BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044G05

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008361395.1|  PREDICTED: CDPK-related protein kinase-like        247   1e-78   
ref|XP_009628482.1|  PREDICTED: CDPK-related protein kinase-like        242   6e-77   Nicotiana tomentosiformis
emb|CBI29399.3|  unnamed protein product                                247   1e-76   Vitis vinifera
ref|XP_002522315.1|  calcium-dependent protein kinase, putative         250   4e-76   
ref|XP_004233433.1|  PREDICTED: CDPK-related kinase 5-like              248   3e-74   Solanum lycopersicum
ref|XP_002281956.2|  PREDICTED: CDPK-related kinase 5                   248   4e-74   Vitis vinifera
emb|CAN82235.1|  hypothetical protein VITISV_007568                     248   4e-74   Vitis vinifera
ref|XP_006360222.1|  PREDICTED: CDPK-related protein kinase-like        248   4e-74   Solanum tuberosum [potatoes]
ref|XP_002262855.3|  PREDICTED: CDPK-related kinase 5                   248   5e-74   Vitis vinifera
ref|XP_003520170.1|  PREDICTED: CDPK-related kinase 5-like              248   6e-74   Glycine max [soybeans]
emb|CAN74933.1|  hypothetical protein VITISV_044433                     248   6e-74   Vitis vinifera
ref|XP_007156536.1|  hypothetical protein PHAVU_003G294300g             247   9e-74   Phaseolus vulgaris [French bean]
ref|XP_008338287.1|  PREDICTED: CDPK-related kinase 5                   247   9e-74   Malus domestica [apple tree]
ref|XP_006346445.1|  PREDICTED: CDPK-related kinase 5-like              247   1e-73   Solanum tuberosum [potatoes]
ref|XP_003528501.1|  PREDICTED: CDPK-related kinase 5-like              247   1e-73   Glycine max [soybeans]
ref|XP_007204593.1|  hypothetical protein PRUPE_ppa003111mg             247   1e-73   Prunus persica
gb|AAL30820.1|AF435452_1  calcium/calmodulin-dependent protein ki...    247   1e-73   Nicotiana tabacum [American tobacco]
ref|XP_009611550.1|  PREDICTED: CDPK-related kinase 5                   247   1e-73   Nicotiana tomentosiformis
ref|XP_009758726.1|  PREDICTED: CDPK-related kinase 5-like isofor...    246   1e-73   Nicotiana sylvestris
ref|XP_008241522.1|  PREDICTED: CDPK-related kinase 5                   246   1e-73   Prunus mume [ume]
ref|XP_006338215.1|  PREDICTED: CDPK-related kinase 5-like              247   2e-73   Solanum tuberosum [potatoes]
ref|XP_009801386.1|  PREDICTED: CDPK-related kinase 5-like              245   4e-73   Nicotiana sylvestris
ref|XP_004230803.1|  PREDICTED: CDPK-related kinase 5                   245   5e-73   Solanum lycopersicum
gb|KDO79300.1|  hypothetical protein CISIN_1g007253mg                   245   6e-73   Citrus sinensis [apfelsine]
ref|XP_006425849.1|  hypothetical protein CICLE_v10025192mg             245   7e-73   Citrus clementina [clementine]
ref|XP_004288057.1|  PREDICTED: CDPK-related kinase 5                   245   7e-73   Fragaria vesca subsp. vesca
ref|XP_010268657.1|  PREDICTED: CDPK-related kinase 5-like isofor...    244   1e-72   Nelumbo nucifera [Indian lotus]
gb|EYU39406.1|  hypothetical protein MIMGU_mgv1a0043831mg               231   1e-72   Erythranthe guttata [common monkey flower]
gb|KDP31899.1|  hypothetical protein JCGZ_12360                         245   1e-72   Jatropha curcas
ref|XP_007047191.1|  CDPK-related kinase                                244   2e-72   Theobroma cacao [chocolate]
ref|XP_004232048.1|  PREDICTED: CDPK-related kinase 5                   244   2e-72   Solanum lycopersicum
ref|XP_010268715.1|  PREDICTED: CDPK-related kinase 5                   244   2e-72   Nelumbo nucifera [Indian lotus]
emb|CDP02477.1|  unnamed protein product                                243   3e-72   Coffea canephora [robusta coffee]
ref|XP_011039202.1|  PREDICTED: CDPK-related kinase 5-like              243   3e-72   Populus euphratica
ref|XP_004505191.1|  PREDICTED: CDPK-related kinase 5-like isofor...    243   3e-72   Cicer arietinum [garbanzo]
ref|XP_002310736.1|  hypothetical protein POPTR_0007s11320g             243   4e-72   
ref|XP_004505190.1|  PREDICTED: CDPK-related kinase 5-like isofor...    243   8e-72   Cicer arietinum [garbanzo]
ref|XP_008236646.1|  PREDICTED: CDPK-related kinase 5-like              241   1e-71   Prunus mume [ume]
ref|XP_007199766.1|  hypothetical protein PRUPE_ppa003176mg             241   2e-71   Prunus persica
gb|KJB43647.1|  hypothetical protein B456_007G210700                    241   2e-71   Gossypium raimondii
ref|XP_003608023.1|  Calcium/calmodulin-dependent protein kinase ...    240   3e-71   Medicago truncatula
ref|XP_010107975.1|  CDPK-related protein kinase                        240   3e-71   Morus notabilis
ref|XP_009366775.1|  PREDICTED: CDPK-related kinase 5-like              240   3e-71   Pyrus x bretschneideri [bai li]
gb|KHG22049.1|  CDPK-related protein kinase                             240   4e-71   Gossypium arboreum [tree cotton]
gb|KJB43646.1|  hypothetical protein B456_007G210700                    240   5e-71   Gossypium raimondii
gb|KHF98882.1|  CDPK-related protein kinase                             240   5e-71   Gossypium arboreum [tree cotton]
ref|XP_004290295.1|  PREDICTED: CDPK-related kinase 5-like              239   8e-71   Fragaria vesca subsp. vesca
ref|XP_009366804.1|  PREDICTED: CDPK-related kinase 5-like              239   1e-70   Pyrus x bretschneideri [bai li]
gb|AAZ83348.1|  CDPK-related protein kinase                             239   1e-70   Gossypium hirsutum [American cotton]
ref|XP_011099193.1|  PREDICTED: CDPK-related protein kinase isofo...    233   3e-70   Sesamum indicum [beniseed]
ref|XP_006579812.1|  PREDICTED: CDPK-related kinase 5-like isofor...    233   3e-70   Glycine max [soybeans]
ref|XP_002306462.1|  CROOKED family protein                             238   3e-70   Populus trichocarpa [western balsam poplar]
sp|P53681.1|CRK_DAUCA  RecName: Full=CDPK-related protein kinase;...    237   6e-70   Daucus carota [carrots]
ref|XP_007042370.1|  CDPK-related kinase                                237   6e-70   
gb|EYU44373.1|  hypothetical protein MIMGU_mgv1a003006mg                237   8e-70   Erythranthe guttata [common monkey flower]
dbj|BAF00328.1|  calcium/calmodulin-dependent protein kinase CaMK1      229   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268648.1|  PREDICTED: CDPK-related kinase 5-like isofor...    236   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010503722.1|  PREDICTED: CDPK-related kinase 5-like              235   5e-69   Camelina sativa [gold-of-pleasure]
gb|KJB32432.1|  hypothetical protein B456_005G240400                    230   5e-69   Gossypium raimondii
gb|KHN47935.1|  CDPK-related protein kinase                             234   6e-69   Glycine soja [wild soybean]
ref|XP_003525704.1|  PREDICTED: CDPK-related kinase 5-like isofor...    234   6e-69   Glycine max [soybeans]
gb|KCW63820.1|  hypothetical protein EUGRSUZ_G014962                    230   6e-69   Eucalyptus grandis [rose gum]
ref|XP_011099192.1|  PREDICTED: CDPK-related kinase 5 isoform X1        234   8e-69   Sesamum indicum [beniseed]
gb|KJB79287.1|  hypothetical protein B456_013G042100                    229   9e-69   Gossypium raimondii
gb|KJB79285.1|  hypothetical protein B456_013G042100                    229   9e-69   Gossypium raimondii
ref|XP_008795162.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...    234   1e-68   Phoenix dactylifera
ref|XP_010926368.1|  PREDICTED: CDPK-related protein kinase-like        227   1e-68   
ref|XP_010916660.1|  PREDICTED: CDPK-related kinase 5                   234   1e-68   Elaeis guineensis
emb|CDO97150.1|  unnamed protein product                                233   1e-68   Coffea canephora [robusta coffee]
emb|CDY69753.1|  BnaCnng65160D                                          232   2e-68   Brassica napus [oilseed rape]
gb|AET04065.2|  calmodulin-domain kinase CDPK protein                   233   2e-68   Medicago truncatula
ref|XP_009409499.1|  PREDICTED: CDPK-related kinase 5-like              233   2e-68   
ref|XP_006290766.1|  hypothetical protein CARUB_v10016874mg             233   2e-68   Capsella rubella
ref|XP_010426596.1|  PREDICTED: CDPK-related kinase 5-like              233   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010515424.1|  PREDICTED: CDPK-related kinase 5                   233   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009101966.1|  PREDICTED: CDPK-related kinase 5-like isofor...    232   3e-68   Brassica rapa
emb|CDY52824.1|  BnaAnng11710D                                          232   4e-68   Brassica napus [oilseed rape]
emb|CDY65016.1|  BnaCnng45690D                                          232   4e-68   Brassica napus [oilseed rape]
ref|XP_009115721.1|  PREDICTED: CDPK-related kinase 5                   232   4e-68   Brassica rapa
ref|XP_008392297.1|  PREDICTED: CDPK-related kinase 5-like              232   4e-68   Malus domestica [apple tree]
ref|XP_009101959.1|  PREDICTED: CDPK-related kinase 5-like isofor...    233   4e-68   Brassica rapa
ref|XP_009347422.1|  PREDICTED: CDPK-related kinase 5-like              232   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_010103697.1|  CDPK-related protein kinase                        232   5e-68   Morus notabilis
ref|XP_004509161.1|  PREDICTED: CDPK-related protein kinase-like        231   5e-68   Cicer arietinum [garbanzo]
ref|XP_006404024.1|  hypothetical protein EUTSA_v10010211mg             232   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006290767.1|  hypothetical protein CARUB_v10016874mg             232   6e-68   
ref|XP_002876036.1|  hypothetical protein ARALYDRAFT_485401             232   6e-68   
ref|XP_003629589.1|  Calcium/calmodulin-dependent protein kinase ...    232   6e-68   
gb|KJB48534.1|  hypothetical protein B456_008G074300                    231   7e-68   Gossypium raimondii
gb|KJB32430.1|  hypothetical protein B456_005G240400                    231   9e-68   Gossypium raimondii
gb|KHG25548.1|  CDPK-related protein kinase                             231   9e-68   Gossypium arboreum [tree cotton]
gb|KJB79283.1|  hypothetical protein B456_013G042100                    231   9e-68   Gossypium raimondii
ref|NP_190622.1|  CDPK-related kinase                                   231   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009358061.1|  PREDICTED: CDPK-related kinase 5-like              231   1e-67   Pyrus x bretschneideri [bai li]
gb|KFK34304.1|  hypothetical protein AALP_AA5G127600                    231   1e-67   Arabis alpina [alpine rockcress]
emb|CDY65651.1|  BnaCnng48080D                                          231   1e-67   Brassica napus [oilseed rape]
ref|XP_010066051.1|  PREDICTED: CDPK-related kinase 5                   231   1e-67   Eucalyptus grandis [rose gum]
gb|EPS68913.1|  hypothetical protein M569_05857                         223   1e-67   Genlisea aurea
ref|XP_011007668.1|  PREDICTED: CDPK-related kinase 5-like              231   1e-67   Populus euphratica
gb|KHG30483.1|  CDPK-related protein kinase                             231   1e-67   Gossypium arboreum [tree cotton]
ref|NP_001190048.1|  CDPK-related kinase                                231   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AFC88293.1|  calcium-dependent protein kinase 6                      230   2e-67   Hevea brasiliensis [jebe]
ref|XP_002521854.1|  calcium-dependent protein kinase, putative         230   2e-67   Ricinus communis
gb|KJB48530.1|  hypothetical protein B456_008G074300                    231   2e-67   Gossypium raimondii
ref|XP_004159890.1|  PREDICTED: CDPK-related protein kinase-like        225   3e-67   
gb|KDP38227.1|  hypothetical protein JCGZ_04870                         229   5e-67   Jatropha curcas
gb|AAL30814.1|AF435446_1  calcium/calmodulin-dependent protein ki...    229   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010680435.1|  PREDICTED: CDPK-related kinase 5                   229   7e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011085503.1|  PREDICTED: CDPK-related protein kinase-like        229   9e-67   Sesamum indicum [beniseed]
ref|NP_001169792.1|  uncharacterized protein LOC100383682               218   1e-66   
gb|KHN36210.1|  CDPK-related protein kinase                             226   1e-66   Glycine soja [wild soybean]
ref|XP_010558347.1|  PREDICTED: CDPK-related kinase 5-like              228   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_003516596.1|  PREDICTED: CDPK-related kinase 5-like              226   7e-66   Glycine max [soybeans]
ref|XP_004136991.1|  PREDICTED: CDPK-related protein kinase-like        226   1e-65   Cucumis sativus [cucumbers]
gb|EPS64045.1|  hypothetical protein M569_10738                         211   3e-65   Genlisea aurea
ref|XP_008457867.1|  PREDICTED: CDPK-related kinase 5-like              224   5e-65   Cucumis melo [Oriental melon]
ref|XP_004148051.1|  PREDICTED: CDPK-related protein kinase-like        224   5e-65   Cucumis sativus [cucumbers]
gb|KDO49130.1|  hypothetical protein CISIN_1g007776mg                   223   5e-65   Citrus sinensis [apfelsine]
ref|XP_004169045.1|  PREDICTED: CDPK-related protein kinase-like        210   6e-65   
ref|XP_011005000.1|  PREDICTED: CDPK-related kinase 5-like              219   1e-64   Populus euphratica
ref|XP_006480135.1|  PREDICTED: CDPK-related kinase 5-like              223   1e-64   Citrus sinensis [apfelsine]
ref|XP_010550381.1|  PREDICTED: CDPK-related kinase 5 isoform X2        223   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_006657969.1|  PREDICTED: CDPK-related protein kinase-like        218   2e-64   
ref|XP_006384440.1|  hypothetical protein POPTR_0004s15110g             223   2e-64   Populus trichocarpa [western balsam poplar]
gb|KDO49131.1|  hypothetical protein CISIN_1g007776mg                   222   2e-64   Citrus sinensis [apfelsine]
ref|XP_004511959.1|  PREDICTED: CDPK-related kinase 5-like              222   3e-64   Cicer arietinum [garbanzo]
ref|XP_010550380.1|  PREDICTED: CDPK-related kinase 5 isoform X1        223   3e-64   Tarenaya hassleriana [spider flower]
gb|EPS69494.1|  hypothetical protein M569_05270                         223   3e-64   Genlisea aurea
ref|XP_011001201.1|  PREDICTED: CDPK-related kinase 5-like              221   6e-64   Populus euphratica
ref|XP_006423061.1|  hypothetical protein CICLE_v10028073mg             220   1e-63   Citrus clementina [clementine]
ref|XP_009389551.1|  PREDICTED: CDPK-related kinase 5-like              219   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC82459.1|  hypothetical protein OsI_26896                          216   5e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_006829951.1|  hypothetical protein AMTR_s00073p00197610          219   6e-63   Amborella trichopoda
ref|XP_006836275.1|  hypothetical protein AMTR_s00101p00154790          218   8e-63   Amborella trichopoda
tpg|DAA63630.1|  TPA: putative protein kinase superfamily protein       213   2e-62   
ref|XP_008668447.1|  PREDICTED: uncharacterized protein LOC100383...    216   3e-62   
dbj|BAK06421.1|  predicted protein                                      216   4e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010028268.1|  PREDICTED: CDPK-related kinase 5                   217   4e-62   Eucalyptus grandis [rose gum]
ref|NP_001060297.1|  Os07g0619800                                       212   9e-62   
ref|XP_003562669.1|  PREDICTED: CDPK-related kinase 5-like              215   1e-61   Brachypodium distachyon [annual false brome]
ref|XP_004958339.1|  PREDICTED: CDPK-related kinase 5-like              215   1e-61   Setaria italica
ref|XP_007156824.1|  hypothetical protein PHAVU_002G020800g             214   1e-61   Phaseolus vulgaris [French bean]
ref|XP_003611786.1|  CDPK-related protein kinase                        214   2e-61   Medicago truncatula
gb|EMS58490.1|  CDPK-related protein kinase                             215   3e-61   Triticum urartu
ref|XP_002463191.1|  hypothetical protein SORBIDRAFT_02g039460          213   5e-61   Sorghum bicolor [broomcorn]
tpg|DAA63631.1|  TPA: LOW QUALITY PROTEIN: putative protein kinas...    213   7e-61   
gb|AAV64211.1|  putative CDPK-related protein kinase                    213   7e-61   Zea mays [maize]
gb|ACG29695.1|  hypothetical protein                                    213   7e-61   Zea mays [maize]
dbj|BAC79915.1|  putative CDPK-related protein kinase                   212   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146922.1|  LOC100280531                                       211   4e-60   Zea mays [maize]
ref|XP_008676192.1|  PREDICTED: CDPK-related protein kinase-like        197   6e-60   
ref|XP_004142011.1|  PREDICTED: CDPK-related protein kinase-like        206   4e-58   Cucumis sativus [cucumbers]
ref|NP_181647.1|  CDPK-related kinase 1                                 205   4e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EEE59106.1|  hypothetical protein OsJ_10964                          201   6e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001167827.1|  uncharacterized LOC100381527                       201   1e-57   Zea mays [maize]
ref|XP_002313096.2|  hypothetical protein POPTR_0009s10880g             204   2e-57   
ref|XP_010523217.1|  PREDICTED: CDPK-related kinase 8 isoform X1        203   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_002879911.1|  hypothetical protein ARALYDRAFT_483182             203   3e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_008440253.1|  PREDICTED: CDPK-related kinase 5 isoform X2        204   3e-57   Cucumis melo [Oriental melon]
gb|ACU18167.1|  unknown                                                 194   3e-57   Glycine max [soybeans]
ref|XP_004249131.1|  PREDICTED: CDPK-related kinase 1                   202   4e-57   Solanum lycopersicum
emb|CDY47375.1|  BnaC04g24880D                                          202   5e-57   Brassica napus [oilseed rape]
emb|CDX76010.1|  BnaA04g02740D                                          202   6e-57   
ref|XP_007028316.1|  CDPK-related kinase 1                              202   8e-57   
ref|XP_009133469.1|  PREDICTED: CDPK-related kinase 1                   201   8e-57   Brassica rapa
ref|XP_006393243.1|  hypothetical protein EUTSA_v10011327mg             202   8e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006411380.1|  hypothetical protein EUTSA_v10016437mg             202   8e-57   Eutrema salsugineum [saltwater cress]
emb|CDY35427.1|  BnaA03g19330D                                          201   9e-57   Brassica napus [oilseed rape]
emb|CDY22505.1|  BnaC03g23150D                                          201   9e-57   Brassica napus [oilseed rape]
ref|XP_008359596.1|  PREDICTED: CDPK-related kinase 1-like              191   1e-56   
gb|EEC75325.1|  hypothetical protein OsI_11701                          202   1e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001050179.1|  Os03g0366200                                       202   1e-56   
sp|Q10KY3.1|CAMK1_ORYSJ  RecName: Full=Calcium/calmodulin-depende...    202   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59103.1|  hypothetical protein OsJ_10960                          201   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010517602.1|  PREDICTED: CDPK-related kinase 1 isoform X3        196   1e-56   
dbj|BAC16472.1|  putative calcium/calmodulin-dependent protein ki...    201   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82532.1|  hypothetical protein OsI_27055                          201   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_007202163.1|  hypothetical protein PRUPE_ppa006385mg             197   1e-56   
ref|XP_009618516.1|  PREDICTED: CDPK-related kinase 7-like              201   1e-56   Nicotiana tomentosiformis
ref|XP_007155948.1|  hypothetical protein PHAVU_003G2460001g            187   2e-56   Phaseolus vulgaris [French bean]
ref|XP_008668263.1|  PREDICTED: uncharacterized LOC100381527 isof...    201   2e-56   Zea mays [maize]
ref|XP_011079071.1|  PREDICTED: CDPK-related kinase 1-like              201   2e-56   Sesamum indicum [beniseed]
ref|XP_009761409.1|  PREDICTED: CDPK-related kinase 1-like              200   2e-56   Nicotiana sylvestris
ref|XP_009142724.1|  PREDICTED: CDPK-related kinase 1-like              200   2e-56   Brassica rapa
ref|XP_006293901.1|  hypothetical protein CARUB_v10022894mg             200   3e-56   Capsella rubella
ref|XP_006362272.1|  PREDICTED: CDPK-related kinase 1-like              200   3e-56   Solanum tuberosum [potatoes]
ref|XP_004958484.1|  PREDICTED: calcium/calmodulin-dependent seri...    201   3e-56   Setaria italica
gb|KFK36961.1|  hypothetical protein AALP_AA4G195100                    200   3e-56   Arabis alpina [alpine rockcress]
ref|NP_001169442.1|  uncharacterized LOC100383313                       201   3e-56   Zea mays [maize]
emb|CDX79956.1|  BnaA05g02000D                                          200   3e-56   
dbj|BAK00699.1|  predicted protein                                      201   3e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY23873.1|  BnaC04g01640D                                          200   3e-56   Brassica napus [oilseed rape]
ref|XP_009420969.1|  PREDICTED: calcium/calmodulin-dependent seri...    200   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562581.1|  PREDICTED: calcium/calmodulin-dependent seri...    201   3e-56   Brachypodium distachyon [annual false brome]
gb|KHN42064.1|  CDPK-related protein kinase                             201   4e-56   Glycine soja [wild soybean]
ref|XP_011000411.1|  PREDICTED: CDPK-related kinase 7-like              200   5e-56   Populus euphratica
ref|XP_002463267.1|  hypothetical protein SORBIDRAFT_02g040850          199   8e-56   Sorghum bicolor [broomcorn]
ref|XP_009139075.1|  PREDICTED: CDPK-related kinase 7-like              199   1e-55   Brassica rapa
ref|XP_006430540.1|  hypothetical protein CICLE_v10011368mg             195   1e-55   
ref|XP_006658886.1|  PREDICTED: calcium/calmodulin-dependent seri...    197   1e-55   Oryza brachyantha
gb|AAK54157.1|AF368282_1  CaMK1                                         199   1e-55   Oryza sativa [red rice]
ref|XP_008440252.1|  PREDICTED: CDPK-related kinase 5 isoform X1        199   1e-55   Cucumis melo [Oriental melon]
gb|EYU20808.1|  hypothetical protein MIMGU_mgv1a003516mg                199   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_010523218.1|  PREDICTED: CDPK-related kinase 8 isoform X2        199   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_008240668.1|  PREDICTED: CDPK-related kinase 7                   198   2e-55   Prunus mume [ume]
ref|XP_008798377.1|  PREDICTED: calcium/calmodulin-dependent seri...    198   2e-55   Phoenix dactylifera
ref|XP_010525467.1|  PREDICTED: CDPK-related kinase 1-like              198   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_010542604.1|  PREDICTED: CDPK-related kinase 1                   198   2e-55   Tarenaya hassleriana [spider flower]
gb|KDO53615.1|  hypothetical protein CISIN_1g0074582mg                  195   2e-55   Citrus sinensis [apfelsine]
gb|KDP27484.1|  hypothetical protein JCGZ_20019                         197   3e-55   Jatropha curcas
ref|XP_003554117.2|  PREDICTED: CDPK-related kinase 1                   195   3e-55   
emb|CDP06189.1|  unnamed protein product                                197   3e-55   Coffea canephora [robusta coffee]
ref|XP_010673049.1|  PREDICTED: CDPK-related kinase 7-like              197   3e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010517599.1|  PREDICTED: CDPK-related kinase 1 isoform X1        197   3e-55   
ref|NP_191235.1|  CDPK-related kinase 7                                 197   4e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522159.1|  calcium-dependent protein kinase, putative         196   4e-55   
ref|XP_003624963.1|  Calcium-dependent protein kinase-like protein      197   4e-55   Medicago truncatula
ref|XP_009393900.1|  PREDICTED: calcium/calmodulin-dependent seri...    197   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010508754.1|  PREDICTED: CDPK-related kinase 1-like              197   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006402951.1|  hypothetical protein EUTSA_v10005861mg             197   5e-55   Eutrema salsugineum [saltwater cress]
ref|XP_004493390.1|  PREDICTED: CDPK-related kinase 7-like              197   6e-55   Cicer arietinum [garbanzo]
ref|XP_006482068.1|  PREDICTED: CDPK-related kinase 7-like              197   6e-55   Citrus sinensis [apfelsine]
ref|XP_010909915.1|  PREDICTED: CDPK-related kinase 7-like isofor...    197   6e-55   Elaeis guineensis
ref|XP_006430539.1|  hypothetical protein CICLE_v10011368mg             196   7e-55   Citrus clementina [clementine]
ref|XP_010907987.1|  PREDICTED: calcium/calmodulin-dependent seri...    196   7e-55   Elaeis guineensis
ref|XP_002878106.1|  hypothetical protein ARALYDRAFT_486115             196   9e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_006651413.1|  PREDICTED: calcium/calmodulin-dependent seri...    195   1e-54   
ref|XP_009371242.1|  PREDICTED: CDPK-related kinase 7-like              196   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_010427515.1|  PREDICTED: CDPK-related kinase 7-like isofor...    196   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006290768.1|  hypothetical protein CARUB_v10016875mg             196   2e-54   
ref|XP_008777902.1|  PREDICTED: calcium/calmodulin-dependent seri...    196   2e-54   Phoenix dactylifera
ref|NP_175381.1|  CDPK-related kinase 8                                 196   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322616.1|  CDPK-related kinase 1 family protein               195   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010504583.1|  PREDICTED: CDPK-related kinase 7-like              195   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010516279.1|  PREDICTED: CDPK-related kinase 7                   195   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010427514.1|  PREDICTED: CDPK-related kinase 7-like isofor...    195   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008464947.1|  PREDICTED: CDPK-related kinase 1-like isofor...    192   3e-54   
ref|XP_002891522.1|  hypothetical protein ARALYDRAFT_474093             195   4e-54   Arabidopsis lyrata subsp. lyrata
gb|KFK35999.1|  hypothetical protein AALP_AA4G064700                    194   8e-54   Arabis alpina [alpine rockcress]
emb|CDY18568.1|  BnaA01g26270D                                          194   9e-54   Brassica napus [oilseed rape]
ref|XP_009112142.1|  PREDICTED: CDPK-related kinase 2                   194   9e-54   Brassica rapa
gb|KJB35809.1|  hypothetical protein B456_006G129900                    193   1e-53   Gossypium raimondii
ref|XP_008464946.1|  PREDICTED: CDPK-related kinase 1-like isofor...    193   1e-53   Cucumis melo [Oriental melon]
ref|XP_009405856.1|  PREDICTED: calcium/calmodulin-dependent seri...    193   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX95464.1|  BnaC01g33560D                                          193   1e-53   
ref|XP_007145486.1|  hypothetical protein PHAVU_007G243100g             193   1e-53   Phaseolus vulgaris [French bean]
ref|XP_007163947.1|  hypothetical protein PHAVU_L003400g                193   2e-53   Phaseolus vulgaris [French bean]
ref|XP_008464945.1|  PREDICTED: CDPK-related kinase 7-like isofor...    193   2e-53   Cucumis melo [Oriental melon]
ref|XP_003535908.1|  PREDICTED: CDPK-related kinase 1-like              192   2e-53   Glycine max [soybeans]
ref|XP_003557839.1|  PREDICTED: calcium/calmodulin-dependent seri...    192   3e-53   Brachypodium distachyon [annual false brome]
ref|XP_008658484.1|  PREDICTED: uncharacterized LOC100279633 isof...    192   3e-53   Zea mays [maize]
ref|NP_001146101.1|  uncharacterized LOC100279633                       192   3e-53   Zea mays [maize]
ref|XP_010228587.1|  PREDICTED: calcium/calmodulin-dependent seri...    192   3e-53   
ref|XP_002862200.1|  hypothetical protein ARALYDRAFT_921091             189   4e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_010922072.1|  PREDICTED: calcium/calmodulin-dependent seri...    192   4e-53   Elaeis guineensis
ref|XP_011075448.1|  PREDICTED: CDPK-related kinase 1                   192   5e-53   Sesamum indicum [beniseed]
ref|XP_006299075.1|  hypothetical protein CARUB_v10015215mg             192   5e-53   Capsella rubella
ref|XP_003518984.1|  PREDICTED: CDPK-related kinase 7-like isofor...    191   5e-53   Glycine max [soybeans]
emb|CDX92303.1|  BnaA05g21040D                                          192   6e-53   
emb|CDX99267.1|  BnaC05g33820D                                          191   6e-53   
ref|XP_010466044.1|  PREDICTED: CDPK-related kinase 2-like              192   7e-53   Camelina sativa [gold-of-pleasure]
gb|KHG24093.1|  Calcium/calmodulin-dependent serine/threonine-pro...    191   7e-53   Gossypium arboreum [tree cotton]
ref|XP_004984283.1|  PREDICTED: calcium/calmodulin-dependent seri...    191   7e-53   Setaria italica
gb|KFK34914.1|  hypothetical protein AALP_AA5G210000                    191   8e-53   Arabis alpina [alpine rockcress]
ref|XP_009145826.1|  PREDICTED: CDPK-related kinase 2-like              192   8e-53   Brassica rapa
ref|XP_009404698.1|  PREDICTED: calcium/calmodulin-dependent seri...    191   9e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT10573.1|  Calcium/calmodulin-dependent serine/threonine-pro...    191   9e-53   
ref|XP_006406536.1|  hypothetical protein EUTSA_v10020326mg             191   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010487837.1|  PREDICTED: CDPK-related kinase 2                   190   2e-52   
ref|XP_010507434.1|  PREDICTED: CDPK-related kinase 2                   190   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002883163.1|  hypothetical protein ARALYDRAFT_898284             189   5e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_002467812.1|  hypothetical protein SORBIDRAFT_01g034520          189   6e-52   Sorghum bicolor [broomcorn]
ref|XP_004141122.1|  PREDICTED: calcium/calmodulin-dependent seri...    188   7e-52   Cucumis sativus [cucumbers]
ref|XP_010479393.1|  PREDICTED: CDPK-related kinase 8-like              188   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010909914.1|  PREDICTED: CDPK-related kinase 7-like isofor...    187   2e-51   Elaeis guineensis
ref|XP_010271816.1|  PREDICTED: CDPK-related kinase 7-like              187   2e-51   Nelumbo nucifera [Indian lotus]
gb|AAD38059.1|AF153352_1  CDPK-related kinase 2                         187   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107289.1|  PREDICTED: CDPK-related kinase 8 isoform X2        187   2e-51   Brassica rapa
ref|XP_009107288.1|  PREDICTED: CDPK-related kinase 8 isoform X1        187   2e-51   Brassica rapa
ref|XP_010246175.1|  PREDICTED: CDPK-related kinase 1-like              187   2e-51   
ref|NP_188541.1|  CDPK-related kinase 2                                 187   2e-51   
ref|XP_002282577.1|  PREDICTED: CDPK-related kinase 1                   186   4e-51   
ref|XP_008377644.1|  PREDICTED: CDPK-related kinase 7-like isofor...    186   4e-51   
emb|CBI32784.3|  unnamed protein product                                186   5e-51   
gb|KFK39251.1|  hypothetical protein AALP_AA3G220000                    186   6e-51   
ref|XP_010500502.1|  PREDICTED: CDPK-related kinase 8-like              186   6e-51   
ref|XP_006303933.1|  hypothetical protein CARUB_v10008616mg             186   1e-50   
ref|XP_010461799.1|  PREDICTED: CDPK-related kinase 8                   185   1e-50   
ref|NP_001140858.1|  uncharacterized LOC100272934                       184   3e-50   
ref|XP_009135614.1|  PREDICTED: CDPK-related kinase 2-like isofor...    184   3e-50   
ref|XP_008667154.1|  PREDICTED: uncharacterized LOC100272934 isof...    185   3e-50   
emb|CDX77233.1|  BnaC08g02780D                                          184   4e-50   
emb|CDY16510.1|  BnaA08g02570D                                          184   5e-50   
ref|XP_008377637.1|  PREDICTED: CDPK-related kinase 7-like isofor...    182   2e-49   
ref|XP_006290769.1|  hypothetical protein CARUB_v10016875mg             181   3e-49   
ref|XP_001768867.1|  predicted protein                                  178   4e-49   
ref|XP_008455724.1|  PREDICTED: CDPK-related kinase 1 isoform X2        176   6e-49   
emb|CDY22990.1|  BnaC03g40790D                                          181   6e-49   
emb|CDX82311.1|  BnaA03g35100D                                          180   8e-49   
ref|XP_002960835.1|  CPK related protein kinase 5                       178   4e-48   
ref|XP_002983837.1|  CPK-related protein kinase 3                       178   5e-48   
ref|XP_011088749.1|  PREDICTED: CDPK-related protein kinase-like        176   2e-47   
ref|XP_008455723.1|  PREDICTED: CDPK-related kinase 1 isoform X1        176   2e-47   
gb|EMS61574.1|  Calcium/calmodulin-dependent serine/threonine-pro...    176   1e-46   
ref|XP_001751663.1|  predicted protein                                  171   9e-46   
gb|EYU37708.1|  hypothetical protein MIMGU_mgv1a005157mg                171   1e-45   
gb|KCW47909.1|  hypothetical protein EUGRSUZ_K01647                     169   2e-45   
gb|EPS59727.1|  hypothetical protein M569_15078                         170   3e-45   
ref|XP_001763397.1|  predicted protein                                  169   5e-45   
ref|XP_004144329.1|  PREDICTED: CDPK-related protein kinase-like        168   2e-44   
ref|XP_010036359.1|  PREDICTED: CDPK-related kinase 1-like              167   3e-44   
ref|XP_002973513.1|  CDK related protein kinase 5                       166   8e-44   
ref|XP_002975545.1|  CDPK-related protein kinase 3                      166   9e-44   
gb|ABK25039.1|  unknown                                                 166   1e-43   
ref|XP_001751664.1|  predicted protein                                  164   2e-43   
ref|XP_010251747.1|  PREDICTED: CDPK-related kinase 3-like              165   3e-43   
ref|XP_006846568.1|  hypothetical protein AMTR_s00018p00240170          164   3e-43   
ref|XP_010907988.1|  PREDICTED: calcium/calmodulin-dependent seri...    164   6e-43   
ref|XP_001773184.1|  crk2 CDPK-related kinase                           163   1e-42   
ref|XP_002266654.1|  PREDICTED: CDPK-related kinase 3 isoform X1        162   4e-42   
ref|XP_008233079.1|  PREDICTED: CDPK-related kinase 3 isoform X2        158   4e-42   
ref|XP_011084555.1|  PREDICTED: CDPK-related kinase 6-like              161   5e-42   
ref|XP_008669940.1|  PREDICTED: calcium/calmodulin-dependent seri...    152   7e-42   
gb|ADN34224.1|  calcium-dependent protein kinase                        155   9e-42   
ref|XP_008364833.1|  PREDICTED: CDPK-related kinase 3-like              157   9e-42   
ref|XP_008233078.1|  PREDICTED: CDPK-related kinase 3 isoform X1        159   2e-41   
ref|XP_004166903.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...    160   2e-41   
ref|XP_004140506.1|  PREDICTED: CDPK-related protein kinase-like        160   2e-41   
ref|XP_007218866.1|  hypothetical protein PRUPE_ppa003103mg             159   3e-41   
gb|KHN06347.1|  CDPK-related protein kinase                             156   5e-41   
ref|XP_008376189.1|  PREDICTED: CDPK-related kinase 3                   158   5e-41   
dbj|BAD54109.1|  putative calcium/calmodulin-dependent protein ki...    158   8e-41   
ref|XP_004494853.1|  PREDICTED: CDPK-related kinase 3-like              158   8e-41   
gb|EYU19682.1|  hypothetical protein MIMGU_mgv1a003314mg                157   1e-40   
dbj|BAD94474.1|  calcium dependent protein kinase CP4                   147   1e-40   
ref|XP_009366623.1|  PREDICTED: CDPK-related kinase 3-like              157   1e-40   
gb|AFK35666.1|  unknown                                                 155   2e-40   
ref|XP_008459759.1|  PREDICTED: CDPK-related kinase 3 isoform X2        155   2e-40   
ref|XP_006657343.1|  PREDICTED: CDPK-related kinase 3-like              156   2e-40   
ref|XP_003528772.1|  PREDICTED: CDPK-related kinase 3-like              157   2e-40   
dbj|BAJ96597.1|  predicted protein                                      157   3e-40   
ref|XP_003563563.1|  PREDICTED: CDPK-related kinase 3-like              156   3e-40   
ref|XP_008459758.1|  PREDICTED: CDPK-related kinase 3 isoform X1        156   3e-40   
ref|XP_004966436.1|  PREDICTED: CDPK-related kinase 3-like              156   3e-40   
gb|KHG10876.1|  CDPK-related protein kinase                             155   4e-40   
ref|XP_003626588.1|  Calcium dependent protein kinase-like protein      156   4e-40   
gb|KJB23990.1|  hypothetical protein B456_004G123900                    155   5e-40   
ref|XP_010523557.1|  PREDICTED: CDPK-related kinase 4                   155   5e-40   
dbj|BAA22410.1|  calcium-dependent protein kinase-related kinase        154   7e-40   
dbj|BAA12691.1|  CDPK-related protein kinase                            155   8e-40   
gb|ACF81864.1|  unknown                                                 152   1e-39   
ref|NP_001105740.1|  calcium dependent protein kinase1                  155   1e-39   
gb|ACG29980.1|  CDPK-related protein kinase                             154   1e-39   
ref|XP_010267443.1|  PREDICTED: CDPK-related kinase 3 isoform X1        154   1e-39   
ref|XP_009150150.1|  PREDICTED: CDPK-related kinase 6                   154   1e-39   
ref|XP_002437591.1|  hypothetical protein SORBIDRAFT_10g030040          154   1e-39   
ref|XP_009389129.1|  PREDICTED: CDPK-related kinase 3-like              154   2e-39   
ref|XP_007135298.1|  hypothetical protein PHAVU_010G117600g             154   2e-39   
emb|CDY00200.1|  BnaA06g21010D                                          154   2e-39   
gb|KJB48531.1|  hypothetical protein B456_008G074300                    154   3e-39   
emb|CDX86978.1|  BnaC03g52480D                                          154   3e-39   
ref|XP_009796477.1|  PREDICTED: CDPK-related kinase 3                   153   3e-39   
ref|XP_009588677.1|  PREDICTED: CDPK-related kinase 3                   153   3e-39   
ref|XP_009375450.1|  PREDICTED: CDPK-related kinase 3 isoform X2        150   4e-39   
ref|XP_010691967.1|  PREDICTED: CDPK-related kinase 3 isoform X2        153   4e-39   
emb|CDY05930.1|  BnaC08g21070D                                          153   4e-39   
ref|NP_001154582.1|  CDPK-related kinase 3                              150   4e-39   
ref|XP_010515290.1|  PREDICTED: CDPK-related kinase 6-like isofor...    150   5e-39   
emb|CDY08129.1|  BnaA06g15970D                                          153   5e-39   
gb|AFW69483.1|  putative protein kinase superfamily protein             153   6e-39   
ref|XP_010503590.1|  PREDICTED: CDPK-related kinase 6 isoform X3        150   7e-39   
ref|XP_011468906.1|  PREDICTED: CDPK-related kinase 3 isoform X2        150   8e-39   
gb|KDP21986.1|  hypothetical protein JCGZ_03151                         152   8e-39   
ref|XP_008354047.1|  PREDICTED: CDPK-related kinase 3-like              150   8e-39   
ref|XP_004309103.1|  PREDICTED: CDPK-related kinase 4-like              152   8e-39   
ref|XP_002515635.1|  calcium-dependent protein kinase, putative         152   1e-38   
ref|XP_007218875.1|  hypothetical protein PRUPE_ppa003281mg             152   1e-38   
ref|XP_010933746.1|  PREDICTED: CDPK-related kinase 3-like isofor...    152   1e-38   
ref|XP_009375449.1|  PREDICTED: CDPK-related kinase 3 isoform X1        152   1e-38   
gb|EPS62160.1|  hypothetical protein M569_12634                         142   1e-38   
ref|XP_010426446.1|  PREDICTED: CDPK-related kinase 6-like              152   1e-38   
ref|XP_010933744.1|  PREDICTED: CDPK-related kinase 3-like isofor...    152   2e-38   
ref|XP_006444766.1|  hypothetical protein CICLE_v10019386mg             151   2e-38   
gb|AAL58909.1|AF462819_1  At2g46700/T3A4.8                              151   2e-38   
ref|NP_182193.1|  CDPK-related kinase 3                                 151   2e-38   
ref|XP_006290782.1|  hypothetical protein CARUB_v10016886mg             151   2e-38   
ref|XP_002529963.1|  calcium-dependent protein kinase, putative         151   2e-38   
ref|XP_010906430.1|  PREDICTED: CDPK-related kinase 3-like isofor...    149   2e-38   
ref|XP_010515289.1|  PREDICTED: CDPK-related kinase 6-like isofor...    151   3e-38   
emb|CDY19836.1|  BnaA09g04890D                                          150   3e-38   
ref|XP_008234671.1|  PREDICTED: CDPK-related kinase 4-like              150   3e-38   
ref|XP_009111629.1|  PREDICTED: CDPK-related kinase 4                   150   3e-38   
gb|ACF84338.1|  unknown                                                 151   3e-38   
ref|XP_009149741.1|  PREDICTED: CDPK-related kinase 6                   150   3e-38   
ref|XP_002874198.1|  hypothetical protein ARALYDRAFT_910482             150   3e-38   
ref|XP_004308284.1|  PREDICTED: CDPK-related kinase 3 isoform X1        150   3e-38   
ref|NP_001105305.1|  LOC542225                                          150   3e-38   
ref|XP_010454753.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...    150   3e-38   
ref|XP_010503589.1|  PREDICTED: CDPK-related kinase 6 isoform X2        150   3e-38   
gb|AAG01179.1|AF289237_1  calcium/calmodulin dependent protein ki...    150   3e-38   
ref|XP_010515287.1|  PREDICTED: CDPK-related kinase 6-like isofor...    150   4e-38   
ref|XP_008796870.1|  PREDICTED: CDPK-related kinase 3-like              150   4e-38   
ref|XP_007136495.1|  hypothetical protein PHAVU_009G050100g             150   4e-38   
ref|XP_010421271.1|  PREDICTED: CDPK-related kinase 4                   150   4e-38   
ref|XP_010503588.1|  PREDICTED: CDPK-related kinase 6 isoform X1        150   5e-38   
ref|NP_001234146.1|  serine/threonine protein kinase pk23               150   6e-38   
ref|XP_011027260.1|  PREDICTED: CDPK-related kinase 1-like isofor...    148   6e-38   
ref|XP_002308892.2|  CDPK-related kinase 1 family protein               149   6e-38   
ref|XP_010906427.1|  PREDICTED: CDPK-related kinase 3-like isofor...    149   6e-38   
ref|XP_010906426.1|  PREDICTED: CDPK-related kinase 3-like isofor...    150   7e-38   
emb|CDX87128.1|  BnaC09g04430D                                          149   7e-38   
ref|XP_008776464.1|  PREDICTED: CDPK-related kinase 3-like isofor...    149   7e-38   
ref|XP_010662917.1|  PREDICTED: CDPK-related kinase 3 isoform X2        148   7e-38   
ref|XP_010906425.1|  PREDICTED: CDPK-related kinase 3-like isofor...    149   8e-38   
ref|XP_010906424.1|  PREDICTED: CDPK-related kinase 3-like isofor...    149   8e-38   
gb|KFK27643.1|  hypothetical protein AALP_AA8G409900                    149   9e-38   
gb|AAL30817.1|AF435449_1  calcium/calmodulin-dependent protein ki...    149   9e-38   
emb|CDP08633.1|  unnamed protein product                                149   9e-38   
ref|XP_010493602.1|  PREDICTED: CDPK-related kinase 4-like              149   1e-37   
ref|XP_011027259.1|  PREDICTED: CDPK-related kinase 7-like isofor...    149   1e-37   
gb|KFK27721.1|  hypothetical protein AALP_AA8G420900                    149   1e-37   
gb|KHG10111.1|  CDPK-related protein kinase                             149   1e-37   
ref|XP_006347491.1|  PREDICTED: CDPK-related kinase 4-like              149   1e-37   
ref|XP_010100681.1|  CDPK-related protein kinase                        149   1e-37   
emb|CAN64098.1|  hypothetical protein VITISV_014897                     149   1e-37   
ref|XP_002464385.1|  hypothetical protein SORBIDRAFT_01g017320          148   2e-37   
ref|XP_006404152.1|  hypothetical protein EUTSA_v10010221mg             149   2e-37   
gb|AAM91611.1|  calcium dependent protein kinase-like protein           147   2e-37   
ref|XP_002273024.1|  PREDICTED: CDPK-related kinase 3 isoform X1        148   2e-37   
ref|XP_009418319.1|  PREDICTED: CDPK-related kinase 3-like              148   2e-37   
emb|CBI23068.3|  unnamed protein product                                147   2e-37   
ref|XP_010691907.1|  PREDICTED: CDPK-related kinase 3 isoform X1        148   2e-37   
ref|XP_011023119.1|  PREDICTED: CDPK-related kinase 3 isoform X4        145   3e-37   
ref|XP_003602328.1|  Calcium dependent protein kinase-like protein      148   3e-37   
ref|XP_002302662.1|  calcium-dependent protein kinase                   148   3e-37   
gb|KDP28435.1|  hypothetical protein JCGZ_14206                         148   3e-37   
gb|AAC24961.1|  CDPK-related protein kinase                             146   4e-37   
ref|NP_190506.1|  CDPK-related kinase 6                                 147   4e-37   
gb|AAD28759.1|AF130252_1  calcium dependent protein kinase CP4          146   4e-37   
ref|XP_011023118.1|  PREDICTED: CDPK-related kinase 3 isoform X3        146   5e-37   
ref|XP_010523832.1|  PREDICTED: CDPK-related kinase 3 isoform X2        145   5e-37   
ref|XP_006394699.1|  hypothetical protein EUTSA_v10003876mg             147   5e-37   
ref|XP_011023117.1|  PREDICTED: CDPK-related kinase 3 isoform X2        145   6e-37   
ref|XP_011023116.1|  PREDICTED: CDPK-related kinase 3 isoform X1        147   7e-37   
ref|NP_197831.3|  CDPK-related kinase 4 (AtCRK4)                        147   7e-37   
gb|EEE66354.1|  hypothetical protein OsJ_22648                          147   8e-37   
ref|XP_010267444.1|  PREDICTED: CDPK-related kinase 3 isoform X2        146   8e-37   
ref|XP_004230019.1|  PREDICTED: CDPK-related kinase 3                   146   9e-37   
ref|XP_008376799.1|  PREDICTED: CDPK-related kinase 4-like              146   9e-37   
emb|CDX88104.1|  BnaA06g26950D                                          146   9e-37   
ref|XP_002877670.1|  hypothetical protein ARALYDRAFT_485296             146   9e-37   
gb|KJB09604.1|  hypothetical protein B456_001G152000                    145   1e-36   
ref|XP_004502721.1|  PREDICTED: CDPK-related kinase 4-like              146   1e-36   
ref|XP_008791676.1|  PREDICTED: CDPK-related kinase 3-like isofor...    145   1e-36   
gb|KHG14961.1|  CDPK-related protein kinase                             146   1e-36   
gb|KJB09598.1|  hypothetical protein B456_001G152000                    146   1e-36   
ref|XP_010112837.1|  Calcium/calmodulin-dependent serine/threonin...    146   1e-36   
emb|CDX80445.1|  BnaC07g29990D                                          146   1e-36   
ref|XP_006661945.1|  PREDICTED: CDPK-related kinase 3-like              145   1e-36   
ref|XP_011038973.1|  PREDICTED: CDPK-related kinase 3-like              145   2e-36   
emb|CDY27530.1|  BnaC04g51710D                                          145   2e-36   
ref|XP_010523831.1|  PREDICTED: CDPK-related kinase 3 isoform X1        145   2e-36   
ref|XP_008776463.1|  PREDICTED: CDPK-related kinase 3-like isofor...    145   2e-36   
ref|XP_010518347.1|  PREDICTED: CDPK-related kinase 3                   145   2e-36   
ref|XP_006286478.1|  hypothetical protein CARUB_v10000513mg             145   2e-36   
ref|XP_002882085.1|  hypothetical protein ARALYDRAFT_483834             145   2e-36   
gb|KHN19539.1|  CDPK-related protein kinase                             144   2e-36   
ref|XP_008791673.1|  PREDICTED: CDPK-related kinase 3-like isofor...    145   3e-36   
gb|AAK84452.1|AC087192_13  putative kinase                              145   3e-36   
ref|XP_002320890.1|  calcium-dependent protein kinase                   145   3e-36   
ref|XP_009361299.1|  PREDICTED: CDPK-related kinase 4-like              144   4e-36   
ref|XP_009624842.1|  PREDICTED: CDPK-related kinase 4-like isofor...    143   4e-36   
ref|XP_002317812.1|  calcium-dependent protein kinase                   144   4e-36   
ref|XP_011094288.1|  PREDICTED: CDPK-related kinase 3                   144   4e-36   
ref|XP_010506686.1|  PREDICTED: CDPK-related kinase 3-like              144   5e-36   
ref|XP_006293857.1|  hypothetical protein CARUB_v10022864mg             144   5e-36   
ref|XP_003522533.1|  PREDICTED: CDPK-related kinase 4-like              144   6e-36   
ref|XP_007039175.1|  Calcium-dependent protein kinase (CDPK) fami...    144   6e-36   
ref|XP_003526744.1|  PREDICTED: CDPK-related kinase 6-like              144   6e-36   
ref|XP_009150973.1|  PREDICTED: CDPK-related kinase 4-like              144   6e-36   
ref|XP_004982632.1|  PREDICTED: CDPK-related kinase 3-like              144   8e-36   
gb|KJB41588.1|  hypothetical protein B456_007G111600                    144   8e-36   
emb|CDP05005.1|  unnamed protein product                                144   9e-36   
ref|XP_009624841.1|  PREDICTED: CDPK-related kinase 4-like isofor...    144   9e-36   
ref|XP_009142438.1|  PREDICTED: CDPK-related kinase 3                   143   1e-35   
gb|KFK37447.1|  hypothetical protein AALP_AA4G258000                    143   1e-35   
ref|XP_010507983.1|  PREDICTED: CDPK-related kinase 3-like              143   2e-35   
emb|CDY48019.1|  BnaA04g26710D                                          143   2e-35   
ref|XP_007051459.1|  CDPK-related kinase 3 isoform 1                    143   2e-35   
gb|AAL30818.1|AF435450_1  calcium/calmodulin-dependent protein ki...    142   2e-35   
ref|XP_006397861.1|  hypothetical protein EUTSA_v10001366mg             142   2e-35   
ref|XP_009768687.1|  PREDICTED: CDPK-related kinase 4-like isofor...    141   3e-35   
ref|XP_010054975.1|  PREDICTED: CDPK-related kinase 3                   142   3e-35   
gb|AFW82166.1|  hypothetical protein ZEAMMB73_583819                    132   5e-35   
ref|XP_009768686.1|  PREDICTED: CDPK-related kinase 4-like isofor...    141   5e-35   
ref|XP_006339759.1|  PREDICTED: CDPK-related kinase 3-like isofor...    141   6e-35   
ref|XP_010234898.1|  PREDICTED: CDPK-related kinase 3-like isofor...    138   1e-34   
ref|XP_010666161.1|  PREDICTED: CDPK-related kinase 3-like isofor...    139   1e-34   
gb|KJB23989.1|  hypothetical protein B456_004G123900                    140   2e-34   
ref|XP_008664763.1|  PREDICTED: CDPK-related kinase 3-like              140   2e-34   



