BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF044A23

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO36651.1|  hypothetical protein CISIN_1g028965mg                   209   2e-64   Citrus sinensis [apfelsine]
gb|KDO36650.1|  hypothetical protein CISIN_1g028965mg                   209   6e-64   Citrus sinensis [apfelsine]
ref|XP_011073234.1|  PREDICTED: probable serine incorporator            206   1e-63   Sesamum indicum [beniseed]
ref|XP_009354238.1|  PREDICTED: probable serine incorporator            206   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_007215456.1|  hypothetical protein PRUPE_ppa006404mg             203   8e-63   
ref|XP_007215457.1|  hypothetical protein PRUPE_ppa006404mg             203   9e-63   Prunus persica
ref|XP_008228861.1|  PREDICTED: probable serine incorporator            203   9e-63   Prunus mume [ume]
ref|XP_006493450.1|  PREDICTED: probable serine incorporator-like       207   2e-62   Citrus sinensis [apfelsine]
gb|KHG09631.1|  Serine incorporator 3                                   204   2e-62   Gossypium arboreum [tree cotton]
ref|XP_006427689.1|  hypothetical protein CICLE_v10025720mg             207   2e-62   Citrus clementina [clementine]
ref|XP_008381162.1|  PREDICTED: probable serine incorporator            201   3e-62   
gb|KJB67006.1|  hypothetical protein B456_010G170100                    207   3e-62   Gossypium raimondii
ref|XP_008342757.1|  PREDICTED: probable serine incorporator            201   3e-62   
gb|KJB68287.1|  hypothetical protein B456_010G236500                    204   3e-62   Gossypium raimondii
gb|KJB68285.1|  hypothetical protein B456_010G236500                    204   3e-62   Gossypium raimondii
ref|XP_004158797.1|  PREDICTED: probable serine incorporator-like       204   5e-62   
ref|XP_009365247.1|  PREDICTED: probable serine incorporator            199   8e-62   Pyrus x bretschneideri [bai li]
ref|XP_007024820.1|  Serinc-domain containing serine and sphingol...    201   2e-61   
ref|XP_010318692.1|  PREDICTED: probable serine incorporator            195   5e-61   Solanum lycopersicum
ref|XP_011466994.1|  PREDICTED: serine incorporator 3                   197   2e-60   Fragaria vesca subsp. vesca
ref|XP_006341429.1|  PREDICTED: probable serine incorporator-like...    193   3e-60   Solanum tuberosum [potatoes]
gb|KJB68286.1|  hypothetical protein B456_010G236500                    197   5e-60   Gossypium raimondii
ref|XP_004135884.1|  PREDICTED: probable serine incorporator-like       194   7e-59   
gb|EYU21792.1|  hypothetical protein MIMGU_mgv1a007183mg                191   1e-58   Erythranthe guttata [common monkey flower]
ref|XP_002270610.1|  PREDICTED: probable serine incorporator            193   2e-58   Vitis vinifera
ref|XP_011082649.1|  PREDICTED: probable serine incorporator            189   3e-58   Sesamum indicum [beniseed]
ref|XP_006341430.1|  PREDICTED: probable serine incorporator-like...    186   5e-58   Solanum tuberosum [potatoes]
ref|XP_011020548.1|  PREDICTED: probable serine incorporator            190   6e-58   Populus euphratica
ref|XP_007140603.1|  hypothetical protein PHAVU_008G126100g             184   2e-57   Phaseolus vulgaris [French bean]
gb|EMS53525.1|  putative serine incorporator                            188   5e-57   Triticum urartu
gb|EMT13726.1|  Putative serine incorporator                            188   6e-57   
gb|KDP41926.1|  hypothetical protein JCGZ_26944                         187   6e-57   Jatropha curcas
gb|AFK43836.1|  unknown                                                 187   6e-57   Medicago truncatula
ref|XP_004492298.1|  PREDICTED: probable serine incorporator-like       182   7e-57   Cicer arietinum [garbanzo]
ref|XP_009399576.1|  PREDICTED: probable serine incorporator            187   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU21795.1|  hypothetical protein MIMGU_mgv1a007183mg                184   1e-56   Erythranthe guttata [common monkey flower]
gb|KEH22799.1|  serinc-domain serine and sphingolipid biosynthesi...    183   4e-56   Medicago truncatula
gb|KEH22798.1|  serinc-domain serine and sphingolipid biosynthesi...    184   5e-56   Medicago truncatula
ref|XP_009759114.1|  PREDICTED: probable serine incorporator isof...    196   5e-56   Nicotiana sylvestris
emb|CDO98258.1|  unnamed protein product                                181   5e-56   Coffea canephora [robusta coffee]
ref|XP_010687311.1|  PREDICTED: probable serine incorporator            182   6e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003570284.1|  PREDICTED: probable serine incorporator            182   9e-56   Brachypodium distachyon [annual false brome]
ref|XP_010107188.1|  putative serine incorporator                       180   1e-55   Morus notabilis
ref|XP_009615680.1|  PREDICTED: serine incorporator 3 isoform X2        194   2e-55   
gb|AFK46909.1|  unknown                                                 179   2e-55   Lotus japonicus
ref|XP_009615679.1|  PREDICTED: probable serine incorporator isof...    194   2e-55   Nicotiana tomentosiformis
gb|ABR25551.1|  serine incorporator 3                                   183   3e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001048364.1|  Os02g0792900                                       181   6e-55   
ref|XP_006649122.1|  PREDICTED: probable serine incorporator-like       181   6e-55   
gb|EAZ24909.1|  hypothetical protein OsJ_08689                          181   6e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008790112.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    182   1e-54   Phoenix dactylifera
ref|XP_008794380.1|  PREDICTED: probable serine incorporator            178   2e-54   Phoenix dactylifera
ref|XP_009383181.1|  PREDICTED: probable serine incorporator            179   4e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008461193.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    179   4e-54   Cucumis melo [Oriental melon]
gb|ABK96018.1|  unknown                                                 178   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006307669.1|  hypothetical protein CARUB_v10009295mg             175   1e-53   Capsella rubella
ref|XP_010929190.1|  PREDICTED: probable serine incorporator isof...    176   1e-53   Elaeis guineensis
ref|XP_004954190.1|  PREDICTED: probable serine incorporator-like       176   2e-53   Setaria italica
ref|XP_002454688.1|  hypothetical protein SORBIDRAFT_04g035670          177   2e-53   Sorghum bicolor [broomcorn]
ref|XP_010929191.1|  PREDICTED: probable serine incorporator isof...    175   2e-53   Elaeis guineensis
ref|XP_010914044.1|  PREDICTED: probable serine incorporator            178   2e-53   Elaeis guineensis
ref|XP_010063622.1|  PREDICTED: probable serine incorporator isof...    175   3e-53   
ref|XP_009759116.1|  PREDICTED: probable serine incorporator isof...    188   3e-53   Nicotiana sylvestris
gb|ACL54492.1|  unknown                                                 176   4e-53   Zea mays [maize]
ref|XP_010532058.1|  PREDICTED: serine incorporator 3                   177   4e-53   Tarenaya hassleriana [spider flower]
ref|NP_001130490.1|  hypothetical protein precursor                     176   5e-53   Zea mays [maize]
ref|XP_002297693.2|  TMS membrane family protein                        176   8e-53   
ref|XP_009615681.1|  PREDICTED: probable serine incorporator isof...    187   1e-52   Nicotiana tomentosiformis
ref|XP_011034606.1|  PREDICTED: probable serine incorporator            176   1e-52   Populus euphratica
ref|XP_010459155.1|  PREDICTED: probable serine incorporator            175   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010497691.1|  PREDICTED: probable serine incorporator            174   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010246591.1|  PREDICTED: serine incorporator 3-like              169   3e-52   
ref|XP_010268463.1|  PREDICTED: serine incorporator 3-like              185   6e-52   Nelumbo nucifera [Indian lotus]
ref|XP_006845424.1|  hypothetical protein AMTR_s00019p00091080          172   6e-52   Amborella trichopoda
ref|XP_003532291.1|  PREDICTED: probable serine incorporator-like       166   1e-51   Glycine max [soybeans]
ref|XP_010476724.1|  PREDICTED: serine incorporator 3                   172   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010063623.1|  PREDICTED: probable serine incorporator isof...    170   1e-51   Eucalyptus grandis [rose gum]
gb|KCW70853.1|  hypothetical protein EUGRSUZ_F03990                     170   1e-51   Eucalyptus grandis [rose gum]
ref|XP_003552131.1|  PREDICTED: probable serine incorporator-like       165   2e-51   Glycine max [soybeans]
emb|CDY52849.1|  BnaA09g56410D                                          172   2e-51   Brassica napus [oilseed rape]
ref|XP_009117776.1|  PREDICTED: serine incorporator 3 isoform X2        172   2e-51   Brassica rapa
emb|CDX81752.1|  BnaC08g38490D                                          171   4e-51   
emb|CDY70974.1|  BnaAnng35710D                                          171   5e-51   Brassica napus [oilseed rape]
ref|XP_009110458.1|  PREDICTED: serine incorporator 3-like              171   5e-51   Brassica rapa
ref|XP_002512768.1|  Membrane protein PB1A10.07c, putative              168   8e-51   
emb|CDX83957.1|  BnaC08g16880D                                          170   1e-50   
ref|NP_173069.1|  Serinc-domain containing serine and sphingolipi...    165   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890152.1|  TMS membrane family protein                        167   3e-50   
ref|XP_006416842.1|  hypothetical protein EUTSA_v10007762mg             166   2e-49   Eutrema salsugineum [saltwater cress]
gb|ABR17762.1|  unknown                                                 161   8e-49   Picea sitchensis
ref|XP_006850791.1|  hypothetical protein AMTR_s00025p00104130          152   1e-46   
ref|NP_001130812.1|  uncharacterized protein LOC100191916               153   6e-45   Zea mays [maize]
ref|XP_002466928.1|  hypothetical protein SORBIDRAFT_01g016840          152   6e-45   Sorghum bicolor [broomcorn]
ref|XP_008673654.1|  PREDICTED: uncharacterized protein LOC100191...    153   6e-45   Zea mays [maize]
ref|XP_004982576.1|  PREDICTED: probable serine incorporator-like       148   7e-45   Setaria italica
tpg|DAA49274.1|  TPA: hypothetical protein ZEAMMB73_017777              153   7e-45   
ref|NP_001050476.1|  Os03g0454100                                       151   2e-44   
gb|ABR16232.1|  unknown                                                 149   9e-44   Picea sitchensis
ref|XP_010546829.1|  PREDICTED: serine incorporator 3 isoform X1        147   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_006650244.1|  PREDICTED: probable serine incorporator-like       148   2e-43   Oryza brachyantha
ref|XP_010237604.1|  PREDICTED: probable serine incorporator            147   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_008458551.1|  PREDICTED: serine incorporator 3                   147   3e-43   Cucumis melo [Oriental melon]
dbj|BAJ86142.1|  predicted protein                                      146   8e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU43840.1|  hypothetical protein MIMGU_mgv1a006662mg                144   9e-43   Erythranthe guttata [common monkey flower]
ref|XP_008799134.1|  PREDICTED: probable serine incorporator            142   1e-42   Phoenix dactylifera
ref|XP_004169518.1|  PREDICTED: LOW QUALITY PROTEIN: serine incor...    145   1e-42   
ref|XP_004150322.1|  PREDICTED: serine incorporator 3-like              145   1e-42   Cucumis sativus [cucumbers]
ref|XP_011090806.1|  PREDICTED: probable serine incorporator            144   1e-42   Sesamum indicum [beniseed]
ref|XP_010546830.1|  PREDICTED: serine incorporator 3 isoform X2        142   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_010938752.1|  PREDICTED: probable serine incorporator            137   3e-41   Elaeis guineensis
ref|XP_009391591.1|  PREDICTED: serine incorporator 3                   138   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002280143.1|  PREDICTED: serine incorporator 3                   139   4e-41   Vitis vinifera
ref|XP_004296950.1|  PREDICTED: probable serine incorporator            141   7e-41   Fragaria vesca subsp. vesca
ref|XP_009365800.1|  PREDICTED: probable serine incorporator isof...    140   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_009365799.1|  PREDICTED: probable serine incorporator isof...    139   4e-40   Pyrus x bretschneideri [bai li]
dbj|BAK02293.1|  predicted protein                                      147   4e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009342179.1|  PREDICTED: probable serine incorporator            139   4e-40   Pyrus x bretschneideri [bai li]
emb|CDY05246.1|  BnaC05g45570D                                          137   7e-40   
ref|XP_010693925.1|  PREDICTED: serine incorporator 3                   135   9e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006419802.1|  hypothetical protein CICLE_v10005070mg             138   9e-40   Citrus clementina [clementine]
gb|ACJ84561.1|  unknown                                                 132   1e-39   Medicago truncatula
emb|CDO98987.1|  unnamed protein product                                135   1e-39   Coffea canephora [robusta coffee]
ref|XP_006356686.1|  PREDICTED: serine incorporator 3-like              134   2e-39   Solanum tuberosum [potatoes]
emb|CDY24707.1|  BnaA05g31060D                                          135   2e-39   Brassica napus [oilseed rape]
ref|XP_010486107.1|  PREDICTED: probable serine incorporator            135   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009129653.1|  PREDICTED: probable serine incorporator            134   6e-39   Brassica rapa
ref|XP_010464184.1|  PREDICTED: probable serine incorporator            135   6e-39   Camelina sativa [gold-of-pleasure]
gb|KHN37564.1|  Putative serine incorporator                            135   7e-39   Glycine soja [wild soybean]
ref|XP_010436570.1|  PREDICTED: probable serine incorporator            134   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006297798.1|  hypothetical protein CARUB_v10013833mg             133   1e-38   
gb|KDO74827.1|  hypothetical protein CISIN_1g039061mg                   134   1e-38   Citrus sinensis [apfelsine]
ref|XP_009799680.1|  PREDICTED: probable serine incorporator            131   1e-38   Nicotiana sylvestris
ref|XP_007147778.1|  hypothetical protein PHAVU_006G154400g             128   8e-38   Phaseolus vulgaris [French bean]
gb|KJB28193.1|  hypothetical protein B456_005G040500                    129   8e-38   Gossypium raimondii
ref|XP_010322266.1|  PREDICTED: serine incorporator 3                   128   9e-38   Solanum lycopersicum
ref|XP_002882452.1|  TMS membrane family protein                        130   1e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_001765634.1|  predicted protein                                  123   3e-37   
ref|NP_187268.2|  Serinc-domain containing serine and sphingolipi...    129   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAF30310.1|AC018907_10  hypothetical protein                         129   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486156.1|  PREDICTED: probable serine incorporator-like       123   3e-37   Cicer arietinum [garbanzo]
ref|XP_009117775.1|  PREDICTED: wall-associated receptor kinase-l...    149   4e-37   Brassica rapa
ref|XP_010255869.1|  PREDICTED: probable serine incorporator            125   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009623079.1|  PREDICTED: probable serine incorporator            126   5e-37   Nicotiana tomentosiformis
ref|XP_006595390.1|  PREDICTED: probable serine incorporator-like       135   5e-37   
ref|XP_008390818.1|  PREDICTED: probable serine incorporator            128   1e-36   
ref|XP_008340909.1|  PREDICTED: probable serine incorporator            129   1e-36   Malus domestica [apple tree]
emb|CAN71158.1|  hypothetical protein VITISV_036762                     124   1e-36   Vitis vinifera
ref|XP_007034589.1|  Serinc-domain containing serine and sphingol...    124   2e-36   
ref|XP_010103434.1|  putative serine incorporator                       125   2e-36   Morus notabilis
ref|XP_008223013.1|  PREDICTED: probable serine incorporator            130   2e-36   Prunus mume [ume]
ref|XP_011010290.1|  PREDICTED: probable serine incorporator            125   6e-36   Populus euphratica
ref|XP_007222705.1|  hypothetical protein PRUPE_ppa006444mg             125   1e-35   Prunus persica
gb|KDP40096.1|  hypothetical protein JCGZ_02094                         123   1e-35   Jatropha curcas
gb|AFK47365.1|  unknown                                                 120   1e-35   Lotus japonicus
ref|XP_002312742.1|  TMS membrane family protein                        124   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006407970.1|  hypothetical protein EUTSA_v10020853mg             122   4e-35   Eutrema salsugineum [saltwater cress]
gb|EPS68630.1|  hypothetical protein M569_06136                         123   4e-35   Genlisea aurea
ref|XP_006407969.1|  hypothetical protein EUTSA_v10020853mg             121   4e-35   
ref|XP_002516786.1|  Membrane protein PB1A10.07c, putative              120   9e-35   Ricinus communis
ref|XP_010024424.1|  PREDICTED: serine incorporator 3                   120   7e-34   Eucalyptus grandis [rose gum]
gb|KJB67012.1|  hypothetical protein B456_010G170100                    104   1e-31   Gossypium raimondii
ref|XP_002979274.1|  hypothetical protein SELMODRAFT_110336           94.4    1e-28   
gb|AEW08633.1|  hypothetical protein CL976Contig1_02                    112   7e-28   Pinus radiata
gb|ABF97020.1|  TMS membrane family protein, putative, expressed      95.1    2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002988580.1|  hypothetical protein SELMODRAFT_128126           85.1    9e-26   
dbj|BAD94992.1|  hypothetical protein                                   105   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ05916.1|  putative serine incorporator                          99.8    7e-25   Monoraphidium neglectum
emb|CAN80334.1|  hypothetical protein VITISV_009413                     103   8e-25   Vitis vinifera
gb|ACG35592.1|  hypothetical protein                                    102   3e-24   Zea mays [maize]
ref|XP_002956760.1|  hypothetical protein VOLCADRAFT_83749              109   3e-24   Volvox carteri f. nagariensis
ref|XP_005651318.1|  TMS membrane protein/tumor differentially hy...    108   6e-24   Coccomyxa subellipsoidea C-169
ref|XP_011397622.1|  putative serine incorporator                     93.2    9e-24   Auxenochlorella protothecoides
ref|XP_004302121.1|  PREDICTED: serine incorporator 3-like            70.9    1e-22   Fragaria vesca subsp. vesca
ref|XP_002506090.1|  predicted protein                                  100   4e-21   Micromonas commoda
ref|XP_001416509.1|  predicted protein                                  100   5e-21   Ostreococcus lucimarinus CCE9901
gb|EFA77480.1|  TMS membrane protein                                  95.5    2e-19   Heterostelium album PN500
emb|CEG01070.1|  TMS membrane protein/tumour differentially expre...  90.9    1e-17   Ostreococcus tauri
ref|XP_003075128.1|  OJ1249_F12.26 gene product (ISS)                 90.9    1e-17   
gb|EXX70672.1|  Tms1p                                                 85.9    2e-16   Rhizophagus irregularis DAOM 197198w
ref|XP_002304839.2|  hypothetical protein POPTR_0003s18530g           62.0    2e-16   
ref|XP_003062471.1|  predicted protein                                87.0    4e-16   Micromonas pusilla CCMP1545
ref|XP_001625531.1|  predicted protein                                87.0    4e-16   Nematostella vectensis
gb|KDD71727.1|  hypothetical protein H632_c4498p0                     83.6    4e-16   Helicosporidium sp. ATCC 50920
ref|XP_004366977.1|  TMS membrane protein                             85.9    7e-16   Cavenderia fasciculata
ref|XP_009493459.1|  hypothetical protein H696_01290                  81.6    7e-16   Fonticula alba
ref|XP_002157067.2|  PREDICTED: probable serine incorporator-like     85.5    1e-15   Hydra vulgaris
ref|XP_009336936.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  83.6    1e-15   
gb|ESA19644.1|  hypothetical protein GLOINDRAFT_19362                 85.1    2e-15   
ref|XP_008242601.1|  PREDICTED: probable serine incorporator          84.0    2e-15   Prunus mume [ume]
ref|XP_007202140.1|  hypothetical protein PRUPE_ppa006940mg           84.0    2e-15   
emb|CEG74958.1|  hypothetical protein RMATCC62417_10078               83.2    2e-15   Rhizopus microsporus
emb|CEG74957.1|  hypothetical protein RMATCC62417_10078               82.8    3e-15   Rhizopus microsporus
ref|NP_741561.1|  Protein Y57E12AL.1, isoform a                       84.3    3e-15   Caenorhabditis elegans [roundworm]
ref|NP_741562.1|  Protein Y57E12AL.1, isoform b                       83.6    4e-15   
ref|XP_009352478.1|  PREDICTED: probable serine incorporator          83.6    4e-15   
gb|KIH42470.1|  TMS membrane protein/tumor differentially express...  78.2    6e-15   Ancylostoma duodenale
emb|CEJ00743.1|  hypothetical protein RMCBS344292_14792               83.2    7e-15   Rhizopus microsporus
emb|CEG67769.1|  hypothetical protein RMATCC62417_04149               82.8    7e-15   Rhizopus microsporus
gb|EGT39434.1|  hypothetical protein CAEBREN_08033                    83.2    7e-15   Caenorhabditis brenneri
emb|CEG74956.1|  hypothetical protein RMATCC62417_10078               82.8    8e-15   Rhizopus microsporus
ref|XP_010440599.1|  PREDICTED: probable serine incorporator          78.2    8e-15   Camelina sativa [gold-of-pleasure]
dbj|GAM29010.1|  hypothetical protein SAMD00019534_121860             82.0    8e-15   Acytostelium subglobosum LB1
emb|CEG74955.1|  hypothetical protein RMATCC62417_10078               82.4    8e-15   Rhizopus microsporus
ref|XP_011458210.1|  PREDICTED: probable serine incorporator isof...  82.4    8e-15   Fragaria vesca subsp. vesca
ref|XP_004287083.1|  PREDICTED: probable serine incorporator isof...  82.8    8e-15   Fragaria vesca subsp. vesca
emb|CEG74954.1|  hypothetical protein RMATCC62417_10078               82.8    1e-14   Rhizopus microsporus
emb|CEJ03265.1|  hypothetical protein RMCBS344292_17253               81.3    1e-14   Rhizopus microsporus
ref|XP_004665239.1|  PREDICTED: serine incorporator 2                 82.8    1e-14   Jaculus jaculus
ref|XP_009336915.1|  PREDICTED: probable serine incorporator          82.0    1e-14   
emb|CEG74953.1|  hypothetical protein RMATCC62417_10078               82.4    1e-14   Rhizopus microsporus
ref|NP_189089.3|  Serinc-domain containing serine and sphingolipi...  82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EGT35951.1|  hypothetical protein CAEBREN_13181                    82.0    2e-14   Caenorhabditis brenneri
ref|XP_011174068.1|  PREDICTED: probable serine incorporator          77.0    2e-14   
gb|ETN74193.1|  TMS membrane protein/tumor differentially express...  81.6    2e-14   Necator americanus
emb|CDX93013.1|  BnaA03g37350D                                        81.3    2e-14   
ref|XP_005665214.1|  PREDICTED: serine incorporator 2-like            77.4    2e-14   
gb|ESA09597.1|  hypothetical protein GLOINDRAFT_80906                 81.3    2e-14   
gb|EGT34050.1|  hypothetical protein CAEBREN_24071                    81.6    3e-14   Caenorhabditis brenneri
emb|CEP13524.1|  hypothetical protein                                 81.6    3e-14   Parasitella parasitica
gb|KHN74385.1|  Serine incorporator 3                                 81.6    3e-14   Toxocara canis
ref|XP_002602420.1|  hypothetical protein BRAFLDRAFT_117027           81.3    4e-14   Branchiostoma floridae
dbj|GAN07994.1|  TMS membrane protein/tumor differentially expres...  81.3    4e-14   Mucor ambiguus
gb|EPB88143.1|  hypothetical protein HMPREF1544_05087                 81.3    4e-14   Mucor circinelloides f. circinelloides 1006PhL
gb|EXX55775.1|  Tms1p                                                 81.3    4e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_010049722.1|  PREDICTED: probable serine incorporator          80.5    5e-14   Eucalyptus grandis [rose gum]
ref|XP_003114570.1|  hypothetical protein CRE_26972                   80.9    5e-14   Caenorhabditis remanei
ref|XP_006295917.1|  hypothetical protein CARUB_v10025054mg           80.1    6e-14   
gb|EGW01137.1|  Serine incorporator 2                                 80.1    6e-14   Cricetulus griseus [Chinese hamsters]
emb|CEG70157.1|  hypothetical protein RMATCC62417_06104               80.5    6e-14   Rhizopus microsporus
ref|XP_008337449.1|  PREDICTED: probable serine incorporator          80.1    7e-14   
ref|XP_010469509.1|  PREDICTED: probable serine incorporator isof...  79.0    7e-14   
gb|ERE85397.1|  serine incorporator 2-like protein                    80.5    7e-14   Cricetulus griseus [Chinese hamsters]
ref|XP_002637793.1|  Hypothetical protein CBG04578                    80.1    7e-14   Caenorhabditis briggsae
ref|XP_007637556.1|  PREDICTED: serine incorporator 2 isoform X2      80.1    7e-14   
ref|XP_008362934.1|  PREDICTED: probable serine incorporator          79.7    7e-14   
ref|XP_007624716.1|  PREDICTED: serine incorporator 2 isoform X1      80.1    7e-14   
ref|NP_850202.4|  Serinc-domain containing serine and sphingolipi...  80.1    8e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KFH68151.1|  hypothetical protein MVEG_06880                       80.1    9e-14   Mortierella verticillata NRRL 6337
emb|CEF63556.1|  TMS1                                                 79.7    9e-14   Strongyloides ratti
ref|XP_005079567.1|  PREDICTED: serine incorporator 2 isoform X1      79.7    9e-14   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003136987.1|  hypothetical protein LOAG_01400                  79.7    9e-14   Loa loa
ref|XP_003102359.1|  hypothetical protein CRE_05000                   79.7    1e-13   Caenorhabditis remanei
gb|EJW79555.1|  serine incorporator 2                                 79.3    1e-13   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_010469508.1|  PREDICTED: probable serine incorporator isof...  79.3    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010469504.1|  PREDICTED: probable serine incorporator isof...  79.3    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010532841.1|  PREDICTED: probable serine incorporator          79.3    1e-13   
ref|XP_005079568.1|  PREDICTED: serine incorporator 2 isoform X2      79.3    1e-13   
ref|XP_001901605.1|  TDE2 protein                                     79.7    1e-13   Brugia malayi [agent of lymphatic filariasis]
ref|XP_010469507.1|  PREDICTED: probable serine incorporator isof...  79.3    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_007318557.1|  hypothetical protein SERLADRAFT_356127           79.7    1e-13   Serpula lacrymans var. lacrymans S7.9
ref|XP_002515588.1|  conserved hypothetical protein                   79.0    1e-13   Ricinus communis
ref|XP_010688168.1|  PREDICTED: probable serine incorporator          79.0    1e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010049913.1|  PREDICTED: probable serine incorporator isof...  79.0    2e-13   Eucalyptus grandis [rose gum]
emb|CDJ97729.1|  TMS membrane protein tumour differentially expre...  78.6    2e-13   Haemonchus contortus [red stomach worm]
ref|XP_010509918.1|  PREDICTED: probable serine incorporator          79.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_001770496.1|  predicted protein                                78.6    2e-13   
gb|KDP32305.1|  hypothetical protein JCGZ_13230                       78.6    2e-13   Jatropha curcas
emb|CDJ92178.1|  TMS membrane protein tumour differentially expre...  79.0    2e-13   Haemonchus contortus [red stomach worm]
ref|XP_002965853.1|  hypothetical protein SELMODRAFT_83891            78.2    2e-13   
ref|XP_004591703.1|  PREDICTED: serine incorporator 2 isoform X1      79.0    2e-13   Ochotona princeps [southern American pika]
ref|XP_009107689.1|  PREDICTED: probable serine incorporator          78.6    2e-13   
ref|XP_010435285.1|  PREDICTED: probable serine incorporator          78.6    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004591704.1|  PREDICTED: serine incorporator 2 isoform X2      79.0    2e-13   Ochotona princeps [southern American pika]
ref|XP_002957018.1|  hypothetical protein VOLCADRAFT_77374            78.6    2e-13   Volvox carteri f. nagariensis
ref|XP_007558462.1|  PREDICTED: serine incorporator 1-like            79.0    2e-13   Poecilia formosa
ref|XP_005353216.1|  PREDICTED: serine incorporator 2                 78.6    2e-13   Microtus ochrogaster [prairie voles]
ref|XP_010656350.1|  PREDICTED: probable serine incorporator isof...  77.8    2e-13   
ref|XP_006414928.1|  hypothetical protein EUTSA_v10025402mg           78.2    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006734246.1|  PREDICTED: serine incorporator 2-like            77.0    2e-13   Leptonychotes weddellii
gb|KFH68448.1|  hypothetical protein MVEG_05263                       78.6    3e-13   Mortierella verticillata NRRL 6337
gb|EYB93217.1|  hypothetical protein Y032_0184g1001                   78.2    3e-13   Ancylostoma ceylanicum
ref|XP_008846447.1|  PREDICTED: serine incorporator 2                 78.6    3e-13   Nannospalax galili
ref|XP_008272011.1|  PREDICTED: serine incorporator 2                 78.6    3e-13   Oryctolagus cuniculus [domestic rabbit]
gb|EYB93216.1|  hypothetical protein Y032_0184g1001                   78.2    3e-13   Ancylostoma ceylanicum
gb|EIE81637.1|  hypothetical protein RO3G_06342                       78.6    3e-13   Rhizopus delemar RA 99-880
ref|XP_008224089.1|  PREDICTED: probable serine incorporator          78.2    3e-13   Prunus mume [ume]
ref|XP_008146179.1|  PREDICTED: serine incorporator 2 isoform X2      78.6    3e-13   Eptesicus fuscus
ref|XP_009267712.1|  Membrane protein TMS1                            78.6    3e-13   Wallemia ichthyophaga EXF-994
ref|XP_004167946.1|  PREDICTED: serine incorporator 1-like            76.3    3e-13   
ref|NP_001240315.1|  serine incorporator 2 isoform 2                  78.2    3e-13   
ref|XP_010656344.1|  PREDICTED: probable serine incorporator isof...  78.2    3e-13   
gb|KFD55197.1|  hypothetical protein M513_03838                       78.6    3e-13   
ref|NP_506611.1|  Protein R11H6.2                                     78.2    3e-13   
ref|NP_766290.2|  serine incorporator 2 isoform 1 precursor           78.2    3e-13   
gb|ENN78699.1|  hypothetical protein YQE_04871                        78.6    3e-13   
ref|XP_006503126.1|  PREDICTED: serine incorporator 2 isoform X1      78.6    3e-13   
ref|NP_849373.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            77.8    3e-13   
ref|XP_008146178.1|  PREDICTED: serine incorporator 2 isoform X1      78.2    3e-13   
ref|XP_006410459.1|  hypothetical protein EUTSA_v10016703mg           78.2    3e-13   
ref|NP_567403.1|  protein MATERNAL EFFECT EMBRYO ARREST 55            77.8    3e-13   
ref|NP_001026826.1|  serine incorporator 2 precursor                  78.2    3e-13   
gb|EPY77486.1|  hypothetical protein CB1_001251006                    74.3    3e-13   
ref|XP_006285723.1|  hypothetical protein CARUB_v10007195mg           77.8    3e-13   
ref|XP_010450223.1|  PREDICTED: probable serine incorporator          77.8    3e-13   
ref|XP_010440600.1|  PREDICTED: probable serine incorporator          77.8    4e-13   
gb|KHG16194.1|  Serine incorporator 3                                 77.8    4e-13   
ref|XP_002863245.1|  hypothetical protein ARALYDRAFT_497050           77.8    4e-13   
ref|XP_009408948.1|  PREDICTED: probable serine incorporator          77.8    4e-13   
emb|CAP36379.2|  Protein CBG19072                                     78.2    4e-13   
ref|XP_002126357.1|  PREDICTED: serine incorporator 5-like            78.2    4e-13   
ref|XP_008458232.1|  PREDICTED: probable serine incorporator isof...  76.6    4e-13   
ref|XP_002637371.1|  Hypothetical protein CBG19072                    78.2    4e-13   
ref|XP_010413903.1|  PREDICTED: probable serine incorporator          77.8    4e-13   
emb|CDP03356.1|  unnamed protein product                              77.4    4e-13   
gb|AAX46603.1|  tumor differentially expressed 2-like                 77.8    4e-13   
sp|Q58CW5.1|SERC2_BOVIN  RecName: Full=Serine incorporator 2; Alt...  77.8    4e-13   
ref|XP_006645562.1|  PREDICTED: probable serine incorporator-like     77.8    5e-13   
gb|AAI26722.1|  SERINC2 protein                                       77.8    5e-13   
ref|XP_007226418.1|  hypothetical protein PRUPE_ppa023345mg           77.4    5e-13   
gb|ETE65034.1|  Serine incorporator 2                                 77.4    5e-13   
gb|ERL86825.1|  hypothetical protein D910_04228                       78.6    5e-13   
ref|XP_010527190.1|  PREDICTED: probable serine incorporator          77.4    5e-13   
ref|XP_002411145.1|  conserved hypothetical protein                   77.8    5e-13   
ref|XP_002881267.1|  TMS membrane family protein                      77.4    5e-13   
gb|KJB54130.1|  hypothetical protein B456_009G023600                  77.4    5e-13   
ref|XP_009688001.1|  PREDICTED: serine incorporator 2-like            77.0    5e-13   
ref|XP_004301051.1|  PREDICTED: probable serine incorporator          77.4    5e-13   
gb|KJB54127.1|  hypothetical protein B456_009G023600                  77.4    6e-13   
ref|XP_002982341.1|  hypothetical protein SELMODRAFT_179397           77.0    6e-13   
ref|XP_004512960.1|  PREDICTED: probable serine incorporator-like     77.4    6e-13   
gb|AIC61740.1|  SERINC2                                               72.8    6e-13   
ref|NP_001030362.1|  serine incorporator 2                            77.0    6e-13   
ref|XP_008408640.1|  PREDICTED: serine incorporator 1-like            77.4    6e-13   
ref|XP_011356110.1|  PREDICTED: serine incorporator 2 isoform X1      77.4    6e-13   
ref|XP_005676784.1|  PREDICTED: serine incorporator 2 isoform X1      77.4    6e-13   
ref|NP_001090209.1|  serine incorporator 1 precursor                  77.4    6e-13   
ref|XP_007573353.1|  PREDICTED: serine incorporator 1-like            77.4    6e-13   
ref|XP_008064965.1|  PREDICTED: serine incorporator 2                 77.4    7e-13   
ref|XP_005993191.1|  PREDICTED: serine incorporator 1-like            77.4    7e-13   
ref|NP_001231077.1|  serine incorporator 2 precursor                  77.4    7e-13   
ref|XP_011356111.1|  PREDICTED: serine incorporator 2 isoform X2      77.0    7e-13   
ref|XP_002324973.1|  TMS membrane family protein                      77.0    7e-13   
ref|XP_007952319.1|  PREDICTED: serine incorporator 2                 77.4    7e-13   
ref|XP_004968422.1|  PREDICTED: probable serine incorporator-like...  77.0    7e-13   
ref|XP_008458214.1|  PREDICTED: probable serine incorporator isof...  77.0    7e-13   
ref|XP_002426175.1|  serine incorporator, putative                    77.0    7e-13   
dbj|BAC37344.1|  unnamed protein product                              73.6    8e-13   
ref|XP_003738027.1|  PREDICTED: probable serine incorporator-like...  77.0    8e-13   
gb|AAH07375.2|  SERINC2 protein                                       73.2    8e-13   
ref|XP_004312133.1|  PREDICTED: serine incorporator 2 isoform 4       77.0    8e-13   
ref|XP_004312132.1|  PREDICTED: serine incorporator 2 isoform 3       77.0    8e-13   
ref|XP_006297795.1|  hypothetical protein CARUB_v10013830mg           77.0    8e-13   
ref|XP_008458224.1|  PREDICTED: probable serine incorporator isof...  77.0    8e-13   
ref|XP_002114508.1|  expressed hypothetical protein                   77.0    8e-13   
ref|XP_004266597.1|  PREDICTED: serine incorporator 2 isoform 3       77.0    8e-13   
ref|XP_004741007.1|  PREDICTED: serine incorporator 2                 77.0    8e-13   
ref|XP_004312131.1|  PREDICTED: serine incorporator 2 isoform 2       77.0    8e-13   
ref|XP_004612673.1|  PREDICTED: serine incorporator 3                 77.4    9e-13   
ref|XP_004266598.1|  PREDICTED: serine incorporator 2 isoform 4       76.6    9e-13   
ref|XP_001947564.2|  PREDICTED: probable serine incorporator isof...  72.8    9e-13   
ref|XP_004230114.1|  PREDICTED: probable serine incorporator          76.6    9e-13   
ref|XP_004312130.1|  PREDICTED: serine incorporator 2 isoform 1       77.0    9e-13   
ref|XP_005959570.1|  PREDICTED: serine incorporator 2 isoform X2      77.0    9e-13   
ref|XP_003638965.2|  PREDICTED: serine incorporator 2                 77.0    9e-13   
ref|XP_007534228.1|  PREDICTED: serine incorporator 2                 77.0    9e-13   
ref|XP_004139427.1|  PREDICTED: serine incorporator 1-like            76.6    9e-13   
ref|XP_008579104.1|  PREDICTED: serine incorporator 2                 77.0    1e-12   
ref|XP_004266595.1|  PREDICTED: serine incorporator 2 isoform 1       77.0    1e-12   
ref|XP_005906241.1|  PREDICTED: serine incorporator 2 isoform X2      77.0    1e-12   
ref|XP_006347785.1|  PREDICTED: probable serine incorporator-like...  76.6    1e-12   
ref|XP_004266596.1|  PREDICTED: serine incorporator 2 isoform 2       77.0    1e-12   
ref|XP_005676787.1|  PREDICTED: serine incorporator 2 isoform X4      76.6    1e-12   
ref|XP_007013229.1|  Serinc-domain containing serine and sphingol...  76.6    1e-12   
ref|XP_007013230.1|  Serinc-domain containing serine and sphingol...  76.3    1e-12   
ref|XP_005959571.1|  PREDICTED: serine incorporator 2 isoform X3      76.6    1e-12   
ref|XP_004005092.1|  PREDICTED: serine incorporator 2 isoform 3       76.6    1e-12   
ref|XP_005676785.1|  PREDICTED: serine incorporator 2 isoform X2      76.6    1e-12   
ref|XP_007013228.1|  Serinc-domain containing serine and sphingol...  76.6    1e-12   
gb|EKC27359.1|  DNA/RNA-binding protein KIN17                         75.1    1e-12   
ref|NP_001037624.1|  membrane protein TMS1 precursor                  76.6    1e-12   
ref|XP_004005091.1|  PREDICTED: serine incorporator 2 isoform 2       76.6    1e-12   
ref|XP_005959572.1|  PREDICTED: serine incorporator 2 isoform X4      76.3    1e-12   
ref|XP_007897489.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_007128527.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
gb|KFV77205.1|  Serine incorporator 1                                 76.6    1e-12   
gb|KFZ58338.1|  Serine incorporator 1                                 76.6    1e-12   
ref|XP_010466851.1|  PREDICTED: probable serine incorporator          76.3    1e-12   
ref|XP_004642983.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_001836185.1|  membrane protein                                 76.3    1e-12   
ref|XP_005906240.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_005959569.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_010767646.1|  PREDICTED: serine incorporator 1-like            73.6    1e-12   
ref|XP_010166344.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
ref|XP_006680018.1|  hypothetical protein BATDEDRAFT_37095            76.6    1e-12   
ref|XP_010249828.1|  PREDICTED: probable serine incorporator          76.3    1e-12   
ref|XP_008319400.1|  PREDICTED: serine incorporator 1-like            76.6    1e-12   
ref|XP_010974399.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
gb|ELR48720.1|  Serine incorporator 2                                 76.6    1e-12   
ref|XP_006924375.1|  PREDICTED: serine incorporator 2                 76.6    1e-12   
ref|XP_009284929.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_004314553.1|  PREDICTED: serine incorporator 1                 75.9    1e-12   
ref|XP_004005090.1|  PREDICTED: serine incorporator 2 isoform 1       76.3    1e-12   
ref|XP_005906242.1|  PREDICTED: serine incorporator 2 isoform X3      76.3    1e-12   
gb|KFM12545.1|  Serine incorporator 2                                 76.3    1e-12   
ref|XP_010950491.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_010835380.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_006196964.1|  PREDICTED: serine incorporator 2 isoform X1      76.6    1e-12   
ref|XP_010950492.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
gb|ERG80713.1|  serine incorporator 3                                 76.6    1e-12   
ref|XP_009907826.1|  PREDICTED: serine incorporator 1                 76.6    1e-12   
ref|XP_010513493.1|  PREDICTED: probable serine incorporator          76.3    1e-12   
gb|ELK02034.1|  Serine incorporator 2                                 76.3    1e-12   
ref|XP_002155155.2|  PREDICTED: probable serine incorporator-like     75.1    1e-12   
ref|XP_006767105.1|  PREDICTED: serine incorporator 2 isoform X3      76.3    1e-12   
ref|XP_003228070.1|  PREDICTED: serine incorporator 2                 76.3    1e-12   
ref|XP_003620496.1|  Serine incorporator                              76.3    1e-12   
ref|XP_006196965.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    1e-12   
ref|XP_006767103.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
ref|XP_004422332.1|  PREDICTED: serine incorporator 1                 76.3    1e-12   
ref|XP_005875118.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    1e-12   
emb|CDY37743.1|  BnaA04g19250D                                        76.6    1e-12   
gb|EPQ13210.1|  Serine incorporator 2                                 75.9    1e-12   
ref|XP_006176241.1|  PREDICTED: serine incorporator 2 isoform X1      76.3    2e-12   
ref|XP_006767104.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    2e-12   
ref|XP_003977493.1|  PREDICTED: serine incorporator 1-like isoform 1  76.3    2e-12   
gb|KFK39759.1|  serinc-domain containing serine and sphingolipid ...  76.3    2e-12   
ref|XP_007454962.1|  PREDICTED: serine incorporator 1                 76.3    2e-12   
ref|XP_004263915.1|  PREDICTED: serine incorporator 1                 76.3    2e-12   
gb|AAS66282.1|  LRRGT00191                                            77.4    2e-12   
gb|AGG19193.1|  maternal effect embryo arrest 55-1                    75.9    2e-12   
dbj|BAK01836.1|  predicted protein                                    76.3    2e-12   
ref|XP_006102950.1|  PREDICTED: serine incorporator 2                 76.3    2e-12   
ref|XP_005875119.1|  PREDICTED: serine incorporator 2 isoform X2      76.3    2e-12   
ref|XP_004406452.1|  PREDICTED: serine incorporator 2                 76.3    2e-12   
ref|NP_001011399.1|  serine incorporator 1 precursor                  76.3    2e-12   
ref|XP_006176242.1|  PREDICTED: serine incorporator 2 isoform X2      75.9    2e-12   
ref|XP_004425924.1|  PREDICTED: serine incorporator 2 isoform 1       75.9    2e-12   
emb|CBI33332.3|  unnamed protein product                              75.9    2e-12   
ref|XP_002968524.1|  hypothetical protein SELMODRAFT_89240            75.9    2e-12   
ref|XP_010650214.1|  PREDICTED: probable serine incorporator          75.9    2e-12   
ref|XP_002994401.1|  hypothetical protein SELMODRAFT_449363           75.5    2e-12   
gb|AAQ88795.1|  GSVL396                                               75.9    2e-12   
ref|XP_003937635.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
ref|XP_010910312.1|  PREDICTED: serine incorporator 1-like            72.4    2e-12   
dbj|BAM19260.1|  membrane protein tms1d                               75.9    2e-12   
ref|XP_011043440.1|  PREDICTED: probable serine incorporator          75.5    2e-12   
gb|EPY87330.1|  Tumor differentially expressed 2-like protein         75.9    2e-12   
ref|XP_005395079.1|  PREDICTED: serine incorporator 2 isoform X1      75.9    2e-12   
gb|KIJ14234.1|  hypothetical protein PAXINDRAFT_163421                75.9    2e-12   
emb|CDY66714.1|  BnaCnng52050D                                        75.5    2e-12   
ref|XP_003765548.1|  PREDICTED: serine incorporator 2                 76.3    2e-12   
ref|XP_010915041.1|  PREDICTED: probable serine incorporator          75.5    2e-12   
gb|KIK77929.1|  hypothetical protein PAXRUDRAFT_834805                75.9    2e-12   
ref|XP_009141296.1|  PREDICTED: probable serine incorporator isof...  75.5    2e-12   
ref|XP_006158214.1|  PREDICTED: serine incorporator 2                 75.9    2e-12   
gb|AAH17085.2|  SERINC2 protein                                       72.8    2e-12   
ref|XP_011062433.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_007190839.1|  PREDICTED: serine incorporator 1                 75.9    2e-12   
ref|XP_005395080.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    2e-12   
ref|XP_011062431.1|  PREDICTED: probable serine incorporator isof...  75.9    2e-12   
ref|XP_011062435.1|  PREDICTED: probable serine incorporator isof...  75.5    2e-12   
ref|XP_010666477.1|  PREDICTED: probable serine incorporator isof...  74.7    2e-12   
gb|AAH46718.1|  TDE2 protein                                          75.9    2e-12   
ref|XP_010264006.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_009141295.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_009891303.1|  PREDICTED: serine incorporator 2                 75.5    3e-12   
gb|KJB06649.1|  hypothetical protein B456_001G003900                  75.1    3e-12   
gb|ABQ22842.1|  serine incorporator 3-like protein                    71.2    3e-12   
ref|XP_007145428.1|  hypothetical protein PHAVU_007G238300g           75.5    3e-12   
ref|XP_011062434.1|  PREDICTED: probable serine incorporator isof...  75.5    3e-12   
ref|XP_004705083.1|  PREDICTED: serine incorporator 2                 75.5    3e-12   
ref|XP_007145427.1|  hypothetical protein PHAVU_007G238300g           75.5    3e-12   
gb|ELW48644.1|  Serine incorporator 2                                 75.5    3e-12   
gb|KIP08229.1|  hypothetical protein PHLGIDRAFT_18984                 75.5    3e-12   
gb|EHJ66123.1|  membrane protein TMS1                                 75.5    3e-12   
ref|XP_004678781.1|  PREDICTED: serine incorporator 2 isoform X2      75.5    3e-12   
ref|XP_006934583.1|  PREDICTED: serine incorporator 2                 75.1    3e-12   
ref|XP_006895005.1|  PREDICTED: serine incorporator 2                 75.5    3e-12   
ref|XP_010666475.1|  PREDICTED: probable serine incorporator isof...  75.1    3e-12   
ref|XP_007114993.1|  PREDICTED: serine incorporator 1                 75.5    3e-12   
ref|XP_004678780.1|  PREDICTED: serine incorporator 2 isoform X1      75.5    3e-12   
gb|KFP04468.1|  Serine incorporator 2                                 75.1    3e-12   
ref|XP_006132696.1|  PREDICTED: serine incorporator 1                 75.1    3e-12   
ref|XP_007867639.1|  TMS membrane protein/tumor differentially ex...  75.5    3e-12   
ref|XP_011449548.1|  PREDICTED: serine incorporator 1-like isofor...  75.5    3e-12   
ref|XP_009067513.1|  PREDICTED: serine incorporator 2                 75.1    3e-12   
gb|KFP69683.1|  Serine incorporator 2                                 75.1    3e-12   
gb|KJB06650.1|  hypothetical protein B456_001G003900                  75.1    3e-12   
ref|XP_006862244.1|  PREDICTED: serine incorporator 2                 75.1    3e-12   
ref|XP_011269367.1|  PREDICTED: probable serine incorporator isof...  75.1    3e-12   
ref|XP_008496681.1|  PREDICTED: serine incorporator 2                 74.7    4e-12   
gb|KIO14457.1|  hypothetical protein M404DRAFT_991205                 75.1    4e-12   
ref|XP_008419538.1|  PREDICTED: serine incorporator 1-like            75.1    4e-12   
gb|ELR60415.1|  Serine incorporator 1                                 75.1    4e-12   
ref|XP_011269371.1|  PREDICTED: probable serine incorporator isof...  75.1    4e-12   
ref|XP_008187951.1|  PREDICTED: probable serine incorporator isof...  70.9    4e-12   
gb|EOB02909.1|  Serine incorporator 1                                 75.1    4e-12   
ref|XP_007170642.1|  PREDICTED: serine incorporator 2                 75.1    4e-12   
gb|KFW95730.1|  Serine incorporator 1                                 74.3    4e-12   
ref|XP_006119217.1|  PREDICTED: serine incorporator 5 isoform X2      74.7    4e-12   
ref|NP_001042203.1|  Os01g0179800                                     75.1    4e-12   
ref|XP_006119218.1|  PREDICTED: serine incorporator 5 isoform X3      74.7    4e-12   
ref|XP_008272697.1|  PREDICTED: serine incorporator 3 isoform X1      75.1    4e-12   
ref|XP_011269370.1|  PREDICTED: probable serine incorporator isof...  75.1    4e-12   
ref|XP_005017423.1|  PREDICTED: serine incorporator 1                 74.7    4e-12   
ref|XP_006879047.1|  PREDICTED: serine incorporator 1                 75.1    4e-12   
ref|XP_006119216.1|  PREDICTED: serine incorporator 5 isoform X1      75.1    4e-12   
ref|XP_006626489.1|  PREDICTED: serine incorporator 1-like            75.1    4e-12   
ref|XP_004465792.1|  PREDICTED: serine incorporator 2 isoform 1       75.1    4e-12   
ref|XP_011449551.1|  PREDICTED: serine incorporator 1-like isofor...  75.1    4e-12   



>gb|KDO36651.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=161

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK+VSTG+ TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP
Sbjct  14   DYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP  73

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  74   MDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  133

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  134  VRILTGWATAALYMWSLVAPILFPDREF  161



>gb|KDO36650.1| hypothetical protein CISIN_1g028965mg [Citrus sinensis]
Length=201

 Score =   209 bits (533),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK+VSTG+ TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP
Sbjct  54   DYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP  113

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  114  MDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  173

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  174  VRILTGWATAALYMWSLVAPILFPDREF  201



>ref|XP_011073234.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073235.1| PREDICTED: probable serine incorporator [Sesamum indicum]
 ref|XP_011073236.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   206 bits (524),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VST +  LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTSSLALGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLP  325

Query  450  LDKADEH-EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LDKADEH EE EKSK VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  LDKADEHHEEAEKSKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR++T W TAALF+WSLVAPI+FPDR+F
Sbjct  386  WVRIITSWATAALFIWSLVAPIIFPDREF  414


 Score = 64.7 bits (156),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASVISLYC YLCYS LASEPR
Sbjct  231  VVTLHPSVSGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_009354238.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009354239.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370970.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009370971.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   206 bits (523),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T GLLTTVLSVVYSAVRAGSSTTLLSPP SPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSSTTLLSPPGSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DEHEE EKSK V+YSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  LDKVDEHEEKEKSKPVSYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TA L++WSL+APILFP+R+F
Sbjct  386  VRMVTGWATAGLYIWSLLAPILFPEREF  413


 Score = 64.7 bits (156),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  231  VVALHPAVNGSILPASVISMYCTYLCYSALASEPR  265



>ref|XP_007215456.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16655.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=397

 Score =   203 bits (517),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKHSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  250  EYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  309

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDKADEHEE EK+K V+YSYSFFHIIFSLASMYSAMLLTGW+TSVGESGKLVDVGW SVW
Sbjct  310  LDKADEHEEKEKAKPVSYSYSFFHIIFSLASMYSAMLLTGWTTSVGESGKLVDVGWPSVW  369

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA LF+WSL+APILFP+R+F
Sbjct  370  VRIVTSWATAGLFIWSLLAPILFPEREF  397


 Score = 65.1 bits (157),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  215  IVALHPAVNGSILPASVISMYCTYLCYSALASEPR  249



>ref|XP_007215457.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 ref|XP_007215458.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16656.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
 gb|EMJ16657.1| hypothetical protein PRUPE_ppa006404mg [Prunus persica]
Length=413

 Score =   203 bits (516),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKHSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  EYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDKADEHEE EK+K V+YSYSFFHIIFSLASMYSAMLLTGW+TSVGESGKLVDVGW SVW
Sbjct  326  LDKADEHEEKEKAKPVSYSYSFFHIIFSLASMYSAMLLTGWTTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA LF+WSL+APILFP+R+F
Sbjct  386  VRIVTSWATAGLFIWSLLAPILFPEREF  413


 Score = 65.5 bits (158),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  231  IVALHPAVNGSILPASVISMYCTYLCYSALASEPR  265



>ref|XP_008228861.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228862.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228863.1| PREDICTED: probable serine incorporator [Prunus mume]
 ref|XP_008228864.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=413

 Score =   203 bits (516),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKHSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  EYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDKADEHEE EK+K V+YSYSFFHIIFSLASMYSAMLLTGW+TSVGESGKLVDVGW SVW
Sbjct  326  LDKADEHEEKEKAKPVSYSYSFFHIIFSLASMYSAMLLTGWTTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA LF+WSL+APILFP+R+F
Sbjct  386  VRIVTSWATAGLFIWSLLAPILFPEREF  413


 Score = 65.5 bits (158),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  231  IVALHPAVNGSILPASVISMYCTYLCYSALASEPR  265



>ref|XP_006493450.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
Length=413

 Score =   207 bits (526),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK+VSTG+ TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP
Sbjct  266  DYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  MDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  386  VRILTGWATAALYMWSLVAPILFPDREF  413


 Score = 60.5 bits (145),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GSI PASVISLYC YLCYS L+SEPR
Sbjct  231  VVALHPAVGGSILPASVISLYCMYLCYSGLSSEPR  265



>gb|KHG09631.1| Serine incorporator 3 [Gossypium arboreum]
Length=413

 Score =   204 bits (520),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADEHEE EK+K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  MDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TA L++WSLVAPILFP+R+F
Sbjct  386  VRIITGWATAGLYIWSLVAPILFPEREF  413


 Score = 62.4 bits (150),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_006427689.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
 gb|ESR40929.1| hypothetical protein CICLE_v10025720mg [Citrus clementina]
Length=413

 Score =   207 bits (526),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK+VSTG+ TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP
Sbjct  266  DYECNGLHRHSKAVSTGSLTLGLITTVLSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADE EE EK+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  MDKADEVEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TAAL++WSLVAPILFPDR+F
Sbjct  386  VRILTGWATAALYMWSLVAPILFPDREF  413


 Score = 59.7 bits (143),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GS+ PASVISLYC YLCYS L+SEPR
Sbjct  231  VVALHPAVGGSVLPASVISLYCMYLCYSGLSSEPR  265



>ref|XP_008381162.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   201 bits (510),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T GLLTTVLSVVYSAVRAGSSTTLLSPPSSPR+G GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRSGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DEHEE EKSK V+YSYSFFHIIFSLASMYSAMLLTGWS SVGESGKLVDVGW SVW
Sbjct  326  LDKVDEHEEKEKSKPVSYSYSFFHIIFSLASMYSAMLLTGWSASVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L++WSL+APILFP+R+F
Sbjct  386  VRMVTSWATAGLYIWSLLAPILFPEREF  413


 Score = 65.9 bits (159),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHPSV GSI PASVIS+YCTYLCYSALASEPR
Sbjct  231  IVALHPSVSGSILPASVISMYCTYLCYSALASEPR  265



>gb|KJB67006.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67007.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67008.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67009.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67010.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67011.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
 gb|KJB67013.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=412

 Score =   207 bits (526),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 142/148 (96%), Gaps = 1/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT T+GLLTT+LSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP
Sbjct  266  DYECNGLHKHSKAISTGTVTVGLLTTILSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDKADE EE EK+KAVTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  LDKADE-EEKEKNKAVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  384

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +R++T WVTAAL++WSL+APILFPDRDF
Sbjct  385  IRILTAWVTAALYMWSLLAPILFPDRDF  412


 Score = 59.7 bits (143),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V  SI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVGSSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_008342757.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=413

 Score =   201 bits (512),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T GLLTTVLSVVYSAVRAGSSTTLLSPP SPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSSTTLLSPPGSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DEH+E EKSK V+YSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  LDKVDEHKEKEKSKPVSYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L++WSL+APILFP+R+F
Sbjct  386  VRMVTSWATAGLYIWSLLAPILFPEREF  413


 Score = 65.1 bits (157),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  231  IVALHPAVSGSILPASVISMYCTYLCYSALASEPR  265



>gb|KJB68287.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   204 bits (519),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  264  DYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADEHEE EK+K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  MDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  383

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TA L++WSLVAPILFP+R+F
Sbjct  384  VRIITGWATAGLYVWSLVAPILFPEREF  411


 Score = 62.4 bits (150),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  229  IVALHPAVGGSILPASVISLYCMYLCYSGLASEPR  263



>gb|KJB68285.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68288.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
 gb|KJB68289.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=413

 Score =   204 bits (518),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 140/148 (95%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADEHEE EK+K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  MDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TA L++WSLVAPILFP+R+F
Sbjct  386  VRIITGWATAGLYVWSLVAPILFPEREF  413


 Score = 62.4 bits (150),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_004158797.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
 gb|KGN45209.1| hypothetical protein Csa_7G431410 [Cucumis sativus]
Length=411

 Score =   204 bits (520),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 140/148 (95%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT +LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLSLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            L+KADEHEE EKSK VTYSYSFFHIIFSLASMYSAMLLTGW+TSVG SG+LVDVGWASVW
Sbjct  324  LEKADEHEEKEKSKPVTYSYSFFHIIFSLASMYSAMLLTGWTTSVGGSGRLVDVGWASVW  383

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VRVVTGW TAALF+WSL+AP+LFPDRDF
Sbjct  384  VRVVTGWATAALFIWSLIAPVLFPDRDF  411


 Score = 61.2 bits (147),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GS+ PASVISLYC YLCYS LASEPR
Sbjct  231  VVALHPAVGGSVLPASVISLYCMYLCYSGLASEPR  265



>ref|XP_009365247.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009365248.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=413

 Score =   199 bits (506),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T GLLTTVLSVVYSAVRAGSSTTLLSPP+SPR+G GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTFGLLTTVLSVVYSAVRAGSSTTLLSPPNSPRSGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DEHEE EKSK V+YSY+FFHIIFSLASMYSAMLLTGWS SVGESGKLVDVGW SVW
Sbjct  326  LDKVDEHEEKEKSKPVSYSYAFFHIIFSLASMYSAMLLTGWSASVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L++WSL+APILFP+R+F
Sbjct  386  VRMVTSWATAGLYIWSLLAPILFPEREF  413


 Score = 65.9 bits (159),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHPSV GSI PASVIS+YCTYLCYSALASEPR
Sbjct  231  IVALHPSVSGSILPASVISMYCTYLCYSALASEPR  265



>ref|XP_007024820.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 ref|XP_007024821.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27442.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
 gb|EOY27443.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein isoform 1 [Theobroma cacao]
Length=413

 Score =   201 bits (511),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT T GLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GK LLP
Sbjct  266  DYECNGLHKHSKAISTGTLTFGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKSLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDKADE EE +K+K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  LDKADEQEEKDKNKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TA L+LWSL+APILFP+R+F
Sbjct  386  VRIITGWATAGLYLWSLIAPILFPEREF  413


 Score = 62.4 bits (150),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_010318692.1| PREDICTED: probable serine incorporator [Solanum lycopersicum]
Length=413

 Score =   195 bits (496),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VS+GT  LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DE EE E+SK V+YSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  326  LDKVDEEEEKERSKPVSYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  386  VRIVTGWATAALFIWSQVAPILFPDREF  413


 Score = 67.0 bits (162),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>ref|XP_011466994.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466995.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466996.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
 ref|XP_011466997.1| PREDICTED: serine incorporator 3 [Fragaria vesca subsp. vesca]
Length=414

 Score =   197 bits (500),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN+LHKHSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  267  DYECNSLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  326

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK +E EE EK+K+V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKL+DVGW SVW
Sbjct  327  LDKPEEREENEKAKSVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLIDVGWPSVW  386

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VRV+T W TA L++WSL+APILFP+R+F
Sbjct  387  VRVMTSWATAGLYIWSLLAPILFPEREF  414


 Score = 63.5 bits (153),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  232  IVALHPTVGGSILPASVISVYCTYLCYSALASEPR  266



>ref|XP_006341429.1| PREDICTED: probable serine incorporator-like isoform X1 [Solanum 
tuberosum]
Length=413

 Score =   193 bits (490),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VS+GT  LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DE EE E+SK V+YSYSFFH+IFSLASMYSAMLLTGWSTSVGE+G LVDVGW SVW
Sbjct  326  LDKVDEEEEKERSKPVSYSYSFFHLIFSLASMYSAMLLTGWSTSVGENGNLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  386  VRIVTGWATAALFIWSQVAPILFPDREF  413


 Score = 67.0 bits (162),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>gb|KJB68286.1| hypothetical protein B456_010G236500 [Gossypium raimondii]
Length=411

 Score =   197 bits (500),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 139/148 (94%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAISTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +DKADEHEE EK+K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  MDKADEHEEKEKNKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  383

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++TGW TA L++WSLVAPILFP+R+F
Sbjct  384  VRIITGWATAGLYVWSLVAPILFPEREF  411


 Score = 62.4 bits (150),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_004135884.1| PREDICTED: probable serine incorporator-like [Cucumis sativus]
Length=422

 Score =   194 bits (493),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 137/154 (89%), Gaps = 8/154 (5%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtl------gllttvlsvVYSAVRAGssttllsppssPRAGG  469
            DYECN LHKHSK+VSTGT +L        LTTVLSVVYSAVRAGSSTTLLSPPSSP AG 
Sbjct  271  DYECNGLHKHSKAVSTGTLSLGLLTTVLSLTTVLSVVYSAVRAGSSTTLLSPPSSPYAG-  329

Query  468  GKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDV  289
             KPLLPL+KADEHEE EKSK VTYSYSFFHIIFSLASMYSAMLLTGW+TSVG SG+LVDV
Sbjct  330  -KPLLPLEKADEHEEKEKSKPVTYSYSFFHIIFSLASMYSAMLLTGWTTSVGGSGRLVDV  388

Query  288  GWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            GWASVWVRVVTGW TAALF+WSL+AP+LFPDRDF
Sbjct  389  GWASVWVRVVTGWATAALFIWSLIAPVLFPDRDF  422


 Score = 60.8 bits (146),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GS+ PASVISLYC YLCYS LASEPR
Sbjct  236  VVALHPAVGGSVLPASVISLYCMYLCYSGLASEPR  270



>gb|EYU21792.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21793.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
 gb|EYU21794.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=416

 Score =   191 bits (485),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VST +  LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTSSLGLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLP  325

Query  450  LDKADEHEEMEKS---KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
            LDKADEH E E+    +AVTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGWA
Sbjct  326  LDKADEHHEEEEKSKSRAVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR++T W TAALF+WSLVAPILFPDR+F
Sbjct  386  SVWVRIITSWATAALFIWSLVAPILFPDREF  416


 Score = 63.2 bits (152),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++TLHPSV GS+ PASVISLYC YLCYS LASEPR
Sbjct  231  VITLHPSVSGSLLPASVISLYCMYLCYSGLASEPR  265



>ref|XP_002270610.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 ref|XP_010655133.1| PREDICTED: probable serine incorporator [Vitis vinifera]
 emb|CBI25248.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   193 bits (491),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT TLGLLTT+LSV+YSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTLGLLTTILSVIYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            L+K D  EE  ++K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESG+LVDVGW SVW
Sbjct  326  LEKTDVPEEKHEAKPVTYSYTFFHIIFSLASMYSAMLLTGWSTSVGESGRLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAAL++WSL APILFP+R+F
Sbjct  386  VRIVTGWATAALYIWSLAAPILFPEREF  413


 Score = 60.1 bits (144),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASV+SLYC YLCYS L+SEPR
Sbjct  231  IVALHPAVGGSILPASVVSLYCMYLCYSGLSSEPR  265



>ref|XP_011082649.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=414

 Score =   189 bits (481),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK+VST +  +GLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  DYECNGLHRHSKAVSTSSLAIGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGSGKPLLP  325

Query  450  LDKADEHEEMEKSKA-VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LDKADE  E ++    VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  LDKADEEHEEKEKSKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+VTGW TAALF+WSLVAPI+FPDR+F
Sbjct  386  WVRIVTGWATAALFIWSLVAPIIFPDREF  414


 Score = 63.5 bits (153),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+TLHPSV GSI P+SVISLYC YLCYS LASEPR
Sbjct  231  IITLHPSVSGSILPSSVISLYCMYLCYSGLASEPR  265



>ref|XP_006341430.1| PREDICTED: probable serine incorporator-like isoform X2 [Solanum 
tuberosum]
Length=411

 Score =   186 bits (471),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VS+GT  LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSSGTLALGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK DE EE E+SK V+YSYSFFH+IFSLASMYSAMLLTGWSTSVGE+G LVDVGW SVW
Sbjct  324  LDKVDEEEEKERSKPVSYSYSFFHLIFSLASMYSAMLLTGWSTSVGENGNLVDVGWPSVW  383

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  384  VRIVTGWATAALFIWSQVAPILFPDREF  411


 Score = 67.0 bits (162),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>ref|XP_011020548.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=415

 Score =   190 bits (482),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LH+HSK+VSTGT ++GLLTTVLSVVYSAVRAGSST LLSPPSSPRAG  KPLLP
Sbjct  266  EYECNGLHRHSKAVSTGTLSIGLLTTVLSVVYSAVRAGSSTALLSPPSSPRAGADKPLLP  325

Query  450  LD-KADEHEEMEKS-KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
            LD KA+E EE EK+ K VTYSYSFFHIIFSLASMYSAMLLTGWSTS+GESGKLVDVGW S
Sbjct  326  LDNKANEQEEKEKARKPVTYSYSFFHIIFSLASMYSAMLLTGWSTSIGESGKLVDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR++TGW TA L+ WSLVAPILFPDR+F
Sbjct  386  VWVRILTGWATAGLYTWSLVAPILFPDREF  415


 Score = 62.4 bits (150),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVNGSVLPASVISLYCMYLCYSGLASEPR  265



>ref|XP_007140603.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
 gb|ESW12597.1| hypothetical protein PHAVU_008G126100g [Phaseolus vulgaris]
Length=410

 Score =   184 bits (468),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 133/148 (90%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GL+TTVLSVVYSAVRAGSS  +LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTVTMGLVTTVLSVVYSAVRAGSSAAVLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD A E E+ EK+K VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  LD-AREEEDKEKAKPVTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  382

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  383  VRIVTSWATALLYLWSLVAPIMFPEREF  410


 Score = 65.9 bits (159),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVISLYCTYLCYSALASEPR
Sbjct  231  IVALHPAVNGSVLPASVISLYCTYLCYSALASEPR  265



>gb|EMS53525.1| putative serine incorporator [Triticum urartu]
Length=316

 Score =   188 bits (477),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK++STG+ TLGL TT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  169  DYECNGLHNHSKAMSTGSLTLGLCTTILSVVYSAVRAGSSATVLSAPDSPRAGADKPLLP  228

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              KADE E  +  K VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  229  FSKADEEETKDVPKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  288

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  289  VRIATQWATAGLFIWSLVAPLLFPDREF  316


 Score = 60.8 bits (146),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP V GS+ PASVI LYCTYLCYS L+SEPR
Sbjct  134  IVALHPKVNGSLLPASVIGLYCTYLCYSGLSSEPR  168



>gb|EMT13726.1| Putative serine incorporator [Aegilops tauschii]
Length=414

 Score =   188 bits (477),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK++STG+ TLGL TT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  267  DYECNGLHNHSKAMSTGSLTLGLCTTILSVVYSAVRAGSSATVLSAPDSPRAGSDKPLLP  326

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              KADE E  +  K VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  327  FSKADEEETKDVPKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  386

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  387  VRIATQWATAGLFIWSLVAPLLFPDREF  414


 Score = 60.8 bits (146),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP V GS+ PASVI LYCTYLCYS L+SEPR
Sbjct  232  IVALHPKVNGSLLPASVIGLYCTYLCYSGLSSEPR  266



>gb|KDP41926.1| hypothetical protein JCGZ_26944 [Jatropha curcas]
Length=413

 Score =   187 bits (475),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 135/150 (90%), Gaps = 4/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GL TTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTVGLFTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKA--DEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
            L+ +  + HEE +K K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW S
Sbjct  324  LENSTGEHHEEKDKVKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPS  383

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVRV+TGW TA L+LWSLVAPI+FPDR+F
Sbjct  384  VWVRVITGWATAGLYLWSLVAPIMFPDREF  413


 Score = 61.6 bits (148),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YC YLCYS LASEPR
Sbjct  231  IVALHPAVNGSILPASVISVYCMYLCYSGLASEPR  265



>gb|AFK43836.1| unknown [Medicago truncatula]
Length=190

 Score =   187 bits (474),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTG+ TLGL+TTVLSVVYSAVRAGSS T+LSPPSSPRAG  KPLLP
Sbjct  46   DYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYSAVRAGSSATVLSPPSSPRAG--KPLLP  103

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD  DE E  EK+K VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  104  LDAKDE-ESNEKAKPVTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  162

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  163  VRIVTCWATALLYLWSLVAPIMFPEREF  190


 Score = 62.0 bits (149),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVIS YC YLCYSALASEPR
Sbjct  11   IVALHPAVNGSVLPASVISFYCMYLCYSALASEPR  45



>ref|XP_004492298.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=410

 Score =   182 bits (462),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 132/148 (89%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT TLGL+TTVLSVVYSAVRAGSS T+LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSSATVLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD   E E  EK+K VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  LD-VKEEESNEKAKPVTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  382

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  383  VRIVTCWATALLYLWSLVAPIMFPEREF  410


 Score = 66.6 bits (161),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHPSV GS+ PASVISLYCTYLCYSALASEPR
Sbjct  231  IVALHPSVNGSVLPASVISLYCTYLCYSALASEPR  265



>ref|XP_009399576.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   187 bits (476),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK VSTG+ TLGLLTTVLSVVYSAVRAGSST+L SPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHNHSKVVSTGSLTLGLLTTVLSVVYSAVRAGSSTSLFSPPSSPRAGSEKPLLP  325

Query  450  LDKADEHEEM--EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             DK DE E+   +++K V+YSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKL+DVGW S
Sbjct  326  FDKLDEQEDKKNDEAKPVSYSYTFFHLIFSLASMYSAMLLTGWSTSVGESGKLIDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+VTGW TAALF+WSLVAP++FPDR+F
Sbjct  386  VWVRIVTGWATAALFMWSLVAPLIFPDREF  415


 Score = 60.1 bits (144),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  733  VTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            V LHP V GS+ PAS+ISLYCTYLCYS L+SEPR
Sbjct  232  VALHPKVNGSLLPASIISLYCTYLCYSGLSSEPR  265



>gb|EYU21795.1| hypothetical protein MIMGU_mgv1a007183mg [Erythranthe guttata]
Length=414

 Score =   184 bits (467),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 5/151 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VST +  LGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTSSLGLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKS---KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
            LDKADEH E E+    +AVTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGWA
Sbjct  324  LDKADEHHEEEEKSKSRAVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  383

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR++T W TAALF+WSLVAPILFPDR+F
Sbjct  384  SVWVRIITSWATAALFIWSLVAPILFPDREF  414


 Score = 63.2 bits (152),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++TLHPSV GS+ PASVISLYC YLCYS LASEPR
Sbjct  231  VITLHPSVSGSLLPASVISLYCMYLCYSGLASEPR  265



>gb|KEH22799.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=427

 Score =   183 bits (465),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTG+ TLGL+TTVLSVVYSAVRAGSS T+LSPPSSPRAG  KPLLP
Sbjct  283  DYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYSAVRAGSSATVLSPPSSPRAG--KPLLP  340

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD  DE E  EK+K VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  341  LDAKDE-ESNEKAKPVTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  399

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  400  VRIVTCWATALLYLWSLVAPIMFPEREF  427


 Score = 62.4 bits (150),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVIS YC YLCYSALASEPR
Sbjct  248  IVALHPAVNGSVLPASVISFYCMYLCYSALASEPR  282



>gb|KEH22798.1| serinc-domain serine and sphingolipid biosynthesis protein [Medicago 
truncatula]
Length=410

 Score =   184 bits (466),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTG+ TLGL+TTVLSVVYSAVRAGSS T+LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGSLTLGLVTTVLSVVYSAVRAGSSATVLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD  DE E  EK+K VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  LDAKDE-ESNEKAKPVTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  382

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA L+LWSLVAPI+FP+R+F
Sbjct  383  VRIVTCWATALLYLWSLVAPIMFPEREF  410


 Score = 62.4 bits (150),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVIS YC YLCYSALASEPR
Sbjct  231  IVALHPAVNGSVLPASVISFYCMYLCYSALASEPR  265



>ref|XP_009759114.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009759115.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = -1

Query  699  SQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRA  520
            S L LY CT   ++   L     DYECN LHKHSK+VS+G+  LGLLTTVLSVVYSAVRA
Sbjct  246  SVLSLY-CTYLCYSA--LASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRA  302

Query  519  GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAML  340
            GSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYSAML
Sbjct  303  GSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYSAML  362

Query  339  LTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  363  LTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  413


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>emb|CDO98258.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   181 bits (458),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VST T T+GLLTTVLSVVYSAVRAGSSTTLLSP        GKPLLP
Sbjct  266  DYECNGLHKHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSSTTLLSPSPPSSPRAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDKAD+ EE EK+K VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW
Sbjct  326  LDKADKEEEKEKAKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAALFLWSLVAPILFPDR+F
Sbjct  386  VRIVTGWATAALFLWSLVAPILFPDREF  413


 Score = 64.7 bits (156),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASVISLYC YLCYS LASEPR
Sbjct  231  VVTLHPSVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_010687311.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687312.1| PREDICTED: probable serine incorporator [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   182 bits (462),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY+CN LHKHS++VST + TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG G+PLLP
Sbjct  266  DYQCNGLHKHSQAVSTTSLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGRPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK  E EE EK+K V+YSYSFFHIIFSLASMYSAMLLTGW+TSVGESGKLVDVGW+SVW
Sbjct  326  LDKVAEEEEKEKAKPVSYSYSFFHIIFSLASMYSAMLLTGWTTSVGESGKLVDVGWSSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAAL++WSLVAP LFPDR+F
Sbjct  386  VRIVTGWATAALYIWSLVAPSLFPDREF  413


 Score = 63.2 bits (152),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVNGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_003570284.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=414

 Score =   182 bits (463),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY+CN LH HSK++STG+ TLGL+TT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  266  DYKCNGLHNHSKAMSTGSLTLGLITTILSVVYSAVRAGSSATVLSAPDSPRAGADKPLLP  325

Query  450  LDKADEHE-EMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE E + +  K VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  FSKADEEEAKKDVPKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  386  WVRMATQWATAGLFVWSLVAPILFPDREF  414


 Score = 62.0 bits (149),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI+LYCTYLCYSAL+SEPR
Sbjct  231  IVALHPKINGSLLPASVIALYCTYLCYSALSSEPR  265



>ref|XP_010107188.1| putative serine incorporator [Morus notabilis]
 gb|EXC14084.1| putative serine incorporator [Morus notabilis]
Length=413

 Score =   180 bits (456),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKHSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  266  EYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LDK +EHEE EK+K VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESG+LVDVGW SVW
Sbjct  326  LDKVEEHEEKEKAKPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGRLVDVGWPSVW  385

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VTGW TAAL++WSL APILFP+R+F
Sbjct  386  VRIVTGWATAALYIWSLAAPILFPEREF  413


 Score = 64.3 bits (155),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GSI PAS+ISLYCTYLCYSALASEPR
Sbjct  231  VVALHPTVSGSILPASIISLYCTYLCYSALASEPR  265



>ref|XP_009615680.1| PREDICTED: serine incorporator 3 isoform X2 [Nicotiana tomentosiformis]
Length=413

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = -1

Query  699  SQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRA  520
            S L LY CT   ++   L     DYECN LHKHSK+VS+G+  LGLLTTVLSVVYSAVRA
Sbjct  246  SVLSLY-CTYLCYSA--LASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRA  302

Query  519  GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAML  340
            GSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYSAML
Sbjct  303  GSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYSAML  362

Query  339  LTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  363  LTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  413


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV+GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVRGSILPASVLSLYCTYLCYSALASEPR  265



>gb|AFK46909.1| unknown [Lotus japonicus]
Length=353

 Score =   179 bits (454),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT TLGLLTT LSVVYSAVRAGSS T+LSPPSSPRAG  KPLLP
Sbjct  209  DYECNGLHKHSKAVSTGTLTLGLLTTTLSVVYSAVRAGSSATVLSPPSSPRAG--KPLLP  266

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD  +E E+ EK K VTYSYSFFH+IFSLASMY AMLLTGWS SVGESGKLVDVGW SVW
Sbjct  267  LD-GNEEEKNEKGKPVTYSYSFFHLIFSLASMYFAMLLTGWSPSVGESGKLVDVGWPSVW  325

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+VT W TA LFLWSLVAPI+FP+R+F
Sbjct  326  VRIVTCWATAILFLWSLVAPIMFPEREF  353


 Score = 64.7 bits (156),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI P+SVISLYCTYLCYSALASEPR
Sbjct  174  IVALHPAVNGSILPSSVISLYCTYLCYSALASEPR  208



>ref|XP_009615679.1| PREDICTED: probable serine incorporator isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = -1

Query  699  SQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRA  520
            S L LY CT   ++   L     DYECN LHKHSK+VS+G+  LGLLTTVLSVVYSAVRA
Sbjct  246  SVLSLY-CTYLCYSA--LASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRA  302

Query  519  GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAML  340
            GSSTTLLSPPSSPRAG GKPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYSAML
Sbjct  303  GSSTTLLSPPSSPRAGAGKPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYSAML  362

Query  339  LTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  363  LTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  413


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>gb|ABR25551.1| serine incorporator 3 [Oryza sativa Indica Group]
Length=220

 Score =   183 bits (464),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ +LGLLTT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  72   DYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSATVLSAPDSPRAGADKPLLP  131

Query  450  LDKADEH-EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE  E+ +  + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  132  FSKADEEAEKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  191

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  192  WVRIATQWATAGLYIWSLVAPLLFPDREF  220


 Score = 60.1 bits (144),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI+LYCTYLCYS L+SEPR
Sbjct  37   IVALHPKINGSLLPASVIALYCTYLCYSGLSSEPR  71



>ref|NP_001048364.1| Os02g0792900 [Oryza sativa Japonica Group]
 dbj|BAD19186.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAD19654.1| putative tumor differentially expressed protein 1 [Oryza sativa 
Japonica Group]
 dbj|BAF10278.1| Os02g0792900 [Oryza sativa Japonica Group]
 gb|EAY87831.1| hypothetical protein OsI_09251 [Oryza sativa Indica Group]
 dbj|BAG96913.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97616.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   181 bits (460),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ +LGLLTT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSATVLSAPDSPRAGADKPLLP  325

Query  450  LDKADEH-EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE  E+ +  + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  FSKADEEAEKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  386  WVRIATQWATAGLYIWSLVAPLLFPDREF  414


 Score = 60.8 bits (146),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI+LYCTYLCYS L+SEPR
Sbjct  231  IVALHPKINGSLLPASVIALYCTYLCYSGLSSEPR  265



>ref|XP_006649122.1| PREDICTED: probable serine incorporator-like, partial [Oryza 
brachyantha]
Length=384

 Score =   181 bits (460),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ +LGLLTT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  236  DYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSATVLSAPDSPRAGADKPLLP  295

Query  450  LDKADEH-EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE  E+ +  + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  296  FSKADEEAEKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  355

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  356  WVRIATQWATAGLYIWSLVAPLLFPDREF  384


 Score = 60.8 bits (146),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI+LYCTYLCYS L+SEPR
Sbjct  201  IVALHPKINGSLLPASVIALYCTYLCYSGLSSEPR  235



>gb|EAZ24909.1| hypothetical protein OsJ_08689 [Oryza sativa Japonica Group]
Length=414

 Score =   181 bits (460),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ +LGLLTT+LSVVYSAVRAGSS T+LS P SPRAG  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLSLGLLTTILSVVYSAVRAGSSATVLSAPDSPRAGADKPLLP  325

Query  450  LDKADEH-EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE  E+ +  + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  FSKADEEAEKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA L++WSLVAP+LFPDR+F
Sbjct  386  WVRIATQWATAGLYIWSLVAPLLFPDREF  414


 Score = 60.8 bits (146),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI+LYCTYLCYS L+SEPR
Sbjct  231  IVALHPKINGSLLPASVIALYCTYLCYSGLSSEPR  265



>ref|XP_008790112.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
 ref|XP_008778863.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Phoenix dactylifera]
Length=415

 Score =   182 bits (463),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSST++LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSTSVLSPPSSPRAGSEKPLLP  325

Query  450  LDKADEHEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             DK ++ E+ +K  +K V+YSYSFF++IFSLASMYSAMLLTGWSTSVGESGKLVDVGW S
Sbjct  326  FDKVEQQEDRKKDEAKPVSYSYSFFYLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+VT W TAAL++WSL+APILFPDR+F
Sbjct  386  VWVRIVTEWATAALYIWSLIAPILFPDREF  415


 Score = 58.2 bits (139),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASV+SLYC YLCYS L+SEPR
Sbjct  231  VIALHPKVNGSLLPASVLSLYCAYLCYSGLSSEPR  265



>ref|XP_008794380.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=415

 Score =   178 bits (452),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRA   +PLLP
Sbjct  266  DYECNGLHGHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRASSERPLLP  325

Query  450  LDKADEHEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             DK ++ E+ +K  +K V+YSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW S
Sbjct  326  FDKVEQQEDRKKDEAKPVSYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+VTGW TAAL++WSL+APILFPDR+F
Sbjct  386  VWVRIVTGWATAALYIWSLIAPILFPDREF  415


 Score = 61.6 bits (148),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVISLYCTYLCYS L+SEPR
Sbjct  231  VVALHPKVNGSLLPASVISLYCTYLCYSGLSSEPR  265



>ref|XP_009383181.1| PREDICTED: probable serine incorporator [Musa acuminata subsp. 
malaccensis]
Length=415

 Score =   179 bits (453),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSSTTL+SPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSTTLISPPSSPRAGSEKPLLP  325

Query  450  LDKADEHEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             DK +E E+ +K  +K V+YSY+FFH+IFSLASMYSAMLLTGWSTSVG SGKLVDVGW S
Sbjct  326  FDKLEEQEDKKKDEAKPVSYSYAFFHLIFSLASMYSAMLLTGWSTSVGGSGKLVDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR++TGW TA+LF+WSL+AP++FP+R F
Sbjct  386  VWVRIITGWATASLFIWSLIAPLIFPERVF  415


 Score = 60.5 bits (145),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVISLYCTYLCYS ++SEPR
Sbjct  231  VVALHPKVNGSLLPASVISLYCTYