   GPVTSPSRSKVRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNQDRALFSI--V  117

Query  470  IPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFR  291
            + GT+  ++++++   KLV++ +V+DL+  P  ERELML+KV  +   R +I  +   FR
Sbjct  118  VSGTNRVLQQVVEQLQKLVNVLKVEDLSNEPQVERELMLLKVNADPQNRAEIKWLVDTFR  177

Query  290  AKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
             K VD+S++++T+E+TG   K++A+QR L  +GI E++RTG++AL RE
Sbjct  178  GKIVDISENSVTIEVTGDPGKMVAVQRSLSKFGIKEISRTGKIALRRE  225



>ref|XP_009625351.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=454

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            ++SGL SHTLSMLVND+PGVLN++TGV +RRGYNIQSLAVG AE EGLSRITTV+PGTDE
Sbjct  278  ETSGLHSHTLSMLVNDTPGVLNIVTGVFARRGYNIQSLAVGHAEVEGLSRITTVVPGTDE  337

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
            ++ KL+Q  YKLVDIHEV+D+T  PFAERELMLIK+A NA ARR++LDIASIFRAK VDV
Sbjct  338  SVSKLVQQLYKLVDIHEVRDITHHPFAERELMLIKIAANAAARRNVLDIASIFRAKAVDV  397

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRGYCLPL  102
            SDHTITLELTG  +K++ALQRLLEP GICEVARTGR+ALVRESGVDS  LRGY  PL
Sbjct  398  SDHTITLELTGDLHKMVALQRLLEPCGICEVARTGRLALVRESGVDSKYLRGYSYPL  454


 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+ + V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT+  ++++++
Sbjct  81   HTIQVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTERVLQQVME  138

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV++ +V+DL++ P  ERELMLIK++ +   R +++ +  +FRAK VD+SDH++T+
Sbjct  139  QLQKLVNVIKVEDLSKEPQVERELMLIKISADPKYRAEVMWLVDVFRAKIVDISDHSLTI  198

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            E+TG   K++A+QR L  +GI E+ARTG++AL RE
Sbjct  199  EVTGDPGKMVAVQRNLSKFGIREIARTGKIALRRE  233



>gb|EMT12300.1| Acetolactate synthase small subunit [Aegilops tauschii]
Length=432

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 160/189 (85%), Gaps = 7/189 (4%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            + L +NQVLDAHWGVL DEDS+GL+SHTLS+LVND PGVLN++TGV +RRGY+IQSLAVG
Sbjct  221  ESLSMNQVLDAHWGVLDDEDSNGLRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVG  280

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTDE+I KL+Q  YKL+D+H+V DLT LPFAERELM+IKV+ N  
Sbjct  281  PAEKEGISRITTVVPGTDESIEKLVQQLYKLIDVHKVDDLTDLPFAERELMVIKVSGNTA  340

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
            ARR+ILDI +IFRA+ VD+SDHT+TL+LTG  +K++ALQRLLEPYGICE        ++R
Sbjct  341  ARREILDIGNIFRAECVDLSDHTVTLQLTGDLDKMVALQRLLEPYGICE-------PVMR  393

Query  149  ESGVDSTSL  123
             SG +  SL
Sbjct  394  ISGYNCRSL  402


 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  +++
Sbjct  10   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQ  67

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R D++ +A++FRAK VD+S+++
Sbjct  68   VIEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVEPDQRADVMFVANVFRAKVVDISENS  127

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +TLE+TG   K++A QR L  +GI E+ RTG++AL RE
Sbjct  128  LTLEVTGDPGKIVAAQRNLRKFGIEEICRTGKIALRRE  165



>gb|EMS53688.1| Acetolactate synthase small subunit [Triticum urartu]
Length=384

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = -1

Query  689  DDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVG  510
            + L +NQVLDAHWGVL DEDS+GL+SHTLS+LVND PGVLN++TGV +RRGY+IQSLAVG
Sbjct  214  ESLSMNQVLDAHWGVLDDEDSNGLRSHTLSILVNDCPGVLNIITGVFARRGYSIQSLAVG  273

Query  509  PAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNAT  330
            PAE+EG+SRITTV+PGTDE+I KL+Q  YKL+D+H+V DLT LPFAERELM+IKV+ N  
Sbjct  274  PAEKEGISRITTVVPGTDESIEKLVQQLYKLIDVHKVDDLTDLPFAERELMVIKVSGNTA  333

Query  329  ARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICE  183
            ARR+ILDI +IFRA+ VD+SDHT+TL+LTG  +K++ALQRLLEPYGICE
Sbjct  334  ARREILDIGNIFRAECVDLSDHTVTLQLTGDLDKMVALQRLLEPYGICE  382


 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 113/159 (71%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  +++
Sbjct  3    VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLKQ  60

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R D++ +A++FRAK VD+S+++
Sbjct  61   VIEQLNKLVNVLNVEDLSKEPQVERELMLIKLNVEPDQRADVMFVANVFRAKVVDISENS  120

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +TLE+TG   K++A QR L  +GI E+ RTG++AL RE 
Sbjct  121  LTLEVTGDPGKIVAAQRNLRKFGIEEICRTGKIALRREK  159



>ref|XP_001773408.1| predicted protein [Physcomitrella patens]
 gb|EDQ61781.1| predicted protein, partial [Physcomitrella patens]
Length=417

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 156/193 (81%), Gaps = 0/193 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            ND ++ +Q+LDAHWG + ++D SG  SHTL +LVND+PGVLN +TGV +RRGYNIQSLAV
Sbjct  217  NDGVWYHQILDAHWGGVEEDDPSGFISHTLGILVNDAPGVLNRVTGVFARRGYNIQSLAV  276

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            GPAE  G SRI TV+PGTDE+I+KLL    KL+D+  VQD+T  PF+ERELMLIKVA  +
Sbjct  277  GPAETPGTSRILTVVPGTDESIKKLLSQLSKLIDVLAVQDITHQPFSERELMLIKVAATS  336

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
              RR++LD+A+IFRAKPVD+S+ TITLELTG   K+ ALQRLLEP+GI EVARTGRVALV
Sbjct  337  DVRREVLDVAAIFRAKPVDLSNRTITLELTGDLEKMAALQRLLEPFGILEVARTGRVALV  396

Query  152  RESGVDSTSLRGY  114
            R  GVD+  LR +
Sbjct  397  RGGGVDTKYLRQF  409


 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ +T+S+ V D  G++N + GVI+RRGYNI+SLAVG  + + L   T V+ GTD  +++
Sbjct  3    VRRYTISVFVGDESGMINRIAGVIARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLQQ  60

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV + +V DL++ P  ERELML+KV V  T R ++L +  IFRA+ VDV++ +
Sbjct  61   VMKQLSKLVSVKQVADLSKEPRVERELMLLKVNVGPTQRAEVLGLVEIFRARIVDVAEES  120

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+TG   K+ A+Q  +  +GI E+ARTG++AL RE
Sbjct  121  LTIEVTGDPGKIAAMQATMGKFGIKELARTGKIALRRE  158



>ref|NP_850174.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
 gb|AEC08588.1| ACT domain-containing small subunit of acetolactate synthase 
protein [Arabidopsis thaliana]
Length=469

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 153/195 (78%), Gaps = 22/195 (11%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            D  V+++LDAHWG+L DED+SGL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLAVG 
Sbjct  295  DPKVHRILDAHWGLLTDEDTSGLRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGH  354

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE +G+SRITTVIP TDE++ KL+Q  YKLVD+HEV DLT LPF+ERELMLIK+AVNA A
Sbjct  355  AETKGISRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAA  414

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIASIFRAK VDVSDHTITL                      +VARTGRVAL RE
Sbjct  415  RRDVLDIASIFRAKAVDVSDHTITL----------------------QVARTGRVALARE  452

Query  146  SGVDSTSLRGYCLPL  102
            SGVDS  LRGY  PL
Sbjct  453  SGVDSKYLRGYSFPL  467


 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 111/160 (69%), Gaps = 2/160 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG    + L   T V+ GT+  +
Sbjct  82   SKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNRDKAL--FTIVVCGTERVL  139

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            +++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ +   FRA+ VD+++
Sbjct  140  QQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVDTFRARVVDIAE  199

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  200  HALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  239



>ref|XP_002979412.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
 gb|EFJ19301.1| hypothetical protein SELMODRAFT_111081 [Selaginella moellendorffii]
Length=414

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            ++ ++ +QVLD  WG +   + +G  SHTLSM+VND+PGVLN +TGV +RRGYNIQSLAV
Sbjct  215  DEGVWSHQVLDPDWGDVEAAEPNGYMSHTLSMVVNDAPGVLNRVTGVFARRGYNIQSLAV  274

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +ER+G+SRITTV+PGTDE+IRKLL    KL+D+ +VQD+T LPFA+RELMLIK++   
Sbjct  275  GLSERQGISRITTVVPGTDESIRKLLHQLSKLIDVVQVQDITHLPFAQRELMLIKISALP  334

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRDILDIA++FRAK VD+S+ +ITLELTG   K+ ALQ LLEPYGI EVARTGR+ALV
Sbjct  335  SARRDILDIANVFRAKTVDLSNRSITLELTGDLEKMAALQHLLEPYGILEVARTGRLALV  394

Query  152  RESGVDSTSLRGYCLPL  102
            R+SGVDS  L G   PL
Sbjct  395  RDSGVDS-KLLGQLQPL  410


 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            +Q +T+S+ V D  G++N + GV SRRGYNI+SLAVG    + L   T V+ GTD  +++
Sbjct  4    IQRYTISVFVGDESGMINRIAGVFSRRGYNIESLAVGLNRDKAL--FTIVVSGTDRVLQQ  61

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++  YKLV++ +V+DL++ P  ERELML+KV V A  R ++L +  IFRA+ VDV++ +
Sbjct  62   VMKQLYKLVNVRKVEDLSKKPRVERELMLLKVNVPAAQRTEVLGLVDIFRARVVDVAEDS  121

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +TLE+TG   KL +L+R +  +GI E+ARTG+++L+R+
Sbjct  122  LTLEVTGDAGKLASLERRMTKFGIKELARTGKISLLRD  159



>ref|XP_002977907.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
 gb|EFJ21245.1| hypothetical protein SELMODRAFT_107328 [Selaginella moellendorffii]
Length=412

 Score =   252 bits (643),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            ++ ++ +QVLD  WG +   + +G  SHTLSM+VND+PGVLN +TGV +RRGYNIQSLAV
Sbjct  215  DEGVWSHQVLDPDWGDVEAAEPNGYMSHTLSMVVNDAPGVLNRVTGVFARRGYNIQSLAV  274

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G +ER+G+SRITTV+PGTDE+IRKLL    KL+D+  VQD+T LPFA+RELMLIK++   
Sbjct  275  GLSERQGISRITTVVPGTDESIRKLLHQLSKLIDV--VQDITHLPFAQRELMLIKISALP  332

Query  332  TARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALV  153
            +ARRDILDIA++FRAK VD+S+ +ITLELTG   K+ ALQ LLEPYGI EVARTGR+ALV
Sbjct  333  SARRDILDIANVFRAKIVDLSNRSITLELTGDLEKMAALQHLLEPYGILEVARTGRLALV  392

Query  152  RESGVDSTSLRGYCLPL  102
            R+SGVD T L G   PL
Sbjct  393  RDSGVD-TKLLGQLQPL  408


 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            +Q +T+S+ V D  G++N + GV SRRGYNI+SLAVG    + L   T V+ GTD  +++
Sbjct  4    IQRYTISVFVGDESGMINRIAGVFSRRGYNIESLAVGLNRDKAL--FTIVVSGTDRVLQQ  61

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++  YKLV++ +V+DL++ P  ERELML+KV V A  R ++L +  IFRA+ VDV++ +
Sbjct  62   VMKQLYKLVNVRKVEDLSKKPRVERELMLLKVNVPAAQRTEVLGLVDIFRARVVDVAEDS  121

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +TLE+TG   KL +L+R +  +GI E+ARTG+++L+R+
Sbjct  122  LTLEVTGDAGKLASLERRMTKFGIKELARTGKISLLRD  159



>ref|XP_010910806.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
[Elaeis guineensis]
Length=309

 Score =   246 bits (629),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            V+QVLDAHWGVL DEDSSGL SHTLS+LVNDSPGVLN++TGV SRRGYNIQSLAVGPAE 
Sbjct  130  VSQVLDAHWGVLDDEDSSGLCSHTLSILVNDSPGVLNIVTGVFSRRGYNIQSLAVGPAEE  189

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EG+SRITTV+PGTDE+I KL+Q  YKL+D+HEVQD+T LPFAERELMLIKVAVN  ARRD
Sbjct  190  EGISRITTVVPGTDESIGKLVQQLYKLIDVHEVQDITHLPFAERELMLIKVAVNTAARRD  249

Query  317  ILDIASIFRAKPVDVSDHTITLE  249
            ILDIA IFRAK VDVSDHTITL+
Sbjct  250  ILDIADIFRAKAVDVSDHTITLQ  272


 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -1

Query  359  MLIKVAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEV  180
            MLIK+ V    R++++ +  IFRAK VD+S+H++T+E+TG   K++A+QR L  +GI E+
Sbjct  1    MLIKLNVGPERRQEVMGLVDIFRAKVVDISEHSLTIEVTGDPGKIVAVQRNLHKFGIKEI  60

Query  179  ARTGRVALVRE  147
            ARTG++AL RE
Sbjct  61   ARTGKIALRRE  71



>ref|XP_011014719.1| PREDICTED: acetolactate synthase small subunit 1, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=446

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  692  NDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAV  513
            NDD  VNQVLDA+WGVLYDEDS+GL+SHTLSMLVN+ PGVLN+LTGVISRRGYNIQSLAV
Sbjct  294  NDDFLVNQVLDANWGVLYDEDSNGLRSHTLSMLVNNCPGVLNILTGVISRRGYNIQSLAV  353

Query  512  GPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNA  333
            G AE+EGLSRITTVIPGTDE+I KL+Q  +KL+D HEV+D+T  PFAEREL LIK+A N+
Sbjct  354  GHAEKEGLSRITTVIPGTDESIGKLVQQLHKLIDFHEVRDITHSPFAERELTLIKIAANS  413

Query  332  TARRDILDIASIFRAKPVDVSDHTITLE  249
             ARRD+LDIA IFRAK VDVSDHTITLE
Sbjct  414  AARRDVLDIARIFRAKAVDVSDHTITLE  441


 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S +Q HT+S+ V D  G++N + GV +RRGY+I+SLAVG  + + L   T V+ GT+E +
Sbjct  75   SKMQRHTISVFVGDEIGIINRIAGVFARRGYSIESLAVGLNKDKAL--FTIVVCGTEEVL  132

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
            R++++   KLV + +V+D++R P  ERELMLIK+  N + R +I+ +  IFRA  VD+S+
Sbjct  133  RQVVEQLNKLVTVIKVEDISRDPQVERELMLIKLNANPSTRAEIMWLVDIFRATIVDISE  192

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            H++T+E+TG   K+ A+QR L  +GI E+ARTG++AL RE+
Sbjct  193  HSLTIEVTGDPGKMAAVQRNLSKFGIKELARTGKIALRRET  233



>ref|XP_009144047.1| PREDICTED: acetolactate synthase small subunit 2, chloroplastic 
isoform X3 [Brassica rapa]
Length=446

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 147/195 (75%), Gaps = 25/195 (13%)
 Frame = -1

Query  686  DLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGP  507
            DL V+ VLDAHWG+L DED+SGL+SHTLS+LVND PGVLNL+TGV +RRGYNIQSLAVG 
Sbjct  275  DLMVHHVLDAHWGLLTDEDTSGLRSHTLSLLVNDVPGVLNLVTGVFARRGYNIQSLAVGH  334

Query  506  AEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATA  327
            AE EG+SRITTV+P TDE++ KL+Q  YKLVD+HEV+DLT LPFAERELMLIK+AVNA A
Sbjct  335  AETEGISRITTVVPATDESVSKLVQQLYKLVDVHEVRDLTHLPFAERELMLIKIAVNAAA  394

Query  326  RRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            RRD+LDIAS+FRAK VDVSDHTITL++    +  L+L R                     
Sbjct  395  RRDVLDIASVFRAKTVDVSDHTITLQVKYTLS--LSLSR---------------------  431

Query  146  SGVDSTSLRGYCLPL  102
              VDS  LRGY  PL
Sbjct  432  --VDSNYLRGYSFPL  444


 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 113/161 (70%), Gaps = 2/161 (1%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +S ++ HT+S+ V D  G++N + GV +RRGYNIQSLAVG    + L   T V+ GT+  
Sbjct  61   NSKVRKHTISVFVGDESGMINRIAGVFARRGYNIQSLAVGLNRDKAL--FTIVVSGTERV  118

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            ++++++   KLV++ +V+D++  P  ERELML+KV  +  +R +I+ + + FRA+ VD+S
Sbjct  119  LQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESRAEIMWLVNTFRARVVDIS  178

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +H +T+E+TG   K++A++R L+ + I E+ RTG++AL RE
Sbjct  179  EHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRRE  219



>ref|XP_010101349.1| Acetolactate synthase small subunit [Morus notabilis]
 gb|EXB88296.1| Acetolactate synthase small subunit [Morus notabilis]
Length=401

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  629  SSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDET  450
            +SG +SHTLS+LVND+PGVL ++TGV +RRGYNIQSLAVG AE EGLSRITTV+P TDE+
Sbjct  231  TSGFRSHTLSILVNDAPGVLYIVTGVFARRGYNIQSLAVGHAETEGLSRITTVVPATDES  290

Query  449  IRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVS  270
            I KL+Q  YKLVD+HEV+D+T LPFAEREL+LIK+AVNA+ARRDILDIA+IFRAK VDVS
Sbjct  291  ITKLVQQLYKLVDVHEVRDITHLPFAERELVLIKLAVNASARRDILDIANIFRAKSVDVS  350

Query  269  DHTITLELTGAFNKLLALQRLLEPYGICEVA  177
            DHTIT+ELTG  +K++ALQRLLEPYGICE++
Sbjct  351  DHTITIELTGDLDKIIALQRLLEPYGICELS  381


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 79/160 (49%), Gaps = 54/160 (34%)
 Frame = -1

Query  626  SGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETI  447
            S ++ HT+S+ V D  G++N + GV +RRGYNI SLAV      GL++            
Sbjct  80   SKVRRHTISVFVGDESGMINRIAGVFARRGYNIDSLAV------GLNK------------  121

Query  446  RKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSD  267
                                     ++ L  I           I+ +   FRAK VD+S+
Sbjct  122  -------------------------DKALFTI-----------IMWLVDTFRAKIVDISE  145

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
             ++T+E+TG   K++ALQR L  +GI E+ARTG++AL RE
Sbjct  146  LSLTIEVTGDPGKMVALQRNLSKFGIKEIARTGKIALRRE  185



>ref|XP_008677344.1| PREDICTED: acetolactate synthase/ amino acid binding protein 
isoform X1 [Zea mays]
Length=446

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  695  SNDDLFVNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLA  516
            S + L VN VLDAHWGVL D+D++GL+SHTLS+LVND PGVLN++TGV +RRGYNIQSLA
Sbjct  286  SYESLSVNHVLDAHWGVLDDDDATGLRSHTLSILVNDCPGVLNIVTGVFARRGYNIQSLA  345

Query  515  VGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVN  336
            VGPAE+EG+SRITTV+PGT E+I KL+Q  YKL+D+HEV D+T  PFAERELMLIKV+VN
Sbjct  346  VGPAEKEGISRITTVVPGTVESIEKLVQQLYKLIDVHEVHDITHSPFAERELMLIKVSVN  405

Query  335  ATARRDILDIASIFRAKPVDVSDHTITLE  249
              AR++ILDIA IFRAKPVDVSDHT+TL+
Sbjct  406  TAARKEILDIAEIFRAKPVDVSDHTVTLQ  434


 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HT+S+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GTD  + +
Sbjct  77   VRRHTISVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDRVLNQ  134

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++  V+DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+S+ T
Sbjct  135  VIEQLNKLVNVLSVEDLSKEPQVERELMLIKLNVEPDQRPEVMVLVDIFRAKVVDISEKT  194

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRE  147
            +T+E+ G   K+ A+QR L  +GI E+ RTG++AL RE
Sbjct  195  LTMEVAGDPGKIAAVQRNLWKFGIKEICRTGKIALRRE  232



>gb|EAZ36982.1| hypothetical protein OsJ_21322 [Oryza sativa Japonica Group]
Length=358

 Score =   229 bits (584),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  527  QSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIK  348
            QSLAVGPAE+EG SRITTV+PGTDE+I KL+   YKL+D++EVQDLT LPFA RELM+IK
Sbjct  217  QSLAVGPAEKEGTSRITTVVPGTDESIAKLVHQLYKLIDVYEVQDLTHLPFAARELMIIK  276

Query  347  VAVNATARRDILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTG  168
            +AVN TARR ILDIA IFRAK VDVSDHT+TL+LTG  +K++ALQR+LEPYGICEVARTG
Sbjct  277  IAVNTTARRAILDIADIFRAKTVDVSDHTVTLQLTGDLDKMVALQRMLEPYGICEVARTG  336

Query  167  RVALVRESGVDSTSLRGYCLPL  102
            RVAL RESGVDS  LRG+ LPL
Sbjct  337  RVALRRESGVDSKYLRGFSLPL  358


 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 114/159 (72%), Gaps = 2/159 (1%)
 Frame = -1

Query  620  LQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRK  441
            ++ HTLS+ V D  G++N + GV +RRGYNI+SLAVG  + + L   T V+ GT++ +++
Sbjct  17   IKRHTLSVFVGDESGMINRIAGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTEKILKQ  74

Query  440  LLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHT  261
            +++   KLV++ +V DL++ P  ERELMLIK+ V    R +++ +  IFRAK VD+SDHT
Sbjct  75   VVEQLNKLVNVIQVDDLSKEPQVERELMLIKLNVEPDKRPEVMGLVDIFRAKVVDLSDHT  134

Query  260  ITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRES  144
            +T+E+TG   K++A+QR L  +GI E+ARTG++AL RE 
Sbjct  135  LTIEVTGDPGKIVAVQRNLSKFGIKEIARTGKIALRREK  173



>ref|XP_011464846.1| PREDICTED: LOW QUALITY PROTEIN: acetolactate synthase small subunit 
2, chloroplastic-like [Fragaria vesca subsp. vesca]
Length=357

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 133/192 (69%), Gaps = 35/192 (18%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            VN +L+A+WGV  DEDS                                   LAVG AE 
Sbjct  201  VNXILNANWGVPNDEDS-----------------------------------LAVGHAEV  225

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EG SRIT V+P TDE+I KL+Q  YKLVD+H+V+DLT  PFAERELMLIK+A NA ARRD
Sbjct  226  EGQSRITAVVPATDESISKLVQQLYKLVDVHDVRDLTNFPFAERELMLIKIAANAVARRD  285

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            +LDI +IFRAK VDVSDHTITLELTG  NK++ALQRLLEP GICEVARTGR+ALVRESGV
Sbjct  286  VLDIGNIFRAKAVDVSDHTITLELTGDLNKMVALQRLLEPCGICEVARTGRIALVRESGV  345

Query  137  DSTSLRGYCLPL  102
            DS  L GY LPL
Sbjct  346  DSRYLCGYSLPL  357


 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 104/147 (71%), Gaps = 9/147 (6%)
 Frame = -1

Query  575  VLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQ  396
            ++N ++GV +RRGYNI+SLAVG  + + L   T V+ GTD  +R+ ++  +KLV++ +V+
Sbjct  1    MINRISGVFARRGYNIESLAVGLNKDKAL--FTIVVSGTDTVLRQAIEQLHKLVNVLKVE  58

Query  395  DLTRLPFAERELMLIKVAVNATARRD----ILDIASIFRAKPVDVSDHTITLELTGAFNK  228
            DL+  P  ERELML+KV    TA  D    I  I +IFRAK VD+SDH++T+E+TG   K
Sbjct  59   DLSSEPQVERELMLLKVT---TAHPDYVAEIKWIVNIFRAKIVDISDHSVTIEVTGDPGK  115

Query  227  LLALQRLLEPYGICEVARTGRVALVRE  147
            ++ALQR L  +GI E+ARTG++AL RE
Sbjct  116  MVALQRNLSKFGIREIARTGKIALRRE  142



>ref|WP_015230978.1| acetolactate synthase small subunit [Dactylococcopsis salina]
 gb|AFZ52004.1| acetolactate synthase, small subunit [Dactylococcopsis salina 
PCC 8305]
Length=176

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRGYNI+SLAVGPAE+EG+SRIT V+PG D TI +L 
Sbjct  3    KHTLSVLVEDEAGVLTRIAGLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLT  62

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+LP  ERELMLIKV   A+ R +++++A +FRA+ VD+S+ T+T
Sbjct  63   KQLYKLINVLKVQDVTQLPCVERELMLIKVNATASGRAEVIELAQVFRARVVDISEDTLT  122

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +GI E+ARTG++ LVR+SGV++  L+
Sbjct  123  LEVVGDPGKMVAIIKMLHKFGIREIARTGKITLVRDSGVNTEYLK  167



>ref|WP_015227737.1| acetolactate synthase small subunit [Halothece sp. PCC 7418]
 gb|AFZ45866.1| acetolactate synthase, small subunit [Halothece sp. PCC 7418]
Length=176

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRGYNI+SLAVGPAE+EG+SRIT V+PG D TI +L 
Sbjct  3    KHTLSVLVQDEAGVLTRIAGLFARRGYNIESLAVGPAEKEGISRITMVVPGDDRTIEQLT  62

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T++P  ERELMLIKV+  A++R +++++A +FRA+ VD+++ ++T
Sbjct  63   KQLYKLINVLKVQDVTQVPSVERELMLIKVSATASSRAEVIELAQVFRARVVDIAEDSLT  122

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ +LL  +GI E+ARTG++ L+RESGV++  L+
Sbjct  123  LEVVGDPGKMVAIIQLLSKFGIREIARTGKITLMRESGVNTEYLK  167



>ref|WP_012195782.1| acetolactate synthase [Prochlorococcus marinus]
 gb|ABX09161.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9211]
Length=176

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  G L+ ++G+ +RRG+NI+SLAVGPAE +G+SR+T V+ G +ET++++ 
Sbjct  2    KHTLSVLVEDQSGALSRISGLFARRGFNIESLAVGPAEAKGISRLTMVVEGDEETLQQMT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +   KLV++  V DLTRLP  ERELML+KV+    AR+DILD+  +FRAK VDVSD  + 
Sbjct  62   KQLDKLVNVLNVIDLTRLPAVERELMLLKVSAKKDARKDILDLVQVFRAKVVDVSDEALI  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR----GYCLP  105
            LE+ G   KL+AL++LL+PYGI E+ARTG+VAL R SGV++  L+    G  LP
Sbjct  122  LEVVGDPGKLVALEKLLKPYGILEIARTGKVALKRASGVNTEMLKSTSSGINLP  175



>sp|Q9MS98.1|ILVH_GALSU RecName: Full=Acetolactate synthase small subunit; AltName: Full=Acetohydroxy-acid 
synthase small subunit; Short=AHAS; Short=ALS 
(chloroplast) [Galdieria sulphuraria]
 gb|AAF81684.1|AF233069_7 acetohydroxy-acid synthase small subunit [Galdieria sulphuraria]
Length=181

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  ++G+ +RRG+NI SLAVGPAE+ G+SRIT VI G +  I ++ 
Sbjct  2    KHTLSVLVEDESGVLTRISGLFARRGFNIDSLAVGPAEKAGISRITMVIRGDNRIIEQIT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +H YKLV++ ++QD+T +P  ERELMLIKV      R +IL+IA+IFRA+ VD+S+  I 
Sbjct  62   KHLYKLVNVLKIQDITNIPCVERELMLIKVKTGENKRNEILEIANIFRARVVDLSESFII  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+TG   K+ A+++LLE YGICE+ARTG++AL RES +++  LR
Sbjct  122  LEITGDPGKIAAIEKLLEKYGICEIARTGKIALTRESKINTEILR  166



>ref|WP_006453777.1| acetolactate synthase [Synechococcus sp. PCC 7335]
 gb|EDX84032.1| acetolactate synthase, small subunit [Synechococcus sp. PCC 7335]
Length=172

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE  G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDESGVLTRIAGLFARRGFNIESLAVGPAEEAGISRITMVVPGDDLVIEQLA  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T  P  ERELMLIKV  N+  R +++ +A IFRA+ VDVS  ++T
Sbjct  62   KQLYKLINVLKVQDITETPSVERELMLIKVNANSENRAEVVGLAQIFRARVVDVSKESVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   KL+A++++L+P+G+ E+ARTG++AL+RESGV++  L+
Sbjct  122  LEVVGDPGKLVAIEQMLKPFGVQEIARTGKIALIRESGVNTEYLK  166



>gb|ACB49979.1| acetolactate synthase small subunit [Cyanothece sp. ATCC 51142]
Length=181

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            ++S    HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D 
Sbjct  4    NTSKTMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDS  63

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
            TI +L +  YKL+++ +V D+T+ P  ERELML+KV+V AT R ++L++A +FRA+ VD+
Sbjct  64   TIEQLTKQLYKLINVLKVNDITQTPCVERELMLVKVSVTATNRAEVLEVAQVFRARIVDI  123

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            SD T+T+E+ G   K++A+ ++L  +GI EVARTG++AL RES V++  L+
Sbjct  124  SDDTVTVEVVGDPGKMVAIVQMLNKFGIREVARTGKIALTRESRVNTEYLK  174



>ref|WP_006527479.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 73106]
 gb|ELR99701.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 73106]
Length=171

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G SRIT V+PG ++ I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQTGRSRITMVVPGDEQVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELMLIKV  N+ +R +I+++A +FRA+ VD+SD T+T
Sbjct  62   KQLYKLINVIKVQDITTIPCVERELMLIKVNANSASRGEIIELAQVFRARIVDISDDTLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++LE +GI E+ARTG++AL+RESGV++  L+
Sbjct  122  VEVVGDPGKMVAIVQMLEKFGIKEIARTGKIALIRESGVNTEYLK  166



>ref|YP_009051154.1| acetohydroxyacid synthase small subunit [Galdieria sulphuraria]
 gb|AIG92596.1| acetohydroxyacid synthase small subunit [Galdieria sulphuraria]
Length=181

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  ++G+ +RRG+NI SLAVGPAE+ G+SRIT V+ G +  I ++ 
Sbjct  2    KHTLSVLVEDESGVLTRISGLFARRGFNIDSLAVGPAEKAGISRITMVVRGDNRIIEQIT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +H YKLV++ ++QD+T +P  ERELMLIKV      R ++L+IA+IFRA+ VD+S++ + 
Sbjct  62   KHLYKLVNVLKIQDITNIPCVERELMLIKVRTGDNKRNEVLEIANIFRARVVDLSEYFVI  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+TG   K+ A+++LLE YGICE+ARTG++AL RES +++  LR
Sbjct  122  LEITGDPGKMAAIEKLLEKYGICEIARTGKIALTRESKINTEILR  166



>ref|WP_007304707.1| acetolactate synthase [Crocosphaera watsonii]
 gb|EAM51559.1| Acetolactate synthase, small subunit [Crocosphaera watsonii WH 
8501]
 gb|EHJ13596.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0003]
 emb|CCQ59733.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0401]
 emb|CCQ49426.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
8502]
 emb|CCQ58541.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0005]
 emb|CCQ65782.1| Acetolactate synthase small subunit [Crocosphaera watsonii WH 
0402]
Length=173

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D +I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDNSIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +V D+T+ P  ERELML+KV V+A  R ++L++A +FRA+ VD+SD T+T
Sbjct  62   KQLYKLINVLKVNDITQTPCVERELMLLKVNVSAANRAEVLEVAQVFRARIVDISDDTVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI EVARTG++AL RESGV++  L+
Sbjct  122  IEVVGDPGKMVAIMKMLSKFGIREVARTGKIALTRESGVNTEYLK  166



>gb|EAZ92294.1| acetolactate synthase small subunit [Cyanothece sp. CCY0110]
Length=181

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 129/171 (75%), Gaps = 0/171 (0%)
 Frame = -1

Query  632  DSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDE  453
            ++S    HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D 
Sbjct  4    NTSKTMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDN  63

Query  452  TIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDV  273
            TI +L +  YKL+++ +V ++T+ P  ERELML+KV+V AT R ++L++A +FRA+ VD+
Sbjct  64   TIEQLTKQLYKLINVLKVNNITQTPCVERELMLVKVSVTATNRAEVLEVAQVFRARIVDI  123

Query  272  SDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            SD T+T+E+ G   K++A+ ++L  +GI EVARTG++AL RES V++  L+
Sbjct  124  SDDTVTVEVVGDPGKMVAIVQMLNKFGIREVARTGKIALTRESRVNTEYLK  174



>ref|WP_015219133.1| acetolactate synthase small subunit [Cyanobacterium aponinum]
 gb|AFZ53404.1| acetolactate synthase, small subunit [Cyanobacterium aponinum 
PCC 10605]
Length=172

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HT+S+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+TI +L +
Sbjct  3    HTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDDTIEQLTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              +KL+++ +V D+T++P  ERELML+KV+ N++ R ++L I  IFRAK VD+SD ++ L
Sbjct  63   QLHKLINVIKVTDITKIPCVERELMLVKVSANSSNRSEVLQIVQIFRAKVVDISDDSLIL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   K++A+  +L  +GI E+ARTG+VALVRESGV++  L+
Sbjct  123  EVVGDPGKMVAIISMLSKFGIKEIARTGKVALVRESGVNTEYLK  166



>ref|WP_009547809.1| MULTISPECIES: acetolactate synthase [Cyanothece]
Length=173

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D TI +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDSTIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +V D+T+ P  ERELML+KV+V AT R ++L++A +FRA+ VD+SD T+T
Sbjct  62   KQLYKLINVLKVNDITQTPCVERELMLVKVSVTATNRAEVLEVAQVFRARIVDISDDTVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI EVARTG++AL RES V++  L+
Sbjct  122  VEVVGDPGKMVAIVQMLNKFGIREVARTGKIALTRESRVNTEYLK  166



>ref|WP_011056724.1| MULTISPECIES: acetolactate synthase [Thermosynechococcus]
 ref|NP_681670.1| acetolactate synthase 3 regulatory subunit [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC08432.1| acetolactate synthase small subunit [Thermosynechococcus elongatus 
BP-1]
 gb|AHB89434.1| acetolactate synthase regulatory subunit IlvH [Thermosynechococcus 
sp. NK55a]
Length=172

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQIGISRITMVVPGDDAVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV   A+ R +IL++  IFRAK VDVSD ++ 
Sbjct  62   KQLYKLINVLKVQDITTIPCVERELMLLKVNATASTRSEILELVQIFRAKVVDVSDDSLI  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E++G   K++AL ++L  +GI E+ARTG++ALVRESGV++  L+
Sbjct  122  IEVSGDPGKMVALVQMLNKFGIREIARTGKIALVRESGVNTEYLK  166



>ref|WP_035798716.1| acetolactate synthase [Cyanothece sp. CCY0110]
Length=173

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D TI +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDNTIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +V ++T+ P  ERELML+KV+V AT R ++L++A +FRA+ VD+SD T+T
Sbjct  62   KQLYKLINVLKVNNITQTPCVERELMLVKVSVTATNRAEVLEVAQVFRARIVDISDDTVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI EVARTG++AL RES V++  L+
Sbjct  122  VEVVGDPGKMVAIVQMLNKFGIREVARTGKIALTRESRVNTEYLK  166



>ref|WP_017303099.1| acetolactate synthase [Spirulina subsalsa]
Length=172

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HT+S+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L+
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLI  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+ + +VQD+T++P  ERELMLIKV  +A+ R ++++IA +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLISVLKVQDITQVPCVERELMLIKVNASASNRAEVIEIAQVFRARIVDMSEDTLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI E+ARTG++ALVRESGV++  L+
Sbjct  122  IEVVGDPGKMVAIVQMLNKFGIREIARTGKIALVRESGVNTEYLK  166



>ref|WP_013322899.1| acetolactate synthase [Cyanothece sp. PCC 7822]
 gb|ADN14794.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7822]
Length=175

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I ++ 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDGIIEQIT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T++P  ERELML+KV  +A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQIPCVERELMLVKVNASAAFRAEVIELAQVFRARVVDISEDTLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +GI E+ARTG+VALVRESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQMLNKFGIKEIARTGKVALVRESGVNTEYLK  166



>ref|WP_026732404.1| acetolactate synthase [Fischerella sp. PCC 9605]
Length=172

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL+ ++G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDRVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV   +T R +I++IA IFRA+ VDV++ ++T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNATSTTRSEIVEIAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRESGVNTELLK  166



>ref|WP_015195236.1| acetolactate synthase, small subunit [Stanieria cyanosphaera]
 gb|AFZ37582.1| acetolactate synthase, small subunit [Stanieria cyanosphaera 
PCC 7437]
Length=173

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HT+S+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L+
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDRIIEQLI  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T++P  ERELML+KV   A+ R +++ IA IFRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQVPSVERELMLVKVNAPASGRAEVIQIAHIFRARIVDMSEDTVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI EVARTG++ALVRESGV++  L+
Sbjct  122  VEVVGDPGKMVAIIQMLNKFGIREVARTGKIALVRESGVNTEYLK  166



>ref|WP_012598844.1| acetolactate synthase [Cyanothece sp. PCC 7424]
 gb|ACK69899.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7424]
Length=175

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+ G D  I ++ 
Sbjct  2    KHTLSVLVQDEAGVLTRIAGLFARRGFNIESLAVGPAEQLGISRITMVVSGDDGIIEQIT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T++P  ERELMLIKV+ +A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQIPCVERELMLIKVSASAINRAEVIELAQVFRARVVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +GI E+ARTG+VALVRESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQMLNKFGIKEIARTGKVALVRESGVNTEYLK  166



>ref|WP_002743360.1| MULTISPECIES: acetolactate synthase [Microcystis]
 emb|CAO89159.1| ilvH [Microcystis aeruginosa PCC 7806]
 emb|CCI04181.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9443]
 emb|CCI24317.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9808]
 emb|CCI32791.1| Acetolactate synthase small subunit [Microcystis sp. T1-4]
 gb|ELS48302.1| acetolactate synthase, small subunit [Microcystis aeruginosa 
DIANCHI905]
Length=174

 Score =   183 bits (464),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG +++I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQTPCVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  122  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  167



>ref|WP_002732118.1| acetolactate synthase [Microcystis aeruginosa]
 dbj|BAG04634.1| acetolactate synthase small subunit [Microcystis aeruginosa NIES-843]
 emb|CCH94766.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9432]
 emb|CCH96995.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9717]
 emb|CCI05878.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
7941]
 emb|CCI25608.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9809]
 emb|CCI34750.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9701]
 gb|ELP55727.1| acetolactate synthase, small subunit [Microcystis aeruginosa 
TAIHU98]
 gb|EPF19849.1| Acetolactate synthase small subunit [Microcystis aeruginosa SPC777]
Length=174

 Score =   182 bits (463),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG +++I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQTPCVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  122  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  167



>emb|CCI18700.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9807]
Length=185

 Score =   183 bits (464),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG +++I +L 
Sbjct  13   KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLT  72

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  73   KQLYKLINVLKVQDITQTPCVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLT  132

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  133  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  178



>dbj|BAA22822.1| acetolactate synthase [Cyanidioschyzon merolae]
Length=166

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RR +NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRSFNIESLAVGPAEQAGISRITMVVPGDDRTIEQLM  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+ I +V++LT++P  EREL+L+KV  N+  RR+ILD+A+IFRA+ VD+S   + 
Sbjct  62   KQLYKLIPILQVENLTQVPCVERELILMKVQANSQTRREILDMANIFRARVVDISADDVM  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+TG   K++AL+++L  +GI EVARTG++AL R S V++  LR
Sbjct  122  LEVTGDPGKMVALEQILTKFGIVEVARTGKIALKRSSKVNTEWLR  166



>ref|WP_017322778.1| acetolactate synthase [cyanobacterium PCC 7702]
Length=172

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL+ ++G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQPGISRITMVVPGDDRVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQDLT +P  ERELML+KV   +T R +I+++A IFRA+ VDV++ ++T
Sbjct  62   KQLYKLINVLKVQDLTEIPCVERELMLLKVNATSTTRSEIVELAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRESGVNTELLK  166



>dbj|GAL94295.1| acetolactate synthase small subunit [Microcystis aeruginosa NIES-44]
Length=174

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 127/166 (77%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG +++I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDEDSIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQTPCVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  122  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  167



>ref|WP_024971071.1| acetolactate synthase [Microcystis aeruginosa]
Length=174

 Score =   182 bits (462),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG + +I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQTPCVERELMLIKVNATAERRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  122  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  167



>ref|WP_043999720.1| acetolactate synthase [Microcystis aeruginosa]
Length=174

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG + +I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITQTPCVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  122  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  167



>ref|WP_039716657.1| acetolactate synthase [Scytonema millei]
 gb|KIF19164.1| acetolactate synthase [Scytonema millei VB511283]
Length=174

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVG AE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGQAEQNGVSRITMVVPGDDRVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV + +VQD+T +P  ERELMLIKV+  ++ R ++++IA IFRA+ VDV++ ++T
Sbjct  62   KQLYKLVHVLKVQDITEVPCVERELMLIKVSATSSNRSEVIEIAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ +LL+ +G+ EVARTG++ALVRESGV++  L+
Sbjct  122  LEVVGDPGKIVAIVQLLQKFGLREVARTGKIALVRESGVNTEYLK  166



>ref|NP_848948.1| aceohydroxyacid synthase small subunit [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAC76110.1| acetolactate synthase small subunit (chloroplast) [Cyanidioschyzon 
merolae strain 10D]
Length=174

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RR +NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRSFNIESLAVGPAEQAGISRITMVVPGDDRTIEQLM  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+ I +V++LT++P  EREL+L+KV  N+  RR+ILD+A+IFRA+ VD+S   + 
Sbjct  62   KQLYKLIPILQVENLTQVPCVERELILMKVQANSQTRREILDMANIFRARVVDISADDVM  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+TG   K++AL+++L  +GI EVARTG++AL R S V++  LR
Sbjct  122  LEVTGDPGKMVALEQILTKFGIVEVARTGKIALKRSSKVNTEWLR  166



>ref|WP_017319158.1| acetolactate synthase [Mastigocladopsis repens]
Length=173

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 128/164 (78%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  GVL+ ++G+ +RRG+NI+SLAVGPAE+ G+SRIT VIPG D  I +L +
Sbjct  3    HTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQPGISRITMVIPGDDRVIEQLTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              YKL+++ +VQD+T +P  ERELML+KV   ++ R +I++IA IFRA+ VDV++ ++TL
Sbjct  63   QLYKLINVLKVQDVTEIPSVERELMLLKVNATSSTRSEIVEIAQIFRARVVDVAEDSLTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+
Sbjct  123  EVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRESGVNTELLK  166



>emb|CCI14937.1| Acetolactate synthase small subunit [Microcystis aeruginosa PCC 
9806]
Length=185

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG + +I +L 
Sbjct  13   KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDENSIEQLT  72

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T+ P  ERELMLIKV   A  R +++++A +FRA+ VD+S+ T+T
Sbjct  73   KQLYKLINVLKVQDITQTPCVERELMLIKVNATADRRAEVIELAQVFRARIVDISEETLT  132

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L  +G+ EVARTG++AL+RESGV++  L+ 
Sbjct  133  IEVVGDPGKMVAIMQMLNKFGVREVARTGKIALIRESGVNTEYLKA  178



>ref|WP_015154365.1| acetolactate synthase small subunit [Chroococcidiopsis thermalis]
 gb|AFY87817.1| acetolactate synthase, small subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=174

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVG AE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGQAEQNGVSRITMVVPGDDRVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV + +VQD+T +P  ERELMLIKV   ++ R ++++IA IFRA+ VDV++ ++T
Sbjct  62   KQLYKLVHVLKVQDITEVPCVERELMLIKVNATSSNRSEVIEIAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++AL +LL+ +G+ EVARTG++ALVRESGV++  L+
Sbjct  122  LEVVGDPGKIVALVQLLQKFGLREVARTGKIALVRESGVNTEYLK  166



>ref|WP_036902537.1| acetolactate synthase [Prochlorococcus sp. MIT 0601]
 gb|KGG12119.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0601]
Length=176

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI+SLAVGPAE  G+SR+T V+ G DET++++ +
Sbjct  3    HTLSVLVEDQSGALSRISGLFARRGFNIESLAVGPAEAPGISRLTMVVEGDDETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV++  V DLT LP  ERELML+KV+  +  R++ILD+  +FRAK VDVSD  + L
Sbjct  63   QLDKLVNVLYVIDLTSLPAVERELMLLKVSAKSNHRKEILDLVQVFRAKVVDVSDQALIL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSL----RGYCLP  105
            E+ G   KL+AL++L++PYGI E+ARTG+VAL R SG+ +  L    +G  LP
Sbjct  123  EVVGDPGKLVALEKLMKPYGILEIARTGKVALERASGISTEMLKSTSKGKNLP  175



>gb|AFZ05551.1| acetolactate synthase, small subunit [Oscillatoria nigro-viridis 
PCC 7112]
Length=178

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -1

Query  623  GLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIR  444
            G   HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+ I 
Sbjct  5    GEMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIE  64

Query  443  KLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDH  264
            +L +  YKL+++ +VQD+T +P  ERELML+KV   +  R +I+++A IFRA+ VD+ D 
Sbjct  65   QLTKQLYKLINVLKVQDITEIPCVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDD  124

Query  263  TITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            T+TLE+ G   K++A+ ++L  +GI E+ARTG++AL RESGV++  L+
Sbjct  125  TLTLEVVGDPGKMVAIVQVLNRFGIKEIARTGKIALTRESGVNTEFLK  172



>ref|WP_012626204.1| acetolactate synthase [Cyanothece sp. PCC 7425]
 gb|ACL43106.1| acetolactate synthase, small subunit [Cyanothece sp. PCC 7425]
Length=172

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+ I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQMGVSRITMVVPGDDQIIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV  +A+ R +IL++ +IFRAK VDVS+ ++T
Sbjct  62   KQLYKLINVLKVQDVTEIPCVERELMLVKVNASASNRSEILELVNIFRAKVVDVSEESLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI E+ARTG++ L RESGV++  L+
Sbjct  122  IEVAGDPGKMVAIIQVLLKFGIREIARTGKICLTRESGVNTEYLK  166



>ref|WP_008314262.1| acetolactate synthase, small subunit [Leptolyngbya sp. PCC 6406]
Length=176

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+ I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDQAIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV  N+T R +I+ +A IFRA+ VDV++ ++T
Sbjct  62   KQLYKLINVLKVQDVTEVPCVERELMLLKVNANSTTRAEIVGLAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +G+ E+ARTG+VAL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGLREIARTGKVALTRESGVNTEYLK  166



>gb|EGK83985.1| acetolactate synthase, small subunit [Microcoleus vaginatus FGP-2]
Length=178

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 125/168 (74%), Gaps = 0/168 (0%)
 Frame = -1

Query  623  GLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIR  444
            G   HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+ I 
Sbjct  5    GEMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIE  64

Query  443  KLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDH  264
            +L +  YKL+++ +VQD+T +P  ERELML+KV   +  R +I+++A IFRA+ VD+ D 
Sbjct  65   QLTKQLYKLINVLKVQDITEIPCVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDD  124

Query  263  TITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            T+TLE+ G   K++A+ ++L  +GI E+ARTG++AL RESGV++  L+
Sbjct  125  TLTLEVVGDPGKMVAIVQVLNRFGIKEIARTGKIALTRESGVNTEFLK  172



>ref|WP_006910483.1| acetolactate synthase [Cyanobium sp. PCC 7001]
 gb|EDY38581.1| acetolactate synthase, small subunit [Cyanobium sp. PCC 7001]
Length=176

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI+SLAVGPAEREG+SR+T V+ G D T+ ++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIESLAVGPAEREGMSRLTMVVEGDDRTLAQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL+++  V DL+RLP  ERELML+KVA  A  R  ILD+  +FRA  VDV+D  +TL
Sbjct  63   QLDKLINVLGVIDLSRLPSVERELMLLKVAAPAEQRSAILDLVQVFRANVVDVADDALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++++EP+GI E+ARTG+VAL R SGV++  LR
Sbjct  123  EVVGDPGKLVALEQVMEPFGILEIARTGKVALERASGVNTAFLR  166



>ref|WP_016875905.1| acetolactate synthase [Chlorogloeopsis fritschii]
Length=172

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 128/165 (78%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL+ ++G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGISRITMVVPGDDYVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV   +T R +++++A IFRA+ VDV++ ++T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNATSTNRSEVVELAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKIALTRESGVNTELLK  166



>ref|WP_041622928.1| acetolactate synthase [Oscillatoria nigro-viridis]
Length=172

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+ I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV   +  R +I+++A IFRA+ VD+ D T+T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +GI E+ARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGIKEIARTGKIALTRESGVNTEFLK  166



>gb|AIA61091.1| acetohydroxyacid synthase small subunit (chloroplast) (chloroplast) 
[Cyanidiaceae sp. MX-AZ01]
Length=172

 Score =   180 bits (456),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RR +NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRSFNIESLAVGPAEQIGISRITMVVPGDDRTIEQLM  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+ I +V++LT++P  ERELML+KV  ++  RR+ILD+A+IFRA+ VD++   + 
Sbjct  62   KQLYKLIPIFKVENLTQVPCVERELMLMKVKADSNTRREILDMANIFRARVVDIASDDLM  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+TG   K++AL+++L+ +G+ E+ARTG++AL R S V++  LR
Sbjct  122  LEVTGDPGKMVALEQMLQKFGLVEIARTGKIALKRSSKVNTEWLR  166



>ref|WP_039887977.1| acetolactate synthase [Microcoleus vaginatus]
Length=172

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D+ I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDQIIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV   +  R +I+++A IFRA+ VD+ D T+T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLLKVNAASGTRSEIIELAQIFRARVVDIGDDTLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +GI E+ARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGIKEIARTGKIALTRESGVNTEFLK  166



>dbj|BAA22831.1| acetolactate synthase [Cyanidium caldarium]
Length=166

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RR +NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRSFNIESLAVGPAEQVGISRITMVVPGDDRTIEQLM  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YK + I +V++LT++P  ERELML+KV  N+  RR+ILD+A+IFRA+ VD++   + 
Sbjct  62   KQLYKFIPIFKVENLTQVPCVERELMLMKVKANSDTRREILDMANIFRARIVDIAAEDLM  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+TG   K++AL+++L  +G+ EVARTG++AL R S V++  LR
Sbjct  122  LEVTGDPGKMVALEQVLAKFGLVEVARTGKIALKRSSKVNTEWLR  166



>ref|WP_015171191.1| acetolactate synthase small subunit [Geitlerinema sp. PCC 7407]
 gb|AFY65624.1| acetolactate synthase, small subunit [Geitlerinema sp. PCC 7407]
Length=172

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDDHVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV  N+  R +I+++A +FRA+ VD+++ ++T
Sbjct  62   KQLYKLINVLKVQDITEVPCVERELMLLKVNANSGTRSEIIELAQVFRARVVDIAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +GI E+ARTGRVAL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLNRFGIREIARTGRVALTRESGVNTEFLK  166



>ref|WP_014407139.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 sp|Q55141.2|ILVH_SYNY3 RecName: Full=Acetolactate synthase small subunit; AltName: Full=Acetohydroxy-acid 
synthase small subunit; Short=AHAS; Short=ALS 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAK51060.1| acetolactate synthase [Synechocystis sp. PCC 6803]
 dbj|BAL30058.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL33227.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36396.1| acetolactate synthase [Synechocystis sp. PCC 6803 substr. PCC-P]
Length=172

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVG AE+  +SRIT V+PG + TI +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV++ +VQD+T  P  ERELML+KV+ NA  R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLVNVIKVQDITETPCVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI EVARTG++ALVRESGV++  L+
Sbjct  122  IEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRESGVNTEYLK  166



>ref|WP_016870148.1| acetolactate synthase [Fischerella muscicola]
Length=173

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 127/164 (77%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  GVL+ ++G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L +
Sbjct  3    HTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDHVIEQLTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              YKL+++ +VQD+T  P  ERELML+KV   ++ R +I+++A IFRA+ VDV++ ++TL
Sbjct  63   QLYKLINVLKVQDITETPCVERELMLLKVNATSSTRSEIVELAQIFRARVVDVAEDSLTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+
Sbjct  123  EVVGDPGKMVAIVQVLQKFGLKEIARTGKIALTRESGVNTELLK  166



>ref|WP_011818754.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 gb|ABE10998.1| acetolactate synthase small subunit [uncultured Prochlorococcus 
marinus clone ASNC612]
 gb|ABM70615.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. AS9601]
 gb|ABO17969.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9301]
 gb|AIQ95400.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0604]
 gb|KGG00403.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9314]
 gb|KGG09118.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. SB]
Length=174

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE +G+SR+T V+ G DET++++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL ++  V D T L   ERELML+KV+     R +ILDI  IFRAK VDVSD  +TL
Sbjct  63   QLNKLFNVLGVVDFTNLAAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALKRSSGVNTEMLK  166



>ref|WP_009767679.1| acetolactate synthase, small subunit [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68565.1| acetolactate synthase, small subunit [Oscillatoriales cyanobacterium 
JSC-12]
Length=177

 Score =   180 bits (456),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQIGISRITMVVPGDDRIIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV  N++ R +I+++A IFRA+ VDV++ ++T
Sbjct  62   KQLYKLINVLKVQDITEVPCVERELMLMKVNANSSTRSEIIELAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L  +G+ E+ARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLNKFGLREIARTGKIALTRESGVNTEFLK  166



>ref|WP_015145546.1| acetolactate synthase small subunit [Pleurocapsa minor]
 gb|AFY79248.1| acetolactate synthase, small subunit [Pleurocapsa sp. PCC 7327]
Length=172

 Score =   179 bits (455),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 126/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG +  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQVGISRITMVVPGDERIIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T +P  ERELML+KV   ++ R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLINVLKVQDITEIPCVERELMLVKVNATSSNRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI E+ARTG++AL+RESGV++  L+
Sbjct  122  VEVVGDPGKMVAIVQMLNKFGIREIARTGKIALIRESGVNTEYLK  166



>ref|WP_006508477.1| acetolactate synthase, small subunit [Xenococcus sp. PCC 7305]
 gb|ELS04426.1| acetolactate synthase, small subunit [Xenococcus sp. PCC 7305]
Length=174

 Score =   179 bits (455),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HT+S+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L+
Sbjct  2    KHTISVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEKVGVSRITMVVPGDDTIIEQLI  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+ + +VQD+T+ P  ERELML+KV   A  R +++ +  IFRA+ VD++D  +T
Sbjct  62   KQLYKLISVLKVQDITQTPSVERELMLVKVNATAANRAEVIQLVQIFRARIVDIADEAVT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   KL+A+ ++L  +GI E++RTG++ALVRESGV++  L+
Sbjct  122  LEVVGDPGKLVAIIQMLNKFGIKEISRTGKIALVRESGVNTEYLK  166



>ref|WP_032518375.1| acetolactate synthase [Prochlorococcus marinus]
 gb|KGG02943.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9321]
 gb|KGG05569.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9322]
 gb|KGG07613.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9401]
Length=174

 Score =   179 bits (455),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE +G+SR+T V+ G DET++++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL ++  V D T L   ERELML+KV+     R +ILDI  IFRAK VDVSD  +TL
Sbjct  63   QLNKLFNVLGVVDFTNLAAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDTALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALKRSSGVNTEMLK  166



>ref|WP_009756687.1| MULTISPECIES: acetolactate synthase [Fischerella]
 gb|EHC16251.1| acetolactate synthase, small subunit [Fischerella sp. JSC-11]
Length=173

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  GVL+ ++G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L +
Sbjct  3    HTLSVLVEDEAGVLSRISGLFARRGFNIESLAVGPAEQSGVSRITMVVPGDDRVIEQLTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              YKL+++ +VQD+T  P  ERELML+KV   +  R +I+++A IFRA+ VDV++ ++TL
Sbjct  63   QLYKLINVLKVQDITETPCVERELMLLKVNATSNTRSEIVELAQIFRARVVDVAEDSLTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+
Sbjct  123  EVVGDPGKMVAIVQVLQKFGLKEIARTGKIALTRESGVNTELLK  166



>ref|YP_008144692.1| acetolactate synthase small subunit [Grateloupia taiwanensis]
 gb|AGO19808.1| acetolactate synthase small subunit [Grateloupia taiwanensis]
Length=176

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  GVL+ + G+ +RRG+NI+SLAVGPAE+ G+SRIT ++PG + TI ++++
Sbjct  3    HTLSVLVEDESGVLSRIAGLFARRGFNIESLAVGPAEQIGISRITMIVPGDNRTIEQIIK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              YKLV+I  VQD+T +P  EREL+LIKV      R  ILDIA+IFRAK VD++   + L
Sbjct  63   QLYKLVNILSVQDITNIPCVERELVLIKVQATNKHRTSILDIANIFRAKVVDIAKEYLIL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+TG   K +A+++LL  YGI E+ARTG+++L+R S +++  LR
Sbjct  123  EVTGDPGKTMAIEQLLSEYGIVEIARTGKISLIRSSNINTEFLR  166



>ref|WP_038653708.1| acetolactate synthase [Prochlorococcus sp. MIT 0801]
 gb|AIQ97755.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0801]
Length=167

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ + G+ +RRG+NI SLAVGPAE +G+SR+T V+ G + T++++ +
Sbjct  3    HTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEAKGISRLTMVVQGDESTLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL+++ EV DLT LP  ERELML+KV+ ++  R  ILD+  +FRAK VDVSD  +TL
Sbjct  63   QLNKLINVLEVLDLTTLPAVERELMLLKVSASSQNRGKILDLVQVFRAKVVDVSDSALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL+ LL+PYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALENLLKPYGILEIARTGKVALKRASGVNTEMLK  166



>ref|WP_025930661.1| acetolactate synthase [Prochlorococcus sp. scB241_528O2]
Length=174

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE +G+SR+T V+ G DET++++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL ++  V D T L   ERELML+KV+     R +ILDI  IFRAK VDVSD  +TL
Sbjct  63   QLNKLFNVLGVVDFTNLAAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALKRSSGVNTEILK  166



>dbj|BAM54375.1| acetolactate synthase 3 regulatory subunit [Synechocystis sp. 
PCC 6803]
Length=175

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVG AE+  +SRIT V+PG + TI +L 
Sbjct  5    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGSAEQGDVSRITMVVPGDENTIEQLT  64

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV++ +VQD+T  P  ERELML+KV+ NA  R +++++A +FRA+ VD+S+ T+T
Sbjct  65   KQLYKLVNVIKVQDITETPCVERELMLVKVSANAPNRAEVIELAQVFRARIVDISEDTVT  124

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI EVARTG++ALVRESGV++  L+
Sbjct  125  IEVVGDPGKMVAILQMLAKFGIKEVARTGKIALVRESGVNTEYLK  169



>ref|WP_036918354.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 gb|KGG15568.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0602]
 gb|KGG17848.1| Acetolactate synthase small subunit [Prochlorococcus sp. MIT 
0603]
Length=176

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE  G+SR+T V+ G D T++++ +
Sbjct  3    HTLSVLVEDQSGALSRISGLFARRGFNIDSLAVGPAEAPGISRLTMVVEGDDRTLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KLV++  V DLT LP  ERELML+KV+ N   R  ILD+  +FRAK VDVS++ +TL
Sbjct  63   QLDKLVNVLNVIDLTTLPAVERELMLLKVSANNEHRSSILDLVQVFRAKVVDVSNNALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SG+++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALERASGINTELLK  166



>ref|WP_017651464.1| acetolactate synthase [Microchaete sp. PCC 7126]
Length=172

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL+ ++ + +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLSRISSLFARRGFNIESLAVGPAEQGGVSRITMVVPGDDRVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV++ +VQD+T  P  ERELML+KV  N+T R +++ IA IFRA+ VDV++ ++T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNANSTNRSEVVGIAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L+ +G+ E+ARTG+++L+RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREIARTGKISLIRESGVNTELLK  166



>ref|WP_023076484.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
 gb|ESA32600.1| acetolactate small subunit [Leptolyngbya sp. Heron Island J]
Length=178

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 124/166 (75%), Gaps = 0/166 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL+ + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLSRIAGLFARRGFNIESLAVGPAEQTGVSRITMVVPGDDSVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +V D+T  P  ERELML+KV  N+  R +I++ A IFRA+ VDVSD ++T
Sbjct  62   KQLYKLINVLKVNDITEKPCVERELMLLKVNANSNTRSEIINFAQIFRARVVDVSDDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLRG  117
            +E+ G   K++A+ ++L+ +G+ E+ARTG++AL RESGV++  L+ 
Sbjct  122  IEVVGDPGKMVAIVQVLDRFGVREIARTGKIALTRESGVNTEYLKA  167



>ref|WP_011294852.1| acetolactate synthase [Prochlorococcus marinus]
 gb|AAZ58255.1| acetolactate synthase, small subunit [Prochlorococcus marinus 
str. NATL2A]
 gb|ABM76161.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. NATL1A]
 gb|KGG21278.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. PAC1]
Length=167

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ + G+ +RRG+NI SLAVGPAE +G+SR+T V+ G + T++++ +
Sbjct  3    HTLSVLVEDESGALSRIAGLFARRGFNIDSLAVGPAEAKGISRLTMVVQGDESTLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL+++ EV DLT LP  ERELML+KV+ ++  R  ILD+  +FRAK VDVSD  +TL
Sbjct  63   QLNKLINVLEVLDLTTLPAVERELMLLKVSASSENRGKILDLVQVFRAKVVDVSDSALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL+ LL+PYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALENLLKPYGILEIARTGKVALKRASGVNTEMLK  166



>ref|WP_012008031.1| MULTISPECIES: acetolactate synthase [Prochlorococcus]
 gb|ABV50975.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9215]
 gb|KGF86553.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. GP2]
 gb|KGF91892.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9107]
 gb|KGF93520.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9116]
 gb|KGF94067.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9123]
 gb|KGF96738.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9201]
 gb|KGF96834.1| Acetolactate synthase small subunit [Prochlorococcus marinus 
str. MIT 9302]
Length=174

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE +G+SR+T V+ G DET++++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDDETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL ++  V D T L   ERELML+KV+     R +ILDI  IFRAK VDVSD  +TL
Sbjct  63   QLNKLFNVLGVVDFTNLAAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDIALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALKRSSGVNTEMLK  166



>ref|WP_008188861.1| acetolactate synthase [Moorea producens]
 gb|EGJ29930.1| acetolactate synthase, small subunit [Moorea producens 3L]
Length=172

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGP E+ G+SRIT V+PG D +I +L +
Sbjct  3    HTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPTEQVGISRITMVVPGDDSSIEQLTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
              YKL+++ +VQD+T +P  ERELML+KV   ++ R +I+++A +FRA  VD S+ ++TL
Sbjct  63   QLYKLINVLKVQDITSIPCVERELMLLKVNTTSSTRSEIIELAQVFRAHVVDTSEESLTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   K++AL ++L  +GI E+ARTG++AL RESGV++  L+
Sbjct  123  EVVGDPGKMVALTQMLNKFGIREIARTGKIALTRESGVNTEYLK  166



>ref|WP_015189621.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 7428]
 gb|AFZ31752.1| acetolactate synthase, small subunit [Gloeocapsa sp. PCC 7428]
Length=173

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D  I +L 
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQNGISRITMVVPGDDRVIEQLT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV++ +VQD+T  P  ERELML+KV   ++ R +I++++ IFRA+ VDV++ ++T
Sbjct  62   KQLYKLVNVLKVQDITETPCVERELMLLKVNATSSTRSEIVELSQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            LE+ G   K++A+ ++L+ +G+ EVARTG++AL RESGV++  L+
Sbjct  122  LEVVGDPGKMVAIVQVLQKFGLREVARTGKIALTRESGVNTELLK  166



>ref|WP_040935206.1| acetolactate synthase [Prochloron didemni]
Length=172

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQAGVSRITMVVPGDDRTIEQLI  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD T LP  ERELMLIK+   ++ R +++ I  IFRA+ VD+S+ T T
Sbjct  62   KQLYKLINVLKVQDFTNLPCVERELMLIKINATSSLREEVMQIVQIFRARIVDMSEETTT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI E+ RTG++AL+RES V++  L+
Sbjct  122  VEVVGDPGKMVAIIQMLSKFGIREIGRTGKIALIRESRVNTEYLK  166



>ref|XP_011400735.1| Acetolactate synthase small subunit [Auxenochlorella protothecoides]
 gb|KFM27748.1| Acetolactate synthase small subunit [Auxenochlorella protothecoides]
Length=485

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 129/185 (70%), Gaps = 4/185 (2%)
 Frame = -1

Query  677  VNQVLDAHWGVLYDEDSSGLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAER  498
            V  VLDA+    Y+ + S  + +TL + V D PGVLN +TGV++RRGYN+QSLAVG +ER
Sbjct  295  VRNVLDAY----YENEGSEFEPYTLLLEVQDRPGVLNQVTGVVARRGYNVQSLAVGNSER  350

Query  497  EGLSRITTVIPGTDETIRKLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRD  318
            EG SRIT V+PG    I KL++   KLV +  V +L   PF  RELMLIKV   A  R +
Sbjct  351  EGYSRITMVVPGNATGIEKLMKQVQKLVYVDRVTNLNANPFVARELMLIKVRATAAQRGE  410

Query  317  ILDIASIFRAKPVDVSDHTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGV  138
            +L++A IF    +DVS  T+T+E+TG  +K+ ALQ +LEPYGI EVARTGR++LVR+SGV
Sbjct  411  LLNLAQIFHGSVLDVSLTTLTIEVTGKEDKMRALQSVLEPYGILEVARTGRISLVRDSGV  470

Query  137  DSTSL  123
            D+  L
Sbjct  471  DTKYL  475


 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 100/159 (63%), Gaps = 3/159 (2%)
 Frame = -1

Query  623  GLQSHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIR  444
            G+  HTLS+ V D  G++N + GV +RRG NI+SLAVG  + + L   T V  GT+ T+ 
Sbjct  86   GVAKHTLSVFVGDEAGMINRVAGVFARRGANIESLAVGLTQDKAL--FTIVATGTEATVA  143

Query  443  KLLQHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARR-DILDIASIFRAKPVDVSD  267
             L +   KLV++  V+D+T     +REL + KVA    A R ++  +A +FRA+ VDV++
Sbjct  144  NLCKQLAKLVNVRYVEDITASEHFQRELFIAKVAAPPGATRTELQQVAEVFRARVVDVAE  203

Query  266  HTITLELTGAFNKLLALQRLLEPYGICEVARTGRVALVR  150
             T+TL  TG   K+ ALQR L  +GI E+ RTGR+AL R
Sbjct  204  RTLTLSATGDPGKIAALQRALGRFGIVELVRTGRIALKR  242



>ref|WP_009342538.1| acetolactate synthase [Raphidiopsis brookii]
 gb|EFA73522.1| Acetolactate synthase, small subunit [Raphidiopsis brookii D9]
Length=177

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL+ +  + +RRG+NI+SLAVGPAE+EG+SRIT V+PG D  I ++ 
Sbjct  2    KHTLSVLVEDEAGVLSRIASLFARRGFNIESLAVGPAEQEGISRITMVVPGDDRVIEQIT  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD+T  P  ERELML+KV  N+T R +++++A IFRA+ VDV++ ++T
Sbjct  62   KQLYKLINVLKVQDVTETPCVERELMLLKVNANSTNRSEVVELAQIFRARVVDVAEDSLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L+ +G+ E+ARTG+++L RESGV++  L+
Sbjct  122  IEVVGDPGKMVAIVQVLQKFGLKEIARTGKISLTRESGVNTELLK  166



>ref|WP_018397129.1| acetolactate synthase [filamentous cyanobacterium ESFC-1]
Length=172

 Score =   178 bits (451),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 127/165 (77%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HT+S+LV D  GVL  +  + +RRG+NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTISVLVEDEAGVLTRIASLFARRGFNIESLAVGPAEQVGISRITMVVPGDDGTIEQLI  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKLV++ +VQD+T++P  ERELML+K+   A+ R +++++A +FRA+ VD+S+ T+T
Sbjct  62   KQLYKLVNVLKVQDITQVPCVERELMLLKINATASNRAEVIELAQVFRARIVDISEETLT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI E+ARTG+VAL R+SGV++  L+
Sbjct  122  IEVVGDPGKMVAIVQMLNKFGIREIARTGKVALPRDSGVNTEYLK  166



>ref|WP_025961335.1| acetolactate synthase [Prochlorococcus sp. scB245a_519L21]
Length=174

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE +G+SR+T V+ G +ET++++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDEETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL ++  V D T L   ERELML+KV+     R +ILDI  IFRAK VDVSD  +TL
Sbjct  63   QLNKLFNVLGVVDFTNLAAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALKRSSGVNTEMLK  166



>ref|WP_025939160.1| acetolactate synthase [Prochlorococcus sp. scB245a_518A6]
Length=174

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 0/164 (0%)
 Frame = -1

Query  611  HTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLLQ  432
            HTLS+LV D  G L+ ++G+ +RRG+NI SLAVGPAE +G+SR+T V+ G +ET++++ +
Sbjct  3    HTLSVLVEDESGALSRISGLFARRGFNIDSLAVGPAESKGISRLTMVVEGDNETLQQMTK  62

Query  431  HFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTITL  252
               KL ++  V D T L   ERELML+KV+     R +ILDI  IFRAK VDVSD  +TL
Sbjct  63   QLNKLFNVLGVVDFTNLAAVERELMLLKVSSKEDTRSNILDIVQIFRAKVVDVSDMALTL  122

Query  251  ELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            E+ G   KL+AL++LLEPYGI E+ARTG+VAL R SGV++  L+
Sbjct  123  EVVGDPGKLVALEKLLEPYGILEIARTGKVALKRSSGVNTEMLK  166



>ref|WP_040931574.1| acetolactate synthase [Prochloron didemni]
Length=172

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = -1

Query  614  SHTLSMLVNDSPGVLNLLTGVISRRGYNIQSLAVGPAEREGLSRITTVIPGTDETIRKLL  435
             HTLS+LV D  GVL  + G+ +RRG+NI+SLAVGPAE+ G+SRIT V+PG D TI +L+
Sbjct  2    KHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGPAEQAGVSRITMVVPGDDRTIEQLI  61

Query  434  QHFYKLVDIHEVQDLTRLPFAERELMLIKVAVNATARRDILDIASIFRAKPVDVSDHTIT  255
            +  YKL+++ +VQD T LP  ERELMLIK+   ++ R +++ I  IFRA+ VD+S+ T T
Sbjct  62   KQLYKLINVLKVQDFTNLPCIERELMLIKINATSSLREEVMQIVQIFRARIVDMSEETTT  121

Query  254  LELTGAFNKLLALQRLLEPYGICEVARTGRVALVRESGVDSTSLR  120
            +E+ G   K++A+ ++L  +GI E+ RTG++AL+RES V++  L+
Sbjct  122  VEVVGDPGKMVAIIQMLSKFGIREIGRTGKIALIRESRVNTEYLK  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340