>ref|XP_008361395.1| PREDICTED: CDPK-related protein kinase-like [Malus domestica]
Length=175

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKE+RI DFLASLNALQYRRMDFEEFCAAALSVHQLEA+DRWEQH
Sbjct  47   LENIKTALMKNATDAMKEARIADFLASLNALQYRRMDFEEFCAAALSVHQLEAVDRWEQH  106

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  107  ARCAYEIFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  166

Query  394  SSRTAAKVQ  368
            SSR   K Q
Sbjct  167  SSRAVPKAQ  175



>ref|XP_009628482.1| PREDICTED: CDPK-related protein kinase-like [Nicotiana tomentosiformis]
Length=158

 Score =   242 bits (617),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  757  KLENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ  578
            KLENI++ALMKY TDAMKESRI DFLASLNALQYR+MDFEEFCAAA SVHQLEAL+RWEQ
Sbjct  29   KLENIRSALMKYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAASSVHQLEALERWEQ  88

Query  577  HARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  398
            HARCAYE+FEKDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG
Sbjct  89   HARCAYEVFEKDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG  148

Query  397  VSSRTAAKVQ  368
             S+R  AK Q
Sbjct  149  PSTRGLAKAQ  158



>emb|CBI29399.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+ ALMK +TDAMKESR+HD LASLNALQYRRMDFEEFCAA LSVHQLEALDRWEQH
Sbjct  193  LENIRAALMKNATDAMKESRVHDLLASLNALQYRRMDFEEFCAATLSVHQLEALDRWEQH  252

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGFAKLLHGV
Sbjct  253  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFAKLLHGV  312

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  313  SSRALAKAQ  321



>ref|XP_002522315.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF39999.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=467

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMKESRI DFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  339  LENIKSALMKNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  398

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAI+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  399  ARCAYELFEKDGNRAIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  458

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  459  SSRTLAKTQ  467



>ref|XP_004233433.1| PREDICTED: CDPK-related kinase 5-like [Solanum lycopersicum]
Length=591

 Score =   248 bits (633),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NIK ALMKY+TDAMKE+RIHDF+ASLNALQYRRMDFEEFCAAALSV+QLEALD+WEQH
Sbjct  463  LDNIKAALMKYATDAMKEARIHDFVASLNALQYRRMDFEEFCAAALSVYQLEALDQWEQH  522

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEKDGNRAIVIEELASELGLGPSVP+HAVL DWIRHTDGKLSFLGFAKLLHGV
Sbjct  523  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPVHAVLLDWIRHTDGKLSFLGFAKLLHGV  582

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  583  SSRSITKVQ  591



>ref|XP_002281956.2| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
 emb|CBI32452.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+TALMK +TDAMKESRI DFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  456  LENIRTALMKNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  515

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  516  ARCAYELFDKDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  575

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  576  SSRALAKAQ  584



>emb|CAN82235.1| hypothetical protein VITISV_007568 [Vitis vinifera]
Length=584

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+TALMK +TDAMKESRI DFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  456  LENIRTALMKNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  515

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  516  ARCAYELFDKDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  575

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  576  SSRALAKAQ  584



>ref|XP_006360222.1| PREDICTED: CDPK-related protein kinase-like [Solanum tuberosum]
Length=590

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NIK ALMKY+TDAMKE+RIHDF+ASLNALQYRRMDFEEFCAAALSV+QLEALD+WEQH
Sbjct  462  LDNIKAALMKYATDAMKEARIHDFIASLNALQYRRMDFEEFCAAALSVYQLEALDQWEQH  521

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEKDGNRAIVIEELASELGLGPSVP+HAVL DWIRHTDGKLSFLGFAKLLHGV
Sbjct  522  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPVHAVLLDWIRHTDGKLSFLGFAKLLHGV  581

Query  394  SSRTAAKVQ  368
            SSR+  K+Q
Sbjct  582  SSRSITKIQ  590



>ref|XP_002262855.3| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
Length=602

 Score =   248 bits (632),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+ ALMK +TDAMKESR+HD LASLNALQYRRMDFEEFCAA LSVHQLEALDRWEQH
Sbjct  474  LENIRAALMKNATDAMKESRVHDLLASLNALQYRRMDFEEFCAATLSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGFAKLLHGV
Sbjct  534  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFAKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  594  SSRALAKAQ  602



>ref|XP_003520170.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+  ALMKY+TDAMKESRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  470  LENVNKALMKYATDAMKESRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  530  ARCAYELFDKDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGV  589

Query  394  SSRTAAKVQ  368
            SSR+ AKVQ
Sbjct  590  SSRSLAKVQ  598



>emb|CAN74933.1| hypothetical protein VITISV_044433 [Vitis vinifera]
Length=606

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+ ALMK +TDAMKESR+HD LASLNALQYRRMDFEEFCAA LSVHQLEALDRWEQH
Sbjct  478  LENIRAALMKNATDAMKESRVHDLLASLNALQYRRMDFEEFCAATLSVHQLEALDRWEQH  537

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGFAKLLHGV
Sbjct  538  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFAKLLHGV  597

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  598  SSRALAKAQ  606



>ref|XP_007156536.1| hypothetical protein PHAVU_003G294300g [Phaseolus vulgaris]
 gb|ESW28530.1| hypothetical protein PHAVU_003G294300g [Phaseolus vulgaris]
Length=599

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+  ALMKY+TDAMKESRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  471  LENVNKALMKYATDAMKESRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  530

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  531  ARCAYELFDKDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGV  590

Query  394  SSRTAAKVQ  368
            SSR+ AKVQ
Sbjct  591  SSRSLAKVQ  599



>ref|XP_008338287.1| PREDICTED: CDPK-related kinase 5 [Malus domestica]
Length=602

 Score =   247 bits (631),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKE+RI DFLASLNALQYRRMDFEEFCAAALSVHQLEA+DRWEQH
Sbjct  474  LENIKTALMKNATDAMKEARIADFLASLNALQYRRMDFEEFCAAALSVHQLEAVDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  534  ARCAYEIFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR   K Q
Sbjct  594  SSRAVPKAQ  602



>ref|XP_006346445.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=588

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  757  KLENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ  578
            KLENI++ALMKY TDAMKESRI DFLASLNALQYR+MDFEEFCAAALSVHQLEAL+RWEQ
Sbjct  459  KLENIRSALMKYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAALSVHQLEALERWEQ  518

Query  577  HARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  398
            HARCAYEIF+KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLLHG
Sbjct  519  HARCAYEIFDKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLHG  578

Query  397  VSSRTAAKVQ  368
             S+R  AKVQ
Sbjct  579  PSTRGLAKVQ  588



>ref|XP_003528501.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+  ALMKY+TDAMKESRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  470  LENVNKALMKYATDAMKESRILDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  530  ARCAYELFDKDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGV  589

Query  394  SSRTAAKVQ  368
            SSR+ AKVQ
Sbjct  590  SSRSLAKVQ  598



>ref|XP_007204593.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
 gb|EMJ05792.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
Length=602

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKE+RI DFLASLNALQYRRMDFEEFC A+LSVHQLEALDRWEQH
Sbjct  474  LENIKTALMKNATDAMKEARIADFLASLNALQYRRMDFEEFCTASLSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  534  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSRT  K Q
Sbjct  594  SSRTVPKAQ  602



>gb|AAL30820.1|AF435452_1 calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana 
tabacum]
Length=602

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
              NIKTALMK++TDAMKE+R+HDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  474  FNNIKTALMKHATDAMKEARMHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGV
Sbjct  534  ARCAYEIFEKEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  594  SSRSITKVQ  602



>ref|XP_009611550.1| PREDICTED: CDPK-related kinase 5 [Nicotiana tomentosiformis]
Length=602

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             +N+KTALMK++TDAMKE+R+HDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  474  FDNVKTALMKHATDAMKEARMHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGV
Sbjct  534  ARCAYEIFEKEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  594  SSRSITKVQ  602



>ref|XP_009758726.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009758727.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nicotiana sylvestris]
Length=602

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
              NIKTALMK++TDAMKE+R+HDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  474  FNNIKTALMKHATDAMKEARMHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGV
Sbjct  534  ARCAYEIFEKEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  594  SSRSITKVQ  602



>ref|XP_008241522.1| PREDICTED: CDPK-related kinase 5 [Prunus mume]
Length=602

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKE+RI DFLASLNALQYRRMDFEEFC A+LSVHQLEALDRWEQH
Sbjct  474  LENIKTALMKNATDAMKEARIADFLASLNALQYRRMDFEEFCTASLSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  534  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSRT  K Q
Sbjct  594  SSRTVPKAQ  602



>ref|XP_006338215.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=610

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             +N+KTALMK++TDAMKE+RIHDFLASLNALQYRRMDFEEFCAAALSVHQLEA DRWEQH
Sbjct  482  FDNVKTALMKHATDAMKEARIHDFLASLNALQYRRMDFEEFCAAALSVHQLEAFDRWEQH  541

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGV
Sbjct  542  ARCAYEIFEKEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGV  601

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  602  SSRSITKVQ  610



>ref|XP_009801386.1| PREDICTED: CDPK-related kinase 5-like [Nicotiana sylvestris]
Length=590

 Score =   245 bits (626),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  757  KLENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ  578
            KLENI++ALMKY TDAMKESRI DFLASLNALQYR+MDFEEFCAAA SVHQLEAL+RWEQ
Sbjct  461  KLENIRSALMKYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAASSVHQLEALERWEQ  520

Query  577  HARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  398
            HARCAYEIFEKDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG
Sbjct  521  HARCAYEIFEKDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG  580

Query  397  VSSRTAAKVQ  368
             S+R  AK Q
Sbjct  581  PSTRGLAKAQ  590



>ref|XP_004230803.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=588

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  757  KLENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ  578
            KLENI++ALMKY TDAMKESRI DFLASLNALQYR+MDFEEFCAAALSVHQLEAL+RWEQ
Sbjct  459  KLENIRSALMKYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAALSVHQLEALERWEQ  518

Query  577  HARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  398
            HARCAYEIF+KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLLHG
Sbjct  519  HARCAYEIFDKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLHG  578

Query  397  VSSRTAAKVQ  368
             S+R  AK Q
Sbjct  579  PSTRGLAKAQ  588



>gb|KDO79300.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=611

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+K+ALMK +TDAMK+SRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  483  LENVKSALMKNATDAMKDSRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  542

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGP+VP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  543  ARCAYELFEKDGNRAIVIEELASELGLGPAVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  602

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  603  SSRALAKAQ  611



>ref|XP_006425849.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 ref|XP_006466639.1| PREDICTED: CDPK-related kinase 5-like [Citrus sinensis]
 gb|ESR39089.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=611

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+K+ALMK +TDAMK+SRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  483  LENVKSALMKNATDAMKDSRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  542

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGP+VP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  543  ARCAYELFEKDGNRAIVIEELASELGLGPAVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  602

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  603  SSRALAKAQ  611



>ref|XP_004288057.1| PREDICTED: CDPK-related kinase 5 [Fragaria vesca subsp. vesca]
Length=614

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKE+RI DFLASLNALQYRRMDFEEFC A LSVHQLEALDRWEQH
Sbjct  486  LENIKTALMKNATDAMKEARIADFLASLNALQYRRMDFEEFCTATLSVHQLEALDRWEQH  545

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+K+GNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  546  ARCAYELFDKEGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  605

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  606  SSRVVAKAQ  614



>ref|XP_010268657.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nelumbo nucifera]
Length=601

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKESRIHDFL SL ALQYRRMDFEEFCAAALSV+QLEALD+WEQH
Sbjct  473  LENIKTALMKNATDAMKESRIHDFLGSLLALQYRRMDFEEFCAAALSVYQLEALDQWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  533  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  592

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  593  SSRTLAKAQ  601



>gb|EYU39406.1| hypothetical protein MIMGU_mgv1a0043831mg, partial [Erythranthe 
guttata]
Length=159

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NIKTAL KY+TDAM ESRI DF+ASLNALQYRRMDFEEFCAAA SV+QLEALDRWEQH
Sbjct  31   LDNIKTALKKYATDAMNESRIFDFIASLNALQYRRMDFEEFCAAASSVYQLEALDRWEQH  90

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+K+GNR I+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG+
Sbjct  91   ARCAYELFDKEGNRTIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGI  150

Query  394  SSRTAAK  374
            SSR  AK
Sbjct  151  SSRALAK  157



>gb|KDP31899.1| hypothetical protein JCGZ_12360 [Jatropha curcas]
Length=630

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMKESRI DFLASLNALQYRRMDFEEFCAAA SV+QLEALDRWEQH
Sbjct  502  LENIKVALMKNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAATSVYQLEALDRWEQH  561

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAI+IEELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  562  ARCAYELFEKDGNRAIMIEELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  621

Query  394  SSRTAAKVQ  368
            SSRT  K Q
Sbjct  622  SSRTIVKAQ  630



>ref|XP_007047191.1| CDPK-related kinase [Theobroma cacao]
 gb|EOX91348.1| CDPK-related kinase [Theobroma cacao]
Length=630

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+K ALMK +TDAMKESRI +FLASLNALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  502  LENVKAALMKNATDAMKESRIPEFLASLNALQYRRMDFDEFCAAALSVHQLEALDRWEQH  561

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEEL SELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  562  ARCAYELFEKDGNRAIVIEELPSELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  621

Query  394  SSRTAAK  374
            SSRT AK
Sbjct  622  SSRTLAK  628



>ref|XP_004232048.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=607

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             +++KT LMK++TDAMKE+RIHDFLASLNALQYRRMDFEEFCAAALSVHQLEA DRWEQH
Sbjct  479  FDHVKTVLMKHATDAMKEARIHDFLASLNALQYRRMDFEEFCAAALSVHQLEAFDRWEQH  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGV
Sbjct  539  ARCAYEIFEKEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGV  598

Query  394  SSRTAAKVQ  368
            SSR+ AKVQ
Sbjct  599  SSRSIAKVQ  607



>ref|XP_010268715.1| PREDICTED: CDPK-related kinase 5 [Nelumbo nucifera]
Length=609

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMKESR HDFL SL ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  481  LENIKAALMKNATDAMKESRAHDFLGSLLALQYRRMDFEEFCAAALSVHQLEALDRWEQH  540

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  541  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  600

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  601  SSRTFAKTQ  609



>emb|CDP02477.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK +T+AMKESRIHDFL SLNALQYRRMDFEEFCAA LSVHQLEALDRWEQH
Sbjct  474  LENIKAVLMKNATEAMKESRIHDFLGSLNALQYRRMDFEEFCAAVLSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAI+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  534  ARCAYELFEKDGNRAIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  594  SSRSLPKVQ  602



>ref|XP_011039202.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=606

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKT LMK STDAMKESRI DFLASLNALQYRR+DFEE  AAALSVHQLEALDRWEQH
Sbjct  478  LENIKTTLMKNSTDAMKESRIPDFLASLNALQYRRLDFEECSAAALSVHQLEALDRWEQH  537

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  538  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGA  597

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  598  SSRTLAKPQ  606



>ref|XP_004505191.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Cicer arietinum]
Length=597

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+  AL KY+TDAMKESRI DFL+SL++LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  468  LENVNKALKKYATDAMKESRITDFLSSLSSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  527

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGFAKLLHGV
Sbjct  528  ARCAYELFEKDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFAKLLHGV  587

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  588  SSRSLTKVQ  596



>ref|XP_002310736.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
 gb|EEE91186.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
Length=606

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKT LMK STDAMKESRI DFLASLNALQYRRM+FEEF AAALSVHQLEALDRWEQH
Sbjct  478  LENIKTTLMKNSTDAMKESRIPDFLASLNALQYRRMNFEEFSAAALSVHQLEALDRWEQH  537

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK GNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  538  ARCAYELFEKAGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGA  597

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  598  SSRTLAKPQ  606



>ref|XP_004505190.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Cicer arietinum]
Length=629

 Score =   243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+  AL KY+TDAMKESRI DFL+SL++LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  500  LENVNKALKKYATDAMKESRITDFLSSLSSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  559

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGFAKLLHGV
Sbjct  560  ARCAYELFEKDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFAKLLHGV  619

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  620  SSRSLTKVQ  628



>ref|XP_008236646.1| PREDICTED: CDPK-related kinase 5-like [Prunus mume]
Length=596

 Score =   241 bits (615),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ ALMK +TDAMKESRI D +ASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  469  LDNIRMALMKNATDAMKESRIPDLIASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  529  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  589  SSRTFVK  595



>ref|XP_007199766.1| hypothetical protein PRUPE_ppa003176mg [Prunus persica]
 gb|EMJ00965.1| hypothetical protein PRUPE_ppa003176mg [Prunus persica]
Length=596

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ ALMK +TDAMKESRI D +ASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  469  LDNIRMALMKNATDAMKESRIPDLIASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  529  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  589  SSRTFVK  595



>gb|KJB43647.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=591

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALM+ +TDAMKESRI +FLASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  463  LENIKVALMRNATDAMKESRIPEFLASLSALQYRRMDFDEFCAAALSVHQLEALDRWEQH  522

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  523  ARCAYELFEKDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGV  582

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  583  SSRTFAKAQ  591



>ref|XP_003608023.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
 gb|AES90220.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=592

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI  AL K++TDAMKESRI DFL+SL++LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  463  LENINKALKKHATDAMKESRITDFLSSLSSLQYRRMDFEEFCAAALSVHQLEALDRWEQH  522

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  523  ARCAYELFEKDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGV  582

Query  394  SSRTAAKVQ  368
            SSR+  KVQ
Sbjct  583  SSRSLPKVQ  591



>ref|XP_010107975.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXC17375.1| CDPK-related protein kinase [Morus notabilis]
Length=597

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NIK  LMK +TDAMKESRI DF+ASL+ALQYRRMDFEEFCAAAL VHQLEALDRWEQH
Sbjct  469  LDNIKMTLMKSATDAMKESRIPDFIASLSALQYRRMDFEEFCAAALGVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  529  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAKVQ  368
            SSRT  K Q
Sbjct  589  SSRTFVKAQ  597



>ref|XP_009366775.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKE+RI DFLASLNALQYRRMDFEEFCAAALSVHQLEA+DRWEQH
Sbjct  474  LENIKTALMKNATDAMKEARIADFLASLNALQYRRMDFEEFCAAALSVHQLEAVDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIFEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  534  ARWAYEIFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRTAAKVQ  368
            S+R   K Q
Sbjct  594  SNRAVPKAQ  602



>gb|KHG22049.1| CDPK-related protein kinase [Gossypium arboreum]
Length=617

 Score =   240 bits (613),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQH
Sbjct  489  LENIKAALMKNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQH  548

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  549  ARCAYEIFEKEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  608

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  609  SSRTIAKAQ  617



>gb|KJB43646.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=626

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALM+ +TDAMKESRI +FLASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  498  LENIKVALMRNATDAMKESRIPEFLASLSALQYRRMDFDEFCAAALSVHQLEALDRWEQH  557

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  558  ARCAYELFEKDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGV  617

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  618  SSRTFAKAQ  626



>gb|KHF98882.1| CDPK-related protein kinase [Gossypium arboreum]
Length=626

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALM+ +TDAMKESRI +FLASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  498  LENIKVALMRNATDAMKESRIPEFLASLSALQYRRMDFDEFCAAALSVHQLEALDRWEQH  557

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  558  ARCAYELFEKDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGV  617

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  618  SSRTFAKAQ  626



>ref|XP_004290295.1| PREDICTED: CDPK-related kinase 5-like [Fragaria vesca subsp. 
vesca]
Length=600

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ ALMK +TDAMKESRI D +ASLNALQYRRMDFEEFCAAALSVHQLEALD+WEQH
Sbjct  473  LDNIRMALMKNATDAMKESRIPDLIASLNALQYRRMDFEEFCAAALSVHQLEALDQWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  533  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  592

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  593  SSRTFVK  599



>ref|XP_009366804.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKT LMK +TDAMKE+RI DFLASLNALQYRRMDFEEFC AALSVHQLEA+DRWEQH
Sbjct  474  LENIKTTLMKNATDAMKEARIADFLASLNALQYRRMDFEEFCTAALSVHQLEAVDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIFEKDGNRAI+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  534  ARSAYEIFEKDGNRAIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRTAAKVQ  368
            SSR   K Q
Sbjct  594  SSRAVPKAQ  602



>gb|AAZ83348.1| CDPK-related protein kinase [Gossypium hirsutum]
Length=617

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQH
Sbjct  489  LENIKAVLMKNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQH  548

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  549  ARCAYEIFEKEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  608

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  609  SSRTIAKAQ  617



>ref|XP_011099193.1| PREDICTED: CDPK-related protein kinase isoform X2 [Sesamum indicum]
Length=419

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K AL K +TDAM ESR++DFLASLNALQYRRMDFEEFCAAALSV+QLEAL+RWEQH
Sbjct  291  LDNVKAALKKNATDAMNESRVYDFLASLNALQYRRMDFEEFCAAALSVYQLEALERWEQH  350

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR I+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  351  ARCAYELFEKDGNRTIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  410

Query  394  SSRTAAKV  371
            SSR+ AKV
Sbjct  411  SSRSLAKV  418



>ref|XP_006579812.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Glycine max]
Length=415

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKESRI DFLASLNALQYRRM F+EFCAAALSVHQLEAL RWEQH
Sbjct  288  LENIKTALMKNATDAMKESRIPDFLASLNALQYRRMAFDEFCAAALSVHQLEALGRWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  348  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  406

Query  394  SSRTAAK  374
             SR+ AK
Sbjct  407  PSRSLAK  413



>ref|XP_002306462.1| CROOKED family protein [Populus trichocarpa]
 gb|EEE93458.1| CROOKED family protein [Populus trichocarpa]
Length=607

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK  TDAMK+S I DF+ASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ 
Sbjct  479  LENIKAALMKNGTDAMKDSHIPDFIASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQR  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGF KLL G 
Sbjct  539  ARCAYELFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFVKLLRGA  598

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  599  SSRILAKAQ  607



>sp|P53681.1|CRK_DAUCA RecName: Full=CDPK-related protein kinase; AltName: Full=PK421 
[Daucus carota]
 emb|CAA58750.1| CDPK-related protein kinase [Daucus carota]
Length=602

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALM+ STDAMK+SR+ D L SLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  474  LENIKQALMRNSTDAMKDSRVLDLLVSLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAY++FEKDGNRAI+IEELASELGLGPS+P+HAVLHDWIRHTDGKLSFLG+ KLLHGV
Sbjct  534  ARCAYDLFEKDGNRAIMIEELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGYVKLLHGV  593

Query  394  SSRTAAKVQ  368
            S+R  AK Q
Sbjct  594  STRAIAKAQ  602



>ref|XP_007042370.1| CDPK-related kinase [Theobroma cacao]
 gb|EOX98201.1| CDPK-related kinase [Theobroma cacao]
Length=583

 Score =   237 bits (604),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKES I DFL SLN LQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  455  LENIKTALMKNATDAMKESHIPDFLFSLNTLQYRRMDFEEFCAAALSVHQLEALDRWEQH  514

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G 
Sbjct  515  ARCAYELFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGP  574

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  575  SSRALAKAQ  583



>gb|EYU44373.1| hypothetical protein MIMGU_mgv1a003006mg [Erythranthe guttata]
Length=616

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NIK AL K +TDAM ESRI+DFLASLNALQYRRMDFEEFC A LSV+QLEALDRWEQH
Sbjct  488  LDNIKAALKKNATDAMNESRIYDFLASLNALQYRRMDFEEFCGATLSVYQLEALDRWEQH  547

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR I+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  548  ARCAYELFEKDGNRTIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  607

Query  394  SSRTAAKV  371
            SSR+ AKV
Sbjct  608  SSRSLAKV  615



>dbj|BAF00328.1| calcium/calmodulin-dependent protein kinase CaMK1 [Arabidopsis 
thaliana]
Length=345

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  218  LENIKSALMKMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  277

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  278  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  337

Query  394  SSRT  383
            SSRT
Sbjct  338  SSRT  341



>ref|XP_010268648.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nelumbo nucifera]
Length=611

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 122/139 (88%), Gaps = 10/139 (7%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKESRIHDFL SL ALQYRRMDFEEFCAAALSV+QLEALD+WEQH
Sbjct  473  LENIKTALMKNATDAMKESRIHDFLGSLLALQYRRMDFEEFCAAALSVYQLEALDQWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELAS----------ELGLGPSVPLHAVLHDWIRHTDGKLSF  425
            ARCAYE+FEKDGNRAIVIEELAS          ELGL PSVP+HAVLHDWIRHTDGKLSF
Sbjct  533  ARCAYELFEKDGNRAIVIEELASKISIAIQVHLELGLSPSVPVHAVLHDWIRHTDGKLSF  592

Query  424  LGFAKLLHGVSSRTAAKVQ  368
            LGF KLLHGVSSRT AK Q
Sbjct  593  LGFVKLLHGVSSRTLAKAQ  611



>ref|XP_010503722.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=606

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  479  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  539  ARCAYELFEKDGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  598

Query  394  SSRT  383
            SSRT
Sbjct  599  SSRT  602



>gb|KJB32432.1| hypothetical protein B456_005G240400 [Gossypium raimondii]
Length=416

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKES + DFL SLNALQYRRMDFEEFCAAALSVHQLEA D WEQH
Sbjct  288  LENIKTALMKNATDAMKESHMLDFLLSLNALQYRRMDFEEFCAAALSVHQLEAFDHWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF K+L G 
Sbjct  348  ARCAYELFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKVLRGP  407

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  408  SSRAVAKAQ  416



>gb|KHN47935.1| CDPK-related protein kinase [Glycine soja]
Length=579

 Score =   234 bits (597),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKESRI DFLASLNALQYRRM F+EFCAAALSVHQLEAL RWEQH
Sbjct  452  LENIKTALMKNATDAMKESRIPDFLASLNALQYRRMAFDEFCAAALSVHQLEALGRWEQH  511

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  512  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  570

Query  394  SSRTAAK  374
             SR+ AK
Sbjct  571  PSRSLAK  577



>ref|XP_003525704.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Glycine max]
Length=578

 Score =   234 bits (597),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKESRI DFLASLNALQYRRM F+EFCAAALSVHQLEAL RWEQH
Sbjct  451  LENIKTALMKNATDAMKESRIPDFLASLNALQYRRMAFDEFCAAALSVHQLEALGRWEQH  510

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  511  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  569

Query  394  SSRTAAK  374
             SR+ AK
Sbjct  570  PSRSLAK  576



>gb|KCW63820.1| hypothetical protein EUGRSUZ_G014962, partial [Eucalyptus grandis]
Length=416

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+K AL K +TDAMKESRI DFLASL+ALQYRRMDFEEFCAAALSVHQLEALD WEQH
Sbjct  288  LENMKLALTKNATDAMKESRIPDFLASLSALQYRRMDFEEFCAAALSVHQLEALDNWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEKDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG+
Sbjct  348  ARSAYEHFEKDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGM  407

Query  394  SSRTAAKVQ  368
            SSRTA K Q
Sbjct  408  SSRTAIKTQ  416



>ref|XP_011099192.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Sesamum indicum]
Length=611

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K AL K +TDAM ESR++DFLASLNALQYRRMDFEEFCAAALSV+QLEAL+RWEQH
Sbjct  483  LDNVKAALKKNATDAMNESRVYDFLASLNALQYRRMDFEEFCAAALSVYQLEALERWEQH  542

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR I+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  543  ARCAYELFEKDGNRTIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  602

Query  394  SSRTAAKV  371
            SSR+ AKV
Sbjct  603  SSRSLAKV  610



>gb|KJB79287.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
Length=419

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQH
Sbjct  291  LENIKTALMKNATDAMKDSHVPDFLFSLNALQYRRMCFEEFCAAALSVHQLEALDRWEQH  350

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G 
Sbjct  351  ARCAYELFEKDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGP  410

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  411  SSRALAKAQ  419



>gb|KJB79285.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
 gb|KJB79286.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
Length=415

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQH
Sbjct  287  LENIKTALMKNATDAMKDSHVPDFLFSLNALQYRRMCFEEFCAAALSVHQLEALDRWEQH  346

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G 
Sbjct  347  ARCAYELFEKDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGP  406

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  407  SSRALAKAQ  415



>ref|XP_008795162.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related kinase 5-like [Phoenix 
dactylifera]
Length=609

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMKESR+ D L SL+ALQYRRMDF+EFCAA LSVHQLE LDRWEQH
Sbjct  481  LENIKMALMKKATDAMKESRVQDLLVSLSALQYRRMDFDEFCAATLSVHQLEGLDRWEQH  540

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  541  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  600

Query  394  SSRTAAKVQ  368
            SSR  AK +
Sbjct  601  SSRPLAKAR  609



>ref|XP_010926368.1| PREDICTED: CDPK-related protein kinase-like [Elaeis guineensis]
Length=356

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NIK ALMK +TDAMKES I D   SL+ALQYRRMDF+EFCAA LSVHQLE LD WEQH
Sbjct  228  LDNIKMALMKNATDAMKESCIQDLFVSLSALQYRRMDFDEFCAATLSVHQLEGLDGWEQH  287

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  288  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  347

Query  394  SSRTAAKVQ  368
            SSRT AK +
Sbjct  348  SSRTLAKAR  356



>ref|XP_010916660.1| PREDICTED: CDPK-related kinase 5 [Elaeis guineensis]
Length=609

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMKESR+ D L SL+ALQYRRMDF+EFCAA LSVHQLE LDRWEQH
Sbjct  481  LENIKMALMKNATDAMKESRVQDLLVSLSALQYRRMDFDEFCAATLSVHQLEGLDRWEQH  540

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  541  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  600

Query  394  SSRTAAKVQ  368
            SSR  AK +
Sbjct  601  SSRPLAKAR  609



>emb|CDO97150.1| unnamed protein product [Coffea canephora]
Length=597

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTAL+K STDAM++SR+ DFLASLNALQYR+MDFEEFCAAA SVHQLEALDRWEQH
Sbjct  469  LENIKTALVKNSTDAMEDSRVPDFLASLNALQYRKMDFEEFCAAASSVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIFEK+GNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  529  ARGAYEIFEKEGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGP  588

Query  394  SSRTAAKVQ  368
            S+RT +KV 
Sbjct  589  STRTHSKVP  597



>emb|CDY69753.1| BnaCnng65160D [Brassica napus]
Length=534

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  407  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  466

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  467  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  526

Query  394  SSRT  383
            SSRT
Sbjct  527  SSRT  530



>gb|AET04065.2| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=581

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK +TDAMKESRI D +ASLNALQYRRMDF+EFC AALSVHQLEALDRWEQH
Sbjct  454  LENIKAVLMKNATDAMKESRIPDLVASLNALQYRRMDFDEFCTAALSVHQLEALDRWEQH  513

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEKDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  514  ARCAYEIFEKDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  572

Query  394  SSRTAAKVQ  368
             SR+  K Q
Sbjct  573  PSRSLVKPQ  581



>ref|XP_009409499.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMKESR+ +FL SL+ALQYRRMDF+EFCAA LSVHQLE LDRWEQH
Sbjct  476  LENIKLALMKNATDAMKESRVQEFLLSLSALQYRRMDFDEFCAATLSVHQLEGLDRWEQH  535

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  536  ARCAYELFEKDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  595

Query  394  SSRT  383
            SSR+
Sbjct  596  SSRS  599



>ref|XP_006290766.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23664.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  478  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  537

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  538  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  597

Query  394  SSRT  383
            SSRT
Sbjct  598  SSRT  601



>ref|XP_010426596.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=607

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  480  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  539

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  540  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  599

Query  394  SSRT  383
            SSRT
Sbjct  600  SSRT  603



>ref|XP_010515424.1| PREDICTED: CDPK-related kinase 5 [Camelina sativa]
Length=606

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  479  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  539  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  598

Query  394  SSRT  383
            SSRT
Sbjct  599  SSRT  602



>ref|XP_009101966.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Brassica rapa]
Length=578

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  451  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  510

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  511  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  570

Query  394  SSRT  383
            SSRT
Sbjct  571  SSRT  574



>emb|CDY52824.1| BnaAnng11710D [Brassica napus]
Length=594

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  467  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  526

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  527  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  586

Query  394  SSRT  383
            SSRT
Sbjct  587  SSRT  590



>emb|CDY65016.1| BnaCnng45690D [Brassica napus]
Length=594

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  467  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  526

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  527  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  586

Query  394  SSRT  383
            SSRT
Sbjct  587  SSRT  590



>ref|XP_009115721.1| PREDICTED: CDPK-related kinase 5 [Brassica rapa]
Length=594

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  467  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  526

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  527  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  586

Query  394  SSRT  383
            SSRT
Sbjct  587  SSRT  590



>ref|XP_008392297.1| PREDICTED: CDPK-related kinase 5-like [Malus domestica]
Length=596

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+  L K +TDAMKESRI D ++SLNALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  469  LDNIRMVLTKNATDAMKESRIPDLISSLNALQYRRMDFDEFCAAALSVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  529  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAK  374
            SSR   K
Sbjct  589  SSRAFVK  595



>ref|XP_009101959.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Brassica rapa]
Length=608

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  481  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  540

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  541  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  600

Query  394  SSRT  383
            SSRT
Sbjct  601  SSRT  604



>ref|XP_009347422.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=596

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+  L K +TDAMKESRI D ++SLNALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  469  LDNIRMVLTKNATDAMKESRIPDLISSLNALQYRRMDFDEFCAAALSVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  529  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAK  374
            SSR   K
Sbjct  589  SSRAFVK  595



>ref|XP_010103697.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXB96709.1| CDPK-related protein kinase [Morus notabilis]
Length=603

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK +TDAMKES + D LAS NALQYRRMDFEEFCAA LSVHQLEALDRWEQH
Sbjct  475  LENIKAVLMKNATDAMKESHVLDILASFNALQYRRMDFEEFCAATLSVHQLEALDRWEQH  534

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNRAIVIEELASELG+GPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  535  ARCAYELFEKEGNRAIVIEELASELGVGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  594

Query  394  SSRTAAK  374
            S RT AK
Sbjct  595  SIRTLAK  601



>ref|XP_004509161.1| PREDICTED: CDPK-related protein kinase-like [Cicer arietinum]
Length=582

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALM+ +TDAMKESR+ D LASLNALQYRRMD +EFCAAALSVHQLEALDRWEQH
Sbjct  455  LENIKTALMRNATDAMKESRMPDLLASLNALQYRRMDCDEFCAAALSVHQLEALDRWEQH  514

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELA+ELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  515  ARCAYELFEKDGNRAIVIEELATELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  573

Query  394  SSRTAAKVQ  368
             SR+  K Q
Sbjct  574  PSRSLVKPQ  582



>ref|XP_006404024.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
 gb|ESQ45477.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
Length=614

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  487  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  546

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  547  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  606

Query  394  SSRT  383
            SSRT
Sbjct  607  SSRT  610



>ref|XP_006290767.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23665.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA ++ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  478  LENIKSALMKMATDAMKDSRIPEFLAQVSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  537

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  538  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  597

Query  394  SSRT  383
            SSRT
Sbjct  598  SSRT  601



>ref|XP_002876036.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52295.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  470  LENIKSALMKMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  530  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  589

Query  394  SSRT  383
            SSRT
Sbjct  590  SSRT  593



>ref|XP_003629589.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
Length=607

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 117/129 (91%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK +TDAMKESRI D +ASLNALQYRRMDF+EFC AALSVHQLEALDRWEQH
Sbjct  480  LENIKAVLMKNATDAMKESRIPDLVASLNALQYRRMDFDEFCTAALSVHQLEALDRWEQH  539

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEKDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  540  ARCAYEIFEKDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  598

Query  394  SSRTAAKVQ  368
             SR+  K Q
Sbjct  599  PSRSLVKPQ  607



>gb|KJB48534.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=575

 Score =   231 bits (589),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQH
Sbjct  454  LENIKAALMKNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQH  513

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  514  ARCAYEIFEKEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  573

Query  394  SS  389
            SS
Sbjct  574  SS  575



>gb|KJB32430.1| hypothetical protein B456_005G240400 [Gossypium raimondii]
Length=578

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKES + DFL SLNALQYRRMDFEEFCAAALSVHQLEA D WEQH
Sbjct  450  LENIKTALMKNATDAMKESHMLDFLLSLNALQYRRMDFEEFCAAALSVHQLEAFDHWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF K+L G 
Sbjct  510  ARCAYELFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKVLRGP  569

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  570  SSRAVAKAQ  578



>gb|KHG25548.1| CDPK-related protein kinase [Gossypium arboreum]
Length=578

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMKES + DFL SLNALQYRRMDFEEFCAAALSVHQLEA D WEQH
Sbjct  450  LENIKTALMKNATDAMKESHMLDFLLSLNALQYRRMDFEEFCAAALSVHQLEAFDHWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAY++FEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G 
Sbjct  510  ARCAYDLFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGP  569

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  570  SSRAVAKAQ  578



>gb|KJB79283.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
Length=583

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK +TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQH
Sbjct  455  LENIKTALMKNATDAMKDSHVPDFLFSLNALQYRRMCFEEFCAAALSVHQLEALDRWEQH  514

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G 
Sbjct  515  ARCAYELFEKDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGP  574

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  575  SSRALAKAQ  583



>ref|NP_190622.1| CDPK-related kinase [Arabidopsis thaliana]
 sp|Q9SCS2.1|CAMK5_ARATH RecName: Full=CDPK-related kinase 5; Short=AtCRK5; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 1 [Arabidopsis 
thaliana]
 emb|CAB62482.1| CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AEE78676.1| CDPK-related kinase [Arabidopsis thaliana]
Length=601

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  474  LENIKSALMKMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  534  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  593

Query  394  SSRT  383
            SSRT
Sbjct  594  SSRT  597



>ref|XP_009358061.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=596

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+  + K +TDAMKESRI D ++SLNALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  469  LDNIRMVVTKNATDAMKESRIPDLISSLNALQYRRMDFDEFCAAALSVHQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  529  ARCAYELFEKDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAK  374
            SSR   K
Sbjct  589  SSRAFVK  595



>gb|KFK34304.1| hypothetical protein AALP_AA5G127600 [Arabis alpina]
Length=598

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK++LMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  471  LENIKSSLMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  530

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  531  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  590

Query  394  SSRT  383
            SSRT
Sbjct  591  SSRT  594



>emb|CDY65651.1| BnaCnng48080D [Brassica napus]
Length=585

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  458  LENIKSALMKMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  517

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  518  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  577

Query  394  SSRT  383
            S+RT
Sbjct  578  SNRT  581



>ref|XP_010066051.1| PREDICTED: CDPK-related kinase 5 [Eucalyptus grandis]
Length=600

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN+K AL K +TDAMKESRI DFLASL+ALQYRRMDFEEFCAAALSVHQLEALD WEQH
Sbjct  472  LENMKLALTKNATDAMKESRIPDFLASLSALQYRRMDFEEFCAAALSVHQLEALDNWEQH  531

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEKDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG+
Sbjct  532  ARSAYEHFEKDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGM  591

Query  394  SSRTAAKVQ  368
            SSRTA K Q
Sbjct  592  SSRTAIKTQ  600



>gb|EPS68913.1| hypothetical protein M569_05857, partial [Genlisea aurea]
Length=293

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  757  KLENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ  578
             L++IK+AL K +TDAM ESRI DFL S++ LQYRRMDFEEFCAAALSV+QLE+LDRWEQ
Sbjct  169  NLDSIKSALKKNATDAMNESRIFDFLNSMSGLQYRRMDFEEFCAAALSVYQLESLDRWEQ  228

Query  577  HARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  398
            HARCAYEIFEK+GNR IVIEELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHG
Sbjct  229  HARCAYEIFEKEGNRTIVIEELASELGLGPSLPVHAVLHDWIRHTDGKLSFLGFVKLLHG  288

Query  397  VSSRT  383
            VSSR+
Sbjct  289  VSSRS  293



>ref|XP_011007668.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=607

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK  TDAMK+S I DF+ASLNALQYRRMDFEEFCAAALSVHQLEALD WEQ 
Sbjct  479  LENIKAALMKNGTDAMKDSHIPDFIASLNALQYRRMDFEEFCAAALSVHQLEALDLWEQR  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGF KLL G 
Sbjct  539  ARSAYELFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFVKLLRGA  598

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  599  SSRILAKAQ  607



>gb|KHG30483.1| CDPK-related protein kinase [Gossypium arboreum]
Length=583

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIKTALMK  TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQH
Sbjct  455  LENIKTALMKNVTDAMKDSHVPDFLFSLNALQYRRMGFEEFCAAALSVHQLEALDRWEQH  514

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G 
Sbjct  515  ARCAYELFEKDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGP  574

Query  394  SSRTAAKVQ  368
            SSR  AK Q
Sbjct  575  SSRALAKAQ  583



>ref|NP_001190048.1| CDPK-related kinase [Arabidopsis thaliana]
 gb|AEE78677.1| CDPK-related kinase [Arabidopsis thaliana]
Length=632

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  505  LENIKSALMKMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  564

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  565  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGV  624

Query  394  SSRT  383
            SSRT
Sbjct  625  SSRT  628



>gb|AFC88293.1| calcium-dependent protein kinase 6 [Hevea brasiliensis]
Length=594

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN + ALMK +TDAMK+S I DFL+SLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ 
Sbjct  466  LENFRKALMKNATDAMKDSHIPDFLSSLNALQYRRMDFEEFCAAALSVHQLEALDRWEQR  525

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIF+KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDG+LSF GF KLLHG+
Sbjct  526  ARSAYEIFDKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGQLSFHGFVKLLHGM  585

Query  394  SSRTAAKVQ  368
            SSRT AKVQ
Sbjct  586  SSRTVAKVQ  594



>ref|XP_002521854.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40490.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=598

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN + ALMK +TDAMK+SRI D+L SLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  470  LENFRMALMKNATDAMKDSRIPDYLTSLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++FE++GNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG+
Sbjct  530  ARTAYDLFEREGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGI  589

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  590  SSRTIAKAQ  598



>gb|KJB48530.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=610

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQH
Sbjct  489  LENIKAALMKNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQH  548

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  549  ARCAYEIFEKEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  608

Query  394  SS  389
            SS
Sbjct  609  SS  610



>ref|XP_004159890.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
Length=416

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LE IK  L K++TDAM ESR  DFLA+LN LQYR MDF+EFCAAALS+HQLEALDRWEQH
Sbjct  288  LETIKMGLAKHATDAMNESRTLDFLANLNTLQYRGMDFDEFCAAALSIHQLEALDRWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAIVIEELASELGLGP++PLH VL DWIRHTDGKLSFLGF KLLHGV
Sbjct  348  ARCAYEIFEKNGNRAIVIEELASELGLGPAIPLHVVLQDWIRHTDGKLSFLGFVKLLHGV  407

Query  394  SSRTAAKV  371
            SSR+ AKV
Sbjct  408  SSRSLAKV  415



>gb|KDP38227.1| hypothetical protein JCGZ_04870 [Jatropha curcas]
Length=595

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN++ ALMK +TDAMK+SRI DFL+SLNALQYRRMDFEEFCAA LSVHQLEALD+WEQ 
Sbjct  467  LENLRMALMKNATDAMKDSRIPDFLSSLNALQYRRMDFEEFCAAGLSVHQLEALDQWEQR  526

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            A  AYE+F+KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHGV
Sbjct  527  AISAYELFDKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGV  586

Query  394  SSRTAAKVQ  368
            SSRT AKVQ
Sbjct  587  SSRTVAKVQ  595



>gb|AAL30814.1|AF435446_1 calcium/calmodulin-dependent protein kinase CaMK1 [Arabidopsis 
thaliana]
 emb|CAA70572.1| CDPK-related protein kinase [Arabidopsis thaliana]
Length=601

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK+ALMK +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  474  LENIKSALMKMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KL HGV
Sbjct  534  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLQHGV  593

Query  394  SSRT  383
            SSRT
Sbjct  594  SSRT  597



>ref|XP_010680435.1| PREDICTED: CDPK-related kinase 5 [Beta vulgaris subsp. vulgaris]
Length=598

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMKESR H+ L SL ALQYRRMDFEEFCAAALSV+QLEAL+RW+QH
Sbjct  470  LENIKEALMKNATDAMKESRAHEILTSLTALQYRRMDFEEFCAAALSVYQLEALERWDQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNR I+IEELASELGLGP++P+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  530  ARCAYELFEKDGNRPIMIEELASELGLGPNIPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  589

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  590  SSRTLIK  596



>ref|XP_011085503.1| PREDICTED: CDPK-related protein kinase-like [Sesamum indicum]
Length=613

 Score =   229 bits (584),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI +AL K +TDAM ESRI+DFLASLNALQYRRMDFEEFCAAA SV+QLEALDRWEQH
Sbjct  485  LDNIISALKKNATDAMNESRIYDFLASLNALQYRRMDFEEFCAAASSVYQLEALDRWEQH  544

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+F+KDGNR I+IEELASELGL PS+P+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  545  ARCAYELFDKDGNRTIMIEELASELGLSPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  604

Query  394  SSRTAAK  374
            SSR+ AK
Sbjct  605  SSRSLAK  611



>ref|NP_001169792.1| uncharacterized protein LOC100383682 [Zea mays]
 gb|ACN34927.1| unknown [Zea mays]
Length=219

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  91   LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  150

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  151  ARSAYEYFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  210

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  211  SSRSLSKMR  219



>gb|KHN36210.1| CDPK-related protein kinase [Glycine soja]
Length=521

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LM  +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQLE LD+WEQ+
Sbjct  394  LENIKAVLMVNATDAMKESRIPDFLASLNALQYRRMDFDEFCAAALSVHQLETLDQWEQN  453

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAY++FEKDGN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  454  ARCAYDLFEKDGNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  512

Query  394  SSRTAAKVQ  368
             SR+ AK Q
Sbjct  513  PSRSLAKGQ  521



>ref|XP_010558347.1| PREDICTED: CDPK-related kinase 5-like [Tarenaya hassleriana]
Length=615

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQH
Sbjct  487  LENIKEALMKSATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQH  546

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+IEELASELGLGP+VP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  547  ARCAYELFEKEGNRPIMIEELASELGLGPAVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  606

Query  394  SS  389
            SS
Sbjct  607  SS  608



>ref|XP_003516596.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=585

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LM  +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQLE LD+WEQ+
Sbjct  458  LENIKAVLMVNATDAMKESRIPDFLASLNALQYRRMDFDEFCAAALSVHQLETLDQWEQN  517

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAY++FEKDGN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  518  ARCAYDLFEKDGNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  576

Query  394  SSRTAAKVQ  368
             SR+ AK Q
Sbjct  577  PSRSLAKGQ  585



>ref|XP_004136991.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_008454927.1| PREDICTED: CDPK-related kinase 5 [Cucumis melo]
 gb|KGN43947.1| hypothetical protein Csa_7G074310 [Cucumis sativus]
Length=603

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LE IK  L K++TDAM ESR  DFLA+LN LQYR MDF+EFCAAALS+HQLEALDRWEQH
Sbjct  475  LETIKMGLAKHATDAMNESRTLDFLANLNTLQYRGMDFDEFCAAALSIHQLEALDRWEQH  534

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAIVIEELASELGLGP++PLH VL DWIRHTDGKLSFLGF KLLHGV
Sbjct  535  ARCAYEIFEKNGNRAIVIEELASELGLGPAIPLHVVLQDWIRHTDGKLSFLGFVKLLHGV  594

Query  394  SSRTAAKV  371
            SSR+ AKV
Sbjct  595  SSRSLAKV  602



>gb|EPS64045.1| hypothetical protein M569_10738, partial [Genlisea aurea]
Length=124

 Score =   211 bits (536),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  745  IKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARC  566
             + AL K  T+AM ESRI +FL SLN LQYRRMDFEEFCAAA SVHQLEALDRWEQHARC
Sbjct  1    FRQALKKNGTEAMNESRIFEFLTSLNTLQYRRMDFEEFCAAASSVHQLEALDRWEQHARC  60

Query  565  AYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  386
             YE FEK+GNR I+IEELASELGLGPSVP+HAV+HDW+RHTDGKLSF GF KLLHGVSS+
Sbjct  61   GYEFFEKEGNRTIMIEELASELGLGPSVPVHAVVHDWVRHTDGKLSFHGFVKLLHGVSSK  120

Query  385  TAAK  374
            + AK
Sbjct  121  STAK  124



>ref|XP_008457867.1| PREDICTED: CDPK-related kinase 5-like [Cucumis melo]
Length=622

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            +ENIK ALMK  T+ MKESRI D L SL+ALQYRRMDFEEFCAAA+S+HQLEALDRWEQH
Sbjct  494  IENIKEALMKNITNGMKESRIPDLLTSLSALQYRRMDFEEFCAAAVSIHQLEALDRWEQH  553

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++FEKDGNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  554  ARYAYDLFEKDGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGP  613

Query  394  SSRTAAK  374
            SSRT AK
Sbjct  614  SSRTLAK  620



>ref|XP_004148051.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN62050.1| hypothetical protein Csa_2G292800 [Cucumis sativus]
Length=621

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            +ENIK ALMK  T+ MKESRI D L SL+ALQYRRMDFEEFCAAA+S+HQLEALDRWEQH
Sbjct  493  IENIKEALMKNITNGMKESRIPDLLTSLSALQYRRMDFEEFCAAAVSIHQLEALDRWEQH  552

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++FEKDGNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  553  ARYAYDLFEKDGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGP  612

Query  394  SSRTAAK  374
            SSRT AK
Sbjct  613  SSRTLAK  619



>gb|KDO49130.1| hypothetical protein CISIN_1g007776mg [Citrus sinensis]
Length=547

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             ENIKT LMK +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQH
Sbjct  419  FENIKTVLMKNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQH  478

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVI+ELASELGL PS+PLH VLHDWIRHTDGKLSF GF KLLHGV
Sbjct  479  ARSAYELFEKDGNRAIVIDELASELGLAPSIPLHVVLHDWIRHTDGKLSFHGFVKLLHGV  538

Query  394  SSRTAAK  374
             SRT  K
Sbjct  539  PSRTMGK  545



>ref|XP_004169045.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
Length=121

 Score =   210 bits (534),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  730  MKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIF  551
            MK  T+ MKESRI D L SL+ALQYRRMDFEEFCAAA+S+HQLEALDRWEQHAR AY++F
Sbjct  1    MKNITNGMKESRIPDLLTSLSALQYRRMDFEEFCAAAVSIHQLEALDRWEQHARYAYDLF  60

Query  550  EKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  374
            EKDGNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG SSRT AK
Sbjct  61   EKDGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSSRTLAK  119



>ref|XP_011005000.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=416

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN++ ALMK +T+AMK+SR+ DFLASLN LQYRRMDFEEFCAAAL+VHQLE LD+W+  
Sbjct  288  LENLRMALMKNATNAMKDSRVPDFLASLNPLQYRRMDFEEFCAAALNVHQLETLDQWKHL  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG 
Sbjct  348  ARSAYELFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGT  407

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  408  SSRTIAKAQ  416



>ref|XP_006480135.1| PREDICTED: CDPK-related kinase 5-like [Citrus sinensis]
Length=593

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             ENIKT LMK +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQH
Sbjct  465  FENIKTVLMKNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQH  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVI+ELASELGL PS+PLH VLHDWIRHTDGKLSF GF KLLHGV
Sbjct  525  ARSAYELFEKDGNRAIVIDELASELGLAPSIPLHVVLHDWIRHTDGKLSFHGFVKLLHGV  584

Query  394  SSRTAAK  374
             SRT  K
Sbjct  585  PSRTMGK  591



>ref|XP_010550381.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Tarenaya hassleriana]
Length=614

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L++IK AL+K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALS+HQLEAL+RWEQH
Sbjct  487  LDSIKAALVKNATDAMKDSRISEFLAQLSALQYRRMDFEEFCAAALSIHQLEALERWEQH  546

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  547  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  606

Query  394  SSRT  383
            SSR 
Sbjct  607  SSRV  610



>ref|XP_006657969.1| PREDICTED: CDPK-related protein kinase-like [Oryza brachyantha]
Length=416

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ + LASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQH
Sbjct  288  LDNIRMALTREATDAMKESRVQEILASLSALQYRRMDFQEFCAAALSVHQLEALDRWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY+ FEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  348  ARSAYDFFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  407

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  408  SSRSLSKMR  416



>ref|XP_006384440.1| hypothetical protein POPTR_0004s15110g [Populus trichocarpa]
 gb|ERP62237.1| hypothetical protein POPTR_0004s15110g [Populus trichocarpa]
Length=596

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN++ ALMK +T+AMK+SRI DFLASLN LQYRRMDFEEFCAAAL+VHQLE LD+W+  
Sbjct  468  LENLRMALMKNATNAMKDSRIPDFLASLNQLQYRRMDFEEFCAAALNVHQLETLDQWKHL  527

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIFEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG 
Sbjct  528  ARSAYEIFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGT  587

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  588  SSRTIAKAQ  596



>gb|KDO49131.1| hypothetical protein CISIN_1g007776mg [Citrus sinensis]
Length=590

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             ENIKT LMK +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQH
Sbjct  462  FENIKTVLMKNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQH  521

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVI+ELASELGL PS+PLH VLHDWIRHTDGKLSF GF KLLHGV
Sbjct  522  ARSAYELFEKDGNRAIVIDELASELGLAPSIPLHVVLHDWIRHTDGKLSFHGFVKLLHGV  581

Query  394  SSRTAAK  374
             SRT  K
Sbjct  582  PSRTMGK  588



>ref|XP_004511959.1| PREDICTED: CDPK-related kinase 5-like [Cicer arietinum]
Length=587

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK A M  +TDAMKESRI DFL SLNALQYRRMDF+EFCAAALSVHQLEA+D WE+ 
Sbjct  460  LENIKAAFMVNATDAMKESRIADFLGSLNALQYRRMDFDEFCAAALSVHQLEAIDHWEKR  519

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAY++FEKDGN+AIVI+ELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  520  ARCAYDLFEKDGNKAIVIDELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  578

Query  394  SSRTAAKVQ  368
             SR+ AK Q
Sbjct  579  PSRSLAKAQ  587



>ref|XP_010550380.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Tarenaya hassleriana]
Length=646

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L++IK AL+K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALS+HQLEAL+RWEQH
Sbjct  519  LDSIKAALVKNATDAMKDSRISEFLAQLSALQYRRMDFEEFCAAALSIHQLEALERWEQH  578

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEK+GNR I+I+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  579  ARCAYELFEKEGNRPIMIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  638

Query  394  SSRT  383
            SSR 
Sbjct  639  SSRV  642



>gb|EPS69494.1| hypothetical protein M569_05270 [Genlisea aurea]
Length=657

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LE IKTAL K +T+AM ESRI +FL SLNALQYRRMDFEEFCAAA SV+QLEALDRWEQH
Sbjct  469  LETIKTALKKNATEAMNESRIFEFLTSLNALQYRRMDFEEFCAAASSVYQLEALDRWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARC YE FEK+GNR I+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGF KLLHGV
Sbjct  529  ARCGYEFFEKEGNRTIMIEELASELGLSPSVPVHAVLHDWVRHTDGKLSFLGFVKLLHGV  588

Query  394  SSRTAAKVQ*HSTRPPTRLDHHHPLATSFSSELI  293
            SSR+ AK    ++R     DH   L+++ +S  +
Sbjct  589  SSRSLAKT---NSRTIYLSDHDGKLSSTTTSSCL  619



>ref|XP_011001201.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=596

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN++ ALMK +T+AMK+SR+ DFLASLN LQYRRMDFEEFCAAAL+VHQLE LD+W+  
Sbjct  468  LENLRMALMKNATNAMKDSRVPDFLASLNPLQYRRMDFEEFCAAALNVHQLETLDQWKHL  527

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG 
Sbjct  528  ARSAYELFEKDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGT  587

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  588  SSRTIAKAQ  596



>ref|XP_006423061.1| hypothetical protein CICLE_v10028073mg [Citrus clementina]
 gb|ESR36301.1| hypothetical protein CICLE_v10028073mg [Citrus clementina]
Length=590

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             ENIKT LMK +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQH
Sbjct  462  FENIKTVLMKNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQH  521

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVI+ELASELGL PS+PLH VL+DWIRHTDGKLSF GF KLLHGV
Sbjct  522  ARSAYELFEKDGNRAIVIDELASELGLAPSIPLHVVLNDWIRHTDGKLSFHGFVKLLHGV  581

Query  394  SSRTAAK  374
             SRT  K
Sbjct  582  PSRTMGK  588



>ref|XP_009389551.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK ALMK  TD MKE  + D L SL ALQYRRMDF+EFCAA LSVHQLE LDRWEQH
Sbjct  476  LENIKMALMKNVTDQMKELHVQDILVSLGALQYRRMDFDEFCAATLSVHQLEGLDRWEQH  535

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYE+FEKDGNRAIVIEELASELGL PSVP+H VL DWIRHTDGKLSFLGF KLLHGV
Sbjct  536  ARCAYELFEKDGNRAIVIEELASELGLSPSVPVHVVLRDWIRHTDGKLSFLGFVKLLHGV  595

Query  394  SSRTA  380
            SSR+A
Sbjct  596  SSRSA  600



>gb|EEC82459.1| hypothetical protein OsI_26896 [Oryza sativa Indica Group]
Length=453

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  325  LDNIRMALTREATDAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  384

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY+ FEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  385  ARSAYDFFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  444

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  445  SSRSLSKMR  453



>ref|XP_006829951.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
 gb|ERM97367.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
Length=606

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+ ALMK++TDAMKESR+H+ L S+ AL YR+MDFEEFCAAA+SVHQLE LDRWEQH
Sbjct  477  LENIRMALMKHATDAMKESRVHELLTSMTALLYRKMDFEEFCAAAISVHQLEGLDRWEQH  536

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR A+E+F+K+GNRAIVIEELASELGLGP VP+HAVLHDWIRHTDGKLSFLGF KLLHGV
Sbjct  537  ARSAFELFDKEGNRAIVIEELASELGLGPCVPVHAVLHDWIRHTDGKLSFLGFVKLLHGV  596

Query  394  SSR  386
            SSR
Sbjct  597  SSR  599



>ref|XP_006836275.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
 gb|ERM99128.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
Length=580

 Score =   218 bits (555),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N KTALMK +TDAMKESR+ DF++S+ ALQYRR+DFEEFCAAA SVHQ+E L+ WEQH
Sbjct  449  LQNFKTALMKNATDAMKESRVLDFVSSIGALQYRRLDFEEFCAAATSVHQMEGLENWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRAIVIEELASELGLGPSVP+H VLHDWIRH+DGKLSFLGF +LLHG+
Sbjct  509  ARRAYELFEKDGNRAIVIEELASELGLGPSVPVHVVLHDWIRHSDGKLSFLGFVRLLHGI  568

Query  394  SSRTAAK  374
            SSR   K
Sbjct  569  SSRYMPK  575



>tpg|DAA63630.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=416

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQH
Sbjct  288  LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  348  ARSAYEHFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  407

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  408  SSRSLSKMR  416



>ref|XP_008668447.1| PREDICTED: uncharacterized protein LOC100383682 isoform X1 [Zea 
mays]
 tpg|DAA41478.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=598

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  470  LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  530  ARSAYEYFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  589

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  590  SSRSLSKMR  598



>dbj|BAK06421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKE+R+ + L SL+ALQYRRMDF EFCAAA+SVHQLEALDRWEQH
Sbjct  464  LDNIRMALTREATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQH  523

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIFEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  524  ARSAYEIFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  583

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  584  SSRSLSKMR  592



>ref|XP_010028268.1| PREDICTED: CDPK-related kinase 5 [Eucalyptus grandis]
 gb|KCW54983.1| hypothetical protein EUGRSUZ_I00953 [Eucalyptus grandis]
Length=621

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
             EN+K ALM+ +TDAMKESR+ DFL SL+ALQYRRMDFEEFCAA LSVHQLEA+DRWEQ 
Sbjct  494  FENVKMALMRNATDAMKESRVLDFLTSLSALQYRRMDFEEFCAATLSVHQLEAVDRWEQL  553

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            ARCAYEIFEK+GNRAIVI+ELASELG+  SVP++AVLHDWIRHTDGKLSF GF KLLHG+
Sbjct  554  ARCAYEIFEKEGNRAIVIDELASELGVSSSVPVYAVLHDWIRHTDGKLSFHGFLKLLHGI  613

Query  394  SSRTAAKV  371
            SSR+ AK 
Sbjct  614  SSRSLAKT  621



>ref|NP_001060297.1| Os07g0619800 [Oryza sativa Japonica Group]
 dbj|BAF22211.1| Os07g0619800 [Oryza sativa Japonica Group]
 dbj|BAG90553.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67603.1| hypothetical protein OsJ_25154 [Oryza sativa Japonica Group]
Length=453

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +T AMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  325  LDNIRMALTREATYAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  384

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY+ FEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  385  ARSAYDFFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  444

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  445  SSRSLSKMR  453



>ref|XP_003562669.1| PREDICTED: CDPK-related kinase 5-like [Brachypodium distachyon]
Length=601

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKE+R+ + L SL+ALQYRRMDF EFCAAA+SVHQLEALDRWEQH
Sbjct  473  LDNIRMALTREATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FE+DGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  533  ARSAYELFERDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  592

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  593  SSRSLSKIR  601



>ref|XP_004958339.1| PREDICTED: CDPK-related kinase 5-like [Setaria italica]
Length=604

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  476  LDNIRMALTREATDAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  535

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  536  ARSAYEHFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  595

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  596  SSRSLSKMR  604



>ref|XP_007156824.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
 gb|ESW28818.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
Length=589

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LM  +TDAM ESR+ DFL SLNALQ+RRMDF+EFCAAALSVHQLE  D+WEQ 
Sbjct  462  LENIKAVLMVNATDAMNESRVPDFLTSLNALQFRRMDFDEFCAAALSVHQLETHDQWEQR  521

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  522  ARYAYELFEKDGNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  580

Query  394  SSRTAAKVQ  368
             SR+ AK Q
Sbjct  581  PSRSLAKAQ  589



>ref|XP_003611786.1| CDPK-related protein kinase [Medicago truncatula]
 gb|AES94744.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=587

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK A    +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQ+ ALD WE+ 
Sbjct  460  LENIKAAFSVNATDAMKESRIADFLASLNALQYRRMDFDEFCAAALSVHQVVALDHWEKR  519

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR A+++FEKDGN+AIVI+ELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHG 
Sbjct  520  ARYAFDLFEKDGNKAIVIDELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHG-  578

Query  394  SSRTAAKVQ  368
             SR+ AKVQ
Sbjct  579  PSRSVAKVQ  587



>gb|EMS58490.1| CDPK-related protein kinase [Triticum urartu]
Length=672

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKE+R+ + L SL+ALQYRRMDF EFCAAA+SVHQLEALDRWEQH
Sbjct  544  LDNIRMALTREATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQH  603

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYEIFEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  604  ARSAYEIFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  663

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  664  SSRSLSKMR  672



>ref|XP_002463191.1| hypothetical protein SORBIDRAFT_02g039460 [Sorghum bicolor]
 gb|EER99712.1| hypothetical protein SORBIDRAFT_02g039460 [Sorghum bicolor]
Length=601

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  473  LDNIRMALTREATDAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  533  ARSAYEHFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  592

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  593  SSRSLSKMR  601



>tpg|DAA63631.1| TPA: LOW QUALITY PROTEIN: putative protein kinase superfamily 
protein [Zea mays]
Length=601

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQH
Sbjct  473  LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  533  ARSAYEHFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  592

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  593  SSRSLSKMR  601



>gb|AAV64211.1| putative CDPK-related protein kinase [Zea mays]
 gb|AAV64248.1| putative CDPK-related protein kinase [Zea mays]
Length=602

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQH
Sbjct  474  LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  534  ARSAYEHFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  593

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  594  SSRSLSKMR  602



>gb|ACG29695.1| hypothetical protein [Zea mays]
Length=603

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQH
Sbjct  475  LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQH  534

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  535  ARSAYEHFEKEGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  594

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  595  SSRSLSKMR  603



>dbj|BAC79915.1| putative CDPK-related protein kinase [Oryza sativa Japonica Group]
 dbj|BAC79879.1| putative CDPK-related protein kinase [Oryza sativa Japonica Group]
Length=599

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +T AMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQH
Sbjct  471  LDNIRMALTREATYAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQH  530

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY+ FEKDGNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  531  ARSAYDFFEKDGNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  590

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  591  SSRSLSKMR  599



>ref|NP_001146922.1| LOC100280531 [Zea mays]
 gb|ACG24432.1| CDPK-related protein kinase [Zea mays]
Length=602

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+ AL + +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQH
Sbjct  474  LDNIRMALTREATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQH  533

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEK+GNRAIVI+ELASELGL PS PLH VL DWIRHTDGKLSFLGF KLLHG+
Sbjct  534  ARSAYEHFEKEGNRAIVIDELASELGLSPSAPLHVVLQDWIRHTDGKLSFLGFVKLLHGM  593

Query  394  SSRTAAKVQ  368
            SSR+ +K++
Sbjct  594  SSRSLSKMR  602



>ref|XP_008676192.1| PREDICTED: CDPK-related protein kinase-like [Zea mays]
Length=127

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  736  ALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE  557
            AL + +T+AMKESR+ D L SL+ALQYRRMD  EFCAA +SVHQLEALDRWEQHAR AYE
Sbjct  5    ALTREATNAMKESRVQDILVSLSALQYRRMDLHEFCAAVVSVHQLEALDRWEQHARSAYE  64

Query  556  IFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAA  377
             FEK+ NRAIVI+ELASELGL PSVPLH +L DWIR+TDGKLSFLGF KLLHG+SSR+ +
Sbjct  65   YFEKEVNRAIVIDELASELGLSPSVPLHVILQDWIRYTDGKLSFLGFVKLLHGMSSRSLS  124

Query  376  KVQ  368
            K++
Sbjct  125  KMR  127



>ref|XP_004142011.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_004167564.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN48509.1| hypothetical protein Csa_6G490240 [Cucumis sativus]
Length=604

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK  T+AMKESR  DFLASLNALQ+RRMDFEEFCAA LSV QLE L  WEQ 
Sbjct  477  LENIKETLMKNGTEAMKESRTIDFLASLNALQFRRMDFEEFCAATLSVRQLEDLGHWEQL  536

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEKDGNRAI+IEELASELGL PSVP+H+VL DWIRHTDGKLSFLGF KLLHG 
Sbjct  537  ARSAYEAFEKDGNRAIMIEELASELGLSPSVPVHSVLQDWIRHTDGKLSFLGFVKLLHGP  596

Query  394  SSRTA  380
            SSR  
Sbjct  597  SSRAG  601



>ref|NP_181647.1| CDPK-related kinase 1 [Arabidopsis thaliana]
 sp|O80673.1|CAMK1_ARATH RecName: Full=CDPK-related kinase 1; Short=AtCRK1; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 3; AltName: 
Full=Calmodulin-binding protein kinase 3; Short=AtCBK3; Short=CaM-binding 
protein kinase 3 [Arabidopsis thaliana]
 gb|AAD38058.1|AF153351_1 CDPK-related kinase 1 [Arabidopsis thaliana]
 gb|AAL30816.1|AF435448_1 calcium/calmodulin-dependent protein kinase CaMK3 [Arabidopsis 
thaliana]
 gb|AAD12016.1| CPDK-related protein kinase [Arabidopsis thaliana]
 gb|AEC09936.1| CDPK-related kinase 1 [Arabidopsis thaliana]
Length=576

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K STDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  449  MQNYKTAILKSSTDAMKDSRVFDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTLQK  575



>gb|EEE59106.1| hypothetical protein OsJ_10964 [Oryza sativa Japonica Group]
Length=415

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTALMK ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQH
Sbjct  288  LQNLKTALMKNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE F+K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  348  ARQAYEFFDKEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGV  407

Query  394  SSRTAAKV  371
            SSRT  K 
Sbjct  408  SSRTIPKT  415



>ref|NP_001167827.1| uncharacterized LOC100381527 [Zea mays]
 gb|ACN26229.1| unknown [Zea mays]
 tpg|DAA41583.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=415

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL K STDAMK+SR+ DF+ ++ ALQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  288  LQNLKSALAKNSTDAMKDSRVVDFVNTVCALQYRKLDFEEFAASAISVYQMEALETWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DW+RH DGKLSFLGF KLLHGV
Sbjct  348  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWVRHADGKLSFLGFIKLLHGV  407

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  408  SSRSIPK  414



>ref|XP_002313096.2| hypothetical protein POPTR_0009s10880g [Populus trichocarpa]
 gb|EEE87051.2| hypothetical protein POPTR_0009s10880g [Populus trichocarpa]
Length=591

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LEN++  LMK +T+AMK+SRI DFL+SLN  Q+ R+DFEEFCAAAL+VHQLEA D+W+Q 
Sbjct  463  LENLRMVLMKNATNAMKDSRIPDFLSSLNPFQHGRIDFEEFCAAALNVHQLEAHDQWKQL  522

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNRA+VIEELASELGLGPS+P+HA+L+DWI H DGKLSF GF KLLHG 
Sbjct  523  ARSAYELFEKDGNRALVIEELASELGLGPSIPVHAILNDWISHADGKLSFHGFVKLLHGT  582

Query  394  SSRTAAKVQ  368
            SSRT AK Q
Sbjct  583  SSRTIAKAQ  591



>ref|XP_010523217.1| PREDICTED: CDPK-related kinase 8 isoform X1 [Tarenaya hassleriana]
Length=590

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L NI+ AL   +T+AMKESRI DFLASLN LQYR MDFEEFCAAA+SVHQ E+L  WEQ 
Sbjct  462  LYNIRVALSANATEAMKESRIPDFLASLNGLQYRGMDFEEFCAAAMSVHQHESLGCWEQS  521

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYEIFEK+GNRAIVIEELASELG+GPS+P+H+VLHDWIRH+DGKLS+LGF KLLHGV
Sbjct  522  VRHAYEIFEKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHSDGKLSYLGFVKLLHGV  581

Query  394  SSRTAAKVQ  368
            S+R  AK +
Sbjct  582  SNRPLAKTR  590



>ref|XP_002879911.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56170.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K STDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA + WEQH
Sbjct  450  MQNYKTAILKSSTDAMKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEATETWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTLQK  576



>ref|XP_008440253.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Cucumis melo]
Length=604

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LMK  T+AMKESR  DFLASLNALQ+RRMDFEEFCAA LSV QLE L  WEQ 
Sbjct  477  LENIKETLMKNGTEAMKESRTIDFLASLNALQFRRMDFEEFCAATLSVRQLEDLGHWEQL  536

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEKDGNRAI+IEELASELGL PS P+H+VL DWIRHTDGKLSFLGF KLLHG 
Sbjct  537  ARSAYEAFEKDGNRAIMIEELASELGLSPSAPVHSVLQDWIRHTDGKLSFLGFVKLLHGP  596

Query  394  SSRTA  380
            SSR  
Sbjct  597  SSRAG  601



>gb|ACU18167.1| unknown [Glycine max]
Length=256

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+++ +TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  129  MQNFKTAILRSATDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQH  188

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  189  ARRAYEMFEKEGNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGV  248

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  249  SSRTFQK  255



>ref|XP_004249131.1| PREDICTED: CDPK-related kinase 1 [Solanum lycopersicum]
Length=574

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L N K A+MK STDAMK+SR+ DF+ ++++LQYR++DFEEFCAA++SVHQLE ++ WEQH
Sbjct  447  LPNFKMAVMKNSTDAMKDSRVFDFVNTVSSLQYRKLDFEEFCAASISVHQLEGMESWEQH  506

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  507  ARRGYEFFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  566

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  567  SSRTFQK  573



>emb|CDY47375.1| BnaC04g24880D [Brassica napus]
Length=574

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+MK ST+A K+SRI DF+  ++ LQY+++DFEEFCA+ALSVHQLEA+  WE+H
Sbjct  447  MQNYKTAIMKSSTEATKDSRILDFVDMISCLQYKKLDFEEFCASALSVHQLEAMGTWEKH  506

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF KLLHGV
Sbjct  507  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVKLLHGV  566

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  567  SSRTLQK  573



>emb|CDX76010.1| BnaA04g02740D [Brassica napus]
Length=570

 Score =   202 bits (514),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+MK ST+A K+SRI DF+  ++ LQY+R+DFEEFCA+ALSVHQLEA+  WE+H
Sbjct  443  MQNYKTAIMKSSTEATKDSRILDFVDMISCLQYKRLDFEEFCASALSVHQLEAMGTWEKH  502

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  503  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  562

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  563  SSRTLQK  569



>ref|XP_007028316.1| CDPK-related kinase 1 [Theobroma cacao]
 gb|EOY08818.1| CDPK-related kinase 1 [Theobroma cacao]
Length=576

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTALMK STDAMK+SR+ D++  ++ LQYR++DFEEFCAA++SVHQLE ++ WEQH
Sbjct  449  MQNYKTALMKNSTDAMKDSRVLDYVNMISTLQYRKLDFEEFCAASISVHQLEGMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHG+
Sbjct  509  ARRAYDLFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGI  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTFQK  575



>ref|XP_009133469.1| PREDICTED: CDPK-related kinase 1 [Brassica rapa]
Length=567

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+Q+EA++ WEQH
Sbjct  440  MQNYKTAILKSATDAMKDSRVIDFVHMISCLQYKKLDFEEFCASALSVYQMEAMETWEQH  499

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  500  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  559

Query  394  SSRT  383
            SSRT
Sbjct  560  SSRT  563



>ref|XP_006393243.1| hypothetical protein EUTSA_v10011327mg [Eutrema salsugineum]
 gb|ESQ30529.1| hypothetical protein EUTSA_v10011327mg [Eutrema salsugineum]
Length=608

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENI+ AL   +T+AMKESRI +FLA LN LQYR MDFEEFCAAAL+VHQ E+LD WEQ 
Sbjct  479  LENIRLALSSNATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAALNVHQHESLDCWEQS  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+F+K+GNRAIVIEELASELG+GPS+P+H+VLHDWIRHTDGKLSF GFAKLLHGV
Sbjct  539  IRHAYELFDKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFAKLLHGV  598

Query  394  SSRTAAKV  371
            S R + K 
Sbjct  599  SVRPSVKT  606



>ref|XP_006411380.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
 gb|ESQ52833.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
Length=576

 Score =   202 bits (513),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K STDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  449  MQNYKTAILKSSTDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTLQK  575



>emb|CDY35427.1| BnaA03g19330D [Brassica napus]
Length=567

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+Q+EA++ WEQH
Sbjct  440  MQNYKTAILKSATDAMKDSRVIDFVHMISCLQYKKLDFEEFCASALSVYQMEAMETWEQH  499

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  500  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  559

Query  394  SSRT  383
            SSRT
Sbjct  560  SSRT  563



>emb|CDY22505.1| BnaC03g23150D [Brassica napus]
Length=568

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+Q+EA++ WEQH
Sbjct  441  MQNYKTAILKSATDAMKDSRVIDFVHMISCLQYKKLDFEEFCASALSVYQMEAMETWEQH  500

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  501  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  560

Query  394  SSRT  383
            SSRT
Sbjct  561  SSRT  564



>ref|XP_008359596.1| PREDICTED: CDPK-related kinase 1-like [Malus domestica]
Length=182

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N K  + + STDAMK+SR+ D++  +++++YR++DFEEFCA+A+SVHQLE ++ WE+H
Sbjct  55   MQNFKMGVTRNSTDAMKDSRVLDYVNMISSIRYRKLDFEEFCASAISVHQLEGMESWEEH  114

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEE+ASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  115  ARRAYELFEKDGNRPIMIEEVASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  174

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  175  SSRSFQK  181



>gb|EEC75325.1| hypothetical protein OsI_11701 [Oryza sativa Indica Group]
Length=596

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTALMK ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQH
Sbjct  469  LQNLKTALMKNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE F+K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  529  ARQAYEFFDKEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGV  588

Query  394  SSRTAAKV  371
            SSRT  K 
Sbjct  589  SSRTIPKT  596



>ref|NP_001050179.1| Os03g0366200 [Oryza sativa Japonica Group]
 dbj|BAF12093.1| Os03g0366200 [Oryza sativa Japonica Group]
Length=597

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTALMK ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQH
Sbjct  470  LQNLKTALMKNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE F+K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  530  ARQAYEFFDKEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGV  589

Query  394  SSRTAAKV  371
            SSRT  K 
Sbjct  590  SSRTIPKT  597



>sp|Q10KY3.1|CAMK1_ORYSJ RecName: Full=Calcium/calmodulin-dependent serine/threonine-protein 
kinase 1; AltName: Full=Calcium/calmodulin-binding serine/threonine-protein 
kinase; Short=CaM-binding protein kinase; 
AltName: Full=OsCBK [Oryza sativa Japonica Group]
 gb|ABF96128.1| CDPK-related protein kinase, putative, expressed [Oryza sativa 
Japonica Group]
Length=600

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTALMK ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQH
Sbjct  473  LQNLKTALMKNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE F+K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  533  ARQAYEFFDKEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGV  592

Query  394  SSRTAAKV  371
            SSRT  K 
Sbjct  593  SSRTIPKT  600



>gb|EEE59103.1| hypothetical protein OsJ_10960 [Oryza sativa Japonica Group]
Length=574

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTAL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  447  LQNLKTALVKNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQH  506

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  507  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  566

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  567  SSRSIPK  573



>ref|XP_010517602.1| PREDICTED: CDPK-related kinase 1 isoform X3 [Camelina sativa]
Length=373

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K STDA K+SR+ DF+  ++ LQY+++DFEEFCA+A+SV+QLEA+  WEQH
Sbjct  246  MQNYKTAILKSSTDATKDSRVLDFVHMISCLQYKKLDFEEFCASAISVYQLEAMATWEQH  305

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  306  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  365

Query  394  SSRTAAK  374
            SSR   K
Sbjct  366  SSRALQK  372



>dbj|BAC16472.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
 dbj|BAD31271.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
Length=594

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTAL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  467  LQNLKTALVKNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQH  526

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  527  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  586

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  587  SSRSIPK  593



>gb|EEC82532.1| hypothetical protein OsI_27055 [Oryza sativa Indica Group]
Length=591

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTAL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  464  LQNLKTALVKNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQH  523

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  524  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  583

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  584  SSRSIPK  590



>ref|XP_007202163.1| hypothetical protein PRUPE_ppa006385mg [Prunus persica]
 gb|EMJ03362.1| hypothetical protein PRUPE_ppa006385mg [Prunus persica]
Length=414

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KT +++ STDAMK+SR+ D++  +++++YR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  287  MQNFKTGVIRNSTDAMKDSRVLDYVNMISSIRYRKLDFEEFCAAAISVHQLEGMESWEQH  346

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  347  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  406

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  407  SSRTFQK  413



>ref|XP_009618516.1| PREDICTED: CDPK-related kinase 7-like [Nicotiana tomentosiformis]
Length=577

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L N K A+MK STDAMK+SR+ DF+ ++++LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  450  LPNFKMAVMKNSTDAMKDSRVLDFVNTVSSLQYRKLDFEEFCAAAISVHQLEGMESWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRGYEFFEKEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTFQK  576



>ref|XP_007155948.1| hypothetical protein PHAVU_003G2460001g, partial [Phaseolus vulgaris]
 gb|ESW27942.1| hypothetical protein PHAVU_003G2460001g, partial [Phaseolus vulgaris]
Length=101

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 95/100 (95%), Gaps = 1/100 (1%)
 Frame = -2

Query  673  LNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKDGNRAIVIEELASELGL  494
            LNALQYRRM F+EFCAAALSVHQLEALDRWEQHARCAYE+FEKDGNRAIVIEELASELGL
Sbjct  1    LNALQYRRMAFDEFCAAALSVHQLEALDRWEQHARCAYELFEKDGNRAIVIEELASELGL  60

Query  493  GPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  374
            GPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK
Sbjct  61   GPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAK  99



>ref|XP_008668263.1| PREDICTED: uncharacterized LOC100381527 isoform X1 [Zea mays]
 tpg|DAA41584.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA41585.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
Length=592

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL K STDAMK+SR+ DF+ ++ ALQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  465  LQNLKSALAKNSTDAMKDSRVVDFVNTVCALQYRKLDFEEFAASAISVYQMEALETWEQH  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DW+RH DGKLSFLGF KLLHGV
Sbjct  525  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWVRHADGKLSFLGFIKLLHGV  584

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  585  SSRSIPK  591



>ref|XP_011079071.1| PREDICTED: CDPK-related kinase 1-like [Sesamum indicum]
Length=579

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N KTA+ K STDAMK+SR+ D++  +++LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  452  LQNFKTAMSKNSTDAMKDSRVLDYVNVVSSLQYRKLDFEEFCAAAISVHQLEGMESWEQH  511

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  512  ARHAYEFFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  571

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  572  SSRSFQK  578



>ref|XP_009761409.1| PREDICTED: CDPK-related kinase 1-like [Nicotiana sylvestris]
Length=577

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L N K A+MK +TDAMK+SR+ DF+ ++++LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  450  LSNFKMAVMKNATDAMKDSRVFDFVNTVSSLQYRKLDFEEFCAAAISVHQLEGMESWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRGYEFFEKEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTFQK  576



>ref|XP_009142724.1| PREDICTED: CDPK-related kinase 1-like [Brassica rapa]
Length=577

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDA K+SR+ DF+  ++ LQYR++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  450  MQNYKTAIVKTATDATKDSRVLDFVHMISCLQYRKLDFEEFCASALSVYQLEAMETWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRT  383
            SSRT
Sbjct  570  SSRT  573



>ref|XP_006293901.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
 gb|EOA26799.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
Length=576

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  449  MQNYKTAILKSATDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTLQK  575



>ref|XP_006362272.1| PREDICTED: CDPK-related kinase 1-like [Solanum tuberosum]
Length=574

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L N K A+MK STDAMK+SR+ DF+ ++++LQYR++DFEEFCAA++SVHQLE ++ WEQH
Sbjct  447  LPNFKMAVMKNSTDAMKDSRVFDFVNTVSSLQYRKLDFEEFCAASISVHQLEGMESWEQH  506

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  507  ARRGYEFFEKEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  566

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  567  SSRTFQK  573



>ref|XP_004958484.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Setaria italica]
Length=592

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  465  LQNLKSALVKNSTDAMKDSRVVDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQH  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  525  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  584

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  585  SSRSIPK  591



>gb|KFK36961.1| hypothetical protein AALP_AA4G195100 [Arabis alpina]
Length=579

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDA K+SR+ DF+  ++ +QY+++DFEEFCA+ALSV+QLEAL+ WEQH
Sbjct  452  MQNYKTAILKSATDATKDSRVLDFVHMISCIQYKKLDFEEFCASALSVYQLEALETWEQH  511

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  512  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  571

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  572  SSRTLQK  578



>ref|NP_001169442.1| uncharacterized LOC100383313 [Zea mays]
 gb|ACN33785.1| unknown [Zea mays]
 tpg|DAA63857.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=592

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  465  LQNLKSALVKNSTDAMKDSRVVDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQH  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  525  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  584

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  585  SSRSIPK  591



>emb|CDX79956.1| BnaA05g02000D [Brassica napus]
Length=577

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  450  MQNYKTAILKTATDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTLQK  576



>dbj|BAK00699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  468  LQNLKSALVKNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQH  527

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  528  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  587

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  588  SSRSIPK  594



>emb|CDY23873.1| BnaC04g01640D [Brassica napus]
Length=578

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K +TDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  451  MQNYKTAILKTATDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  510

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  511  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  570

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  571  SSRTLQK  577



>ref|XP_009420969.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=576

 Score =   200 bits (509),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTAL+K STD MK+S++ +F+  +++LQYR++DFEEF AAA+SVHQ+EALD WEQH
Sbjct  449  LQNLKTALLKNSTDTMKDSKVLEFVNMVSSLQYRKLDFEEFAAAAISVHQMEALDTWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLS LGF KLLHGV
Sbjct  509  ARQGYEFFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSLLGFVKLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTIPK  575



>ref|XP_003562581.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Brachypodium distachyon]
Length=596

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  469  LQNLKSALVKNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQH  528

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  529  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  588

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  589  SSRSIPK  595



>gb|KHN42064.1| CDPK-related protein kinase [Glycine soja]
Length=654

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            LENIK  LM  +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQLE LD+WEQ+
Sbjct  287  LENIKVVLMVNATDAMKESRIPDFLASLNALQYRRMDFDEFCAAALSVHQLETLDQWEQN  346

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSF  425
            ARCAY++FEKDGN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKL++
Sbjct  347  ARCAYDLFEKDGNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLTY  396



>ref|XP_011000411.1| PREDICTED: CDPK-related kinase 7-like [Populus euphratica]
Length=578

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K+STDAMK+SR+ D++  +++LQYR++DFEEF A A+SVHQLE +D WEQH
Sbjct  451  MQNFKTAVIKHSTDAMKDSRVLDYVNMISSLQYRKLDFEEFSAVAVSVHQLEGMDCWEQH  510

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  511  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  570

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  571  SSRTFQK  577



>ref|XP_002463267.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
 gb|EER99788.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
Length=593

 Score =   199 bits (507),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K+AL+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  466  LQNLKSALVKNSTDAMKDSRVVDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQH  525

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  526  ARRAYDLFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  585

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  586  SSRSIPK  592



>ref|XP_009139075.1| PREDICTED: CDPK-related kinase 7-like [Brassica rapa]
Length=575

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+MK ST+A K+SRI DF+  ++ LQY+R+DFEEFCA+A+SV+QLEA+  WEQH
Sbjct  448  MQNYKTAIMKSSTEATKDSRILDFVDMISCLQYKRLDFEEFCASAISVYQLEAMGTWEQH  507

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  508  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  567

Query  394  SSRTAAK  374
            SSR   K
Sbjct  568  SSRRLQK  574



>ref|XP_006430540.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
 gb|ESR43780.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
Length=415

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N K A+ K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  288  MQNYKMAVSKNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQH  347

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  348  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  407

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  408  SSRTFQK  414



>ref|XP_006658886.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Oryza brachyantha]
Length=504

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K  L+K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQH
Sbjct  377  LQNLKATLVKNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQH  436

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  437  ARRAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGV  496

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  497  SSRSIPK  503



>gb|AAK54157.1|AF368282_1 CaMK1 [Oryza sativa]
Length=597

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTALMK ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQH
Sbjct  470  LQNLKTALMKNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQH  529

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE F+K+GNR IVI+ELAS LGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  530  ARQAYEFFDKEGNRPIVIDELASGLGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGV  589

Query  394  SSRTAAKV  371
            SSRT  K 
Sbjct  590  SSRTIPKT  597



>ref|XP_008440252.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Cucumis melo]
Length=605

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLAS-LNALQYRRMDFEEFCAAALSVHQLEALDRWEQ  578
            LENIK  LMK  T+AMKESR  DFLAS LNALQ+RRMDFEEFCAA LSV QLE L  WEQ
Sbjct  477  LENIKETLMKNGTEAMKESRTIDFLASQLNALQFRRMDFEEFCAATLSVRQLEDLGHWEQ  536

Query  577  HARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  398
             AR AYE FEKDGNRAI+IEELASELGL PS P+H+VL DWIRHTDGKLSFLGF KLLHG
Sbjct  537  LARSAYEAFEKDGNRAIMIEELASELGLSPSAPVHSVLQDWIRHTDGKLSFLGFVKLLHG  596

Query  397  VSSRTA  380
             SSR  
Sbjct  597  PSSRAG  602



>gb|EYU20808.1| hypothetical protein MIMGU_mgv1a003516mg [Erythranthe guttata]
Length=580

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N KTA+ K STDAMKESR+ D++  +++LQYR++DFEE+CAAA+SVHQLE  + WEQH
Sbjct  453  LQNFKTAMAKISTDAMKESRVVDYVNVVSSLQYRKLDFEEYCAAAISVHQLEGSEGWEQH  512

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  513  ARNAYELFEKNGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  572

Query  394  SSRTAAK  374
            S+RT  K
Sbjct  573  SARTFQK  579



>ref|XP_010523218.1| PREDICTED: CDPK-related kinase 8 isoform X2 [Tarenaya hassleriana]
Length=589

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L NI+ AL   +T+AMKESRI DFLASLN LQYR MDFEEFCAAA+SVHQ E+L  WEQ 
Sbjct  462  LYNIR-ALSANATEAMKESRIPDFLASLNGLQYRGMDFEEFCAAAMSVHQHESLGCWEQS  520

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYEIFEK+GNRAIVIEELASELG+GPS+P+H+VLHDWIRH+DGKLS+LGF KLLHGV
Sbjct  521  VRHAYEIFEKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHSDGKLSYLGFVKLLHGV  580

Query  394  SSRTAAKVQ  368
            S+R  AK +
Sbjct  581  SNRPLAKTR  589



>ref|XP_008240668.1| PREDICTED: CDPK-related kinase 7 [Prunus mume]
Length=576

 Score =   198 bits (504),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KT +++ STDAMK+SR+ D++  +++++YR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  449  MQNFKTGVIRNSTDAMKDSRVLDYVNMISSIRYRKLDFEEFCAAAISVHQLEGMESWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTFQK  575



>ref|XP_008798377.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KT L+KYST+AMK+SR+ DF + +++LQYR++DF+EF AAA+SV+Q+E L  WEQH
Sbjct  450  LQNLKTELLKYSTEAMKDSRVLDFASMVSSLQYRKLDFDEFAAAAISVYQMEGLHNWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGV
Sbjct  510  ARHAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFVKLLHGV  569

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  570  SSRSIPK  576



>ref|XP_010525467.1| PREDICTED: CDPK-related kinase 1-like [Tarenaya hassleriana]
Length=573

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+AMK+SR+ D++  +++LQY+++DFEEFCA+ALSV+QLEA++ WE+H
Sbjct  446  MQNYKTAILKSSTEAMKDSRVLDYVNMISSLQYKKLDFEEFCASALSVYQLEAMETWEEH  505

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELA ELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  506  ARRAYELFEKDGNRPIMIEELAPELGLGPSVPVHIVLQDWIRHSDGKLSFLGFVRLLHGV  565

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  566  SSRTFQK  572



>ref|XP_010542604.1| PREDICTED: CDPK-related kinase 1 [Tarenaya hassleriana]
Length=575

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ D++  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  448  MQNYKTAVLKSSTEATKDSRVLDYVNMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  507

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  508  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  567

Query  394  SSRT  383
            SSRT
Sbjct  568  SSRT  571



>gb|KDO53615.1| hypothetical protein CISIN_1g0074582mg, partial [Citrus sinensis]
Length=444

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N K A+ K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  317  MQNYKMAVSKNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQH  376

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  377  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  436

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  437  SSRTFQK  443



>gb|KDP27484.1| hypothetical protein JCGZ_20019 [Jatropha curcas]
Length=577

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            + N KTA+++ STDA+K+SR+ D+++ +++LQYR+MDFEEFCAA++SVHQLE +D WEQH
Sbjct  450  MSNFKTAVIRNSTDAVKDSRVLDYVSMVSSLQYRKMDFEEFCAASISVHQLEGMDCWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR A+E+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAFELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSR   K
Sbjct  570  SSRAFQK  576



>ref|XP_003554117.2| PREDICTED: CDPK-related kinase 1 [Glycine max]
Length=448

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+++ +TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  321  MQNFKTAILRSATDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQH  380

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  381  ARRAYEMFEKEGNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGV  440

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  441  SSRTFQK  447



>emb|CDP06189.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N K+A+ + STDAMK+SR+ ++++ ++ LQY++MDFEEFCAAA+SVHQLE ++ WEQH
Sbjct  450  VQNFKSAVTRMSTDAMKDSRVLEYVSLVSCLQYKKMDFEEFCAAAISVHQLEGMESWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTFQK  576



>ref|XP_010673049.1| PREDICTED: CDPK-related kinase 7-like [Beta vulgaris subsp. vulgaris]
Length=578

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA ++ +TDAMK+SR  +++  ++++QYR+MDFEE+CAAA SVHQLEA+D WEQH
Sbjct  451  MQNFKTAALRIATDAMKDSRAMEYVNLVSSIQYRKMDFEEYCAAATSVHQLEAMDTWEQH  510

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  511  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  570

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  571  SSRTFQK  577



>ref|XP_010517599.1| PREDICTED: CDPK-related kinase 1 isoform X1 [Camelina sativa]
 ref|XP_010517600.1| PREDICTED: CDPK-related kinase 1 isoform X2 [Camelina sativa]
Length=571

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K STDA K+SR+ DF+  ++ LQY+++DFEEFCA+A+SV+QLEA+  WEQH
Sbjct  444  MQNYKTAILKSSTDATKDSRVLDFVHMISCLQYKKLDFEEFCASAISVYQLEAMATWEQH  503

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  504  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  563

Query  394  SSRTAAK  374
            SSR   K
Sbjct  564  SSRALQK  570



>ref|NP_191235.1| CDPK-related kinase 7 [Arabidopsis thaliana]
 sp|Q9LET1.1|CAMK7_ARATH RecName: Full=CDPK-related kinase 7; Short=AtCRK7; AltName: Full=Calcium/calmodulin-dependent 
protein kinase CRK7 [Arabidopsis 
thaliana]
 emb|CAC00739.1| calcium-dependent protein kinase-like [Arabidopsis thaliana]
 gb|AEE79562.1| CDPK-related kinase 7 [Arabidopsis thaliana]
Length=577

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  450  MQNYKTAILKSSTEATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE++EKDGNR I+IEELA+ELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELYEKDGNRVIMIEELATELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTLQK  576



>ref|XP_002522159.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40200.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=512

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            + N KTA+++ STDA K+SR+ D+++ +++LQYR++DFEEFCAA++SVHQLE +D WEQH
Sbjct  385  MSNFKTAVIRSSTDATKDSRVLDYVSMVSSLQYRKLDFEEFCAASISVHQLEGMDCWEQH  444

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL  SVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  445  ARRAYELFEKDGNRPIMIEELASELGLSTSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  504

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  505  SSRTFQK  511



>ref|XP_003624963.1| Calcium-dependent protein kinase-like protein [Medicago truncatula]
 gb|ABD33022.1| Protein kinase; Calcium-binding EF-hand [Medicago truncatula]
 gb|AES81181.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=595

 Score =   197 bits (502),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+++ +TDA K+SR+ D+   ++++QYR++DFEEFCAAA+SVHQLE +D WEQH
Sbjct  468  MQNFKTAVLRSATDASKDSRVLDYANMVSSIQYRKLDFEEFCAAAISVHQLEGMDTWEQH  527

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  528  ARRAYELFEKDGNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGV  587

Query  394  SSRT  383
            SSRT
Sbjct  588  SSRT  591



>ref|XP_009393900.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=577

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTAL + STD MK+SR+ DF   ++ALQYR++DFEEF AAA+SVHQ+E LD WEQH
Sbjct  450  LQNLKTALSRNSTDTMKDSRVLDFANVVSALQYRKLDFEEFAAAAISVHQMEVLDTWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLS LGF KLLHG 
Sbjct  510  ARNGYEFFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSLLGFIKLLHGF  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTIPK  576



>ref|XP_010508754.1| PREDICTED: CDPK-related kinase 1-like [Camelina sativa]
Length=577

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K STDA K+SR+ D++  ++ LQY+++DFEEFCA+ALSV+QLEA+  WEQH
Sbjct  450  MQNYKTAILKSSTDATKDSRVLDYVHMISCLQYKKLDFEEFCASALSVYQLEAMATWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSR   K
Sbjct  570  SSRALQK  576



>ref|XP_006402951.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
 gb|ESQ44404.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
Length=576

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  449  MQNYKTAILKSSTEATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTLQK  575



>ref|XP_004493390.1| PREDICTED: CDPK-related kinase 7-like [Cicer arietinum]
Length=593

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+++ +TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  466  MQNFKTAILRSATDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQH  525

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  526  ARRAYELFEKDGNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGV  585

Query  394  SSRT  383
            SSRT
Sbjct  586  SSRT  589



>ref|XP_006482068.1| PREDICTED: CDPK-related kinase 7-like [Citrus sinensis]
Length=576

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N K A+ K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  449  MQNYKMAVSKNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTFQK  575



>ref|XP_010909915.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Elaeis guineensis]
Length=577

 Score =   197 bits (500),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KT L+KY T+AMK+SR+ DF   +++LQY ++DFEEF AAA+SV+Q+E LD WEQH
Sbjct  450  LQNLKTELLKYMTEAMKDSRVLDFANMVSSLQYGKLDFEEFAAAAISVYQMEGLDTWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFVKLLHGV  569

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  570  SSRSIQK  576



>ref|XP_006430539.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
 gb|ESR43779.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
Length=576

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N K A+ K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  449  MQNYKMAVSKNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTFQK  575



>ref|XP_010907987.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like isoform X1 [Elaeis guineensis]
Length=577

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K AL+K STDAMK+SR+ DF++ +++LQYR++DFEEF AAA+SV+Q+E LD WE H
Sbjct  450  LQNLKMALLKNSTDAMKDSRVLDFVSMVSSLQYRKLDFEEFAAAAVSVYQMEGLDSWEHH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGV
Sbjct  510  ARSAYELFEKDGNRPIMIEELASELGLSPSVPIHVVLQDWVRHSDGKLSFLGFLKLLHGV  569

Query  394  SSRTAAK  374
            SS +  K
Sbjct  570  SSCSIPK  576



>ref|XP_002878106.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54365.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  450  MQNYKTAILKSSTEATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELA+ELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRVIMIEELATELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  570  SSRTLQK  576



>ref|XP_006651413.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Oryza brachyantha]
Length=515

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTALMK ST+AMK+SR+ DF+ +++ +QYR++DFEEF A+A+SV+Q+E L+ WEQH
Sbjct  386  LQNLKTALMKNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSASAISVYQMEGLETWEQH  445

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            A+ AY+ F+K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGV
Sbjct  446  AQQAYDFFDKEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGV  505

Query  394  SSRTAAK  374
            SSRT  +
Sbjct  506  SSRTIPQ  512



>ref|XP_009371242.1| PREDICTED: CDPK-related kinase 7-like [Pyrus x bretschneideri]
Length=577

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KT + + STDAMK+SR+ D++  +++L+YR++DFEEFCA+A+SVHQLE ++ WEQH
Sbjct  450  MQNFKTGVTRNSTDAMKDSRVLDYVNMISSLRYRKLDFEEFCASAISVHQLEGMESWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSR+  K
Sbjct  570  SSRSFQK  576



>ref|XP_010427515.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Camelina sativa]
Length=584

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  456  MQNYKTAILKSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  515

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  516  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  575

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  576  SSRTLQK  582



>ref|XP_006290768.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
 gb|EOA23666.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
Length=568

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  441  MQNYKTAILKSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  500

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  501  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  560

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  561  SSRTLQK  567



>ref|XP_008777902.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+K +L K STDAMK+SR+ DF+  +++LQYR++DFEEF AAA+SV+Q+E LD WEQH
Sbjct  450  LQNLKMSLSKNSTDAMKDSRVLDFVNMVSSLQYRKLDFEEFAAAAISVYQMEGLDSWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGV
Sbjct  510  ARSAYELFEKDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFLKLLHGV  569

Query  394  SSRTAAK  374
            SS +  K
Sbjct  570  SSCSIPK  576



>ref|NP_175381.1| CDPK-related kinase 8 [Arabidopsis thaliana]
 sp|Q9FX86.1|CAMK8_ARATH RecName: Full=CDPK-related kinase 8; Short=AtCRK8; AltName: Full=Calcium/calmodulin-dependent 
protein kinase CRK8 [Arabidopsis 
thaliana]
 gb|AAG13044.1|AC011807_3 Putative CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AAQ89619.1| At1g49580 [Arabidopsis thaliana]
 dbj|BAF01277.1| putative CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AEE32444.1| CDPK-related kinase 8 [Arabidopsis thaliana]
Length=606

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++ I+ AL   +T+AMKESRI +FLA LN LQYR MDFEEFCAAA++VHQ E+LD WEQ 
Sbjct  477  MDTIRMALASNATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAAINVHQHESLDCWEQS  536

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+F+K+GNRAIVIEELASELG+GPS+P+H+VLHDWIRHTDGKLSF GF KLLHGV
Sbjct  537  IRHAYELFDKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFVKLLHGV  596

Query  394  SSRTAAKV  371
            S R + K 
Sbjct  597  SVRASGKT  604



>ref|XP_002322616.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
 gb|EEF04377.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
Length=578

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K+STDAMK+SR+ D++  ++ LQYR++DFEEF A A+SVHQLE +D WEQH
Sbjct  451  MQNFKTAVIKHSTDAMKDSRVLDYVNMISTLQYRKLDFEEFSAVAISVHQLEGMDCWEQH  510

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGL  SVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  511  ARRAYELFEKDGNRPIMIEELASELGLSRSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  570

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  571  SSRTFQK  577



>ref|XP_010504583.1| PREDICTED: CDPK-related kinase 7-like [Camelina sativa]
Length=582

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  454  MQNYKTAILKSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMEIWEQH  513

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  514  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  573

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  574  SSRTLQK  580



>ref|XP_010516279.1| PREDICTED: CDPK-related kinase 7 [Camelina sativa]
Length=582

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+A+SV+QLEA++ WEQH
Sbjct  454  MQNYKTAILKSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASAISVYQLEAMETWEQH  513

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  514  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  573

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  574  SSRTLQK  580



>ref|XP_010427514.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Camelina sativa]
Length=611

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA++K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQH
Sbjct  483  MQNYKTAILKSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQH  542

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEKDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  543  ARRAYELFEKDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGV  602

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  603  SSRTLQK  609



>ref|XP_008464947.1| PREDICTED: CDPK-related kinase 1-like isoform X3 [Cucumis melo]
Length=447

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTAL+K STDA+K+SR+ D+   ++++QYR++DFEEFCAAA+S++QLE ++ WEQH
Sbjct  320  MQNFKTALIKNSTDAIKDSRVLDYANVVSSIQYRKLDFEEFCAAAISIYQLEGMENWEQH  379

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  380  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  439

Query  394  SSRTAAK  374
            SSR   K
Sbjct  440  SSRAFQK  446



>ref|XP_002891522.1| hypothetical protein ARALYDRAFT_474093 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67781.1| hypothetical protein ARALYDRAFT_474093 [Arabidopsis lyrata subsp. 
lyrata]
Length=608

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++ I+ AL   +T+AMKESRI +FLA LN LQYR MDFEEFCAAA++ HQ E+LD WEQ 
Sbjct  479  MDTIRLALASNATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAAINFHQHESLDCWEQS  538

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+F+K+GNRAIVIEELASELG+GPS+P+H+VLHDWIRHTDGKLSF GF KLLHGV
Sbjct  539  IRHAYELFDKNGNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFVKLLHGV  598

Query  394  SSRTAAKV  371
            S R +AK 
Sbjct  599  SVRPSAKT  606



>gb|KFK35999.1| hypothetical protein AALP_AA4G064700 [Arabis alpina]
Length=601

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            +ENI+ AL   +T+AMKESRI +FLA LN LQ++ MDFEEFCAAAL+VHQ E+LD WEQ 
Sbjct  472  MENIRLALASNATEAMKESRIPEFLALLNGLQHKGMDFEEFCAAALNVHQHESLDCWEQS  531

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+F+K+GNRAIVIEELASELG+GPS+ +H++LHDWIRHTDGKLSF GF KLLHGV
Sbjct  532  VRHAYELFDKNGNRAIVIEELASELGVGPSITVHSILHDWIRHTDGKLSFFGFVKLLHGV  591

Query  394  SSRTAAKV  371
            S+R++ K 
Sbjct  592  STRSSVKT  599



>emb|CDY18568.1| BnaA01g26270D [Brassica napus]
Length=594

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+TAL   +T+AMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ 
Sbjct  465  LDNIRTALATNATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQS  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+FE +GNR IVIEELASELG+G SVP+H +LHDWIRH+DGKLSFLGF KLLHGV
Sbjct  525  VRHAYELFEMNGNRVIVIEELASELGVGSSVPVHTILHDWIRHSDGKLSFLGFVKLLHGV  584

Query  394  SSR  386
            S+R
Sbjct  585  STR  587



>ref|XP_009112142.1| PREDICTED: CDPK-related kinase 2 [Brassica rapa]
Length=594

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+TAL   +T+AMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ 
Sbjct  465  LDNIRTALATNATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQS  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+FE +GNR IVIEELASELG+G SVP+H +LHDWIRH+DGKLSFLGF KLLHGV
Sbjct  525  VRHAYELFEMNGNRVIVIEELASELGVGSSVPVHTILHDWIRHSDGKLSFLGFVKLLHGV  584

Query  394  SSR  386
            S+R
Sbjct  585  STR  587



>gb|KJB35809.1| hypothetical protein B456_006G129900 [Gossypium raimondii]
Length=576

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KT ++K STDAMK+SR+ D++  ++++QYR++DFEEFCA+A+SVHQLE ++ WEQH
Sbjct  449  MQNFKTVMLKNSTDAMKDSRVLDYVNMISSIQYRKLDFEEFCASAVSVHQLEGMETWEQH  508

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL  SVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  509  ARRAYDLFDKDGNRPIMIEELASELGLSSSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  568

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  569  SSRTFQK  575



>ref|XP_008464946.1| PREDICTED: CDPK-related kinase 1-like isoform X2 [Cucumis melo]
Length=572

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTAL+K STDA+K+SR+ D+   ++++QYR++DFEEFCAAA+S++QLE ++ WEQH
Sbjct  445  MQNFKTALIKNSTDAIKDSRVLDYANVVSSIQYRKLDFEEFCAAAISIYQLEGMENWEQH  504

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  505  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  564

Query  394  SSRTAAK  374
            SSR   K
Sbjct  565  SSRAFQK  571



>ref|XP_009405856.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=573

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N K AL++ STDAMK+S I DF+  +++LQYR++DFEEF AAA+SVHQ+EALD WEQH
Sbjct  446  LQNFKMALLRNSTDAMKDSGILDFVNMVSSLQYRKLDFEEFAAAAISVHQMEALDAWEQH  505

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR  YE FEKDGNR I+IEELAS+LGL PSVP+H VL DWIRH+DGKLS LGF KLLHG 
Sbjct  506  ARHGYEFFEKDGNRPIMIEELASDLGLSPSVPVHVVLQDWIRHSDGKLSLLGFVKLLHGF  565

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  566  SSRTIPK  572



>emb|CDX95464.1| BnaC01g33560D [Brassica napus]
Length=592

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+NI+TAL   +T+AMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ 
Sbjct  463  LDNIRTALATNATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQS  522

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
             R AYE+FE +GNR IVIEELASELG+G S+P+H +LHDWIRH+DGKLSFLGF KLLHGV
Sbjct  523  VRHAYELFEMNGNRVIVIEELASELGVGSSIPVHTILHDWIRHSDGKLSFLGFVKLLHGV  582

Query  394  SSRTA  380
            S+R +
Sbjct  583  STRQS  587



>ref|XP_007145486.1| hypothetical protein PHAVU_007G243100g [Phaseolus vulgaris]
 gb|ESW17480.1| hypothetical protein PHAVU_007G243100g [Phaseolus vulgaris]
Length=577

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+++ STDA K+SR+ D++  ++++QYR++DFEEFCAAA+S+HQLE ++ WEQH
Sbjct  450  MQNFKTAVLRSSTDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISMHQLEGMESWEQH  509

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  510  ARRAYELFEKEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  569

Query  394  SSRTAAK  374
            SSR   K
Sbjct  570  SSRAFQK  576



>ref|XP_007163947.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
 gb|ESW35941.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
Length=580

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KT +++  TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  453  MQNFKTGILRSVTDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQH  512

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+FEK+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  513  ARRAYELFEKEGNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGV  572

Query  394  SSRTAAK  374
            SSRT  K
Sbjct  573  SSRTFQK  579



>ref|XP_008464945.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Cucumis melo]
Length=600

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTAL+K STDA+K+SR+ D+   ++++QYR++DFEEFCAAA+S++QLE ++ WEQH
Sbjct  473  MQNFKTALIKNSTDAIKDSRVLDYANVVSSIQYRKLDFEEFCAAAISIYQLEGMENWEQH  532

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AY++F+KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  533  ARHAYDLFDKDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  592

Query  394  SSRTAAK  374
            SSR   K
Sbjct  593  SSRAFQK  599



>ref|XP_003535908.1| PREDICTED: CDPK-related kinase 1-like [Glycine max]
Length=583

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            ++N KTA+++ STDA K+SR+ D+++ ++++QYR++DFEEFCAAA+SVHQLE ++ WEQH
Sbjct  456  MQNFKTAVLRSSTDASKDSRVLDYVSMVSSIQYRKLDFEEFCAAAISVHQLEGMETWEQH  515

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGV
Sbjct  516  ARHAYELFKKEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGV  575

Query  394  SSRTAAK  374
            SSR   K
Sbjct  576  SSRAFQK  582



>ref|XP_003557839.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1 isoform X2 [Brachypodium distachyon]
Length=592

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -2

Query  754  LENIKTALMKYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQH  575
            L+N+KTAL K +T  MK+SRI DF+ ++  +QYR++DFEEF A+++SV+Q+E LD WEQH
Sbjct  465  LQNLKTALTKNTTYVMKDSRIVDFVNTICNVQYRKLDFEEFSASSVSVYQMEGLDTWEQH  524

Query  574  ARCAYEIFEKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGV  395
            AR AYE+F+K+GNR IVIEELASELGLGPSVPLH VL DWIRH+DGKLSFLGF KLLHGV
Sbjct  525  ARQAYELFDKEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHSDGKLSFLGFIKLLHGV  584

Query  394  SSRTAAK  374
            S R   K
Sbjct  585  SPRAIPK  591



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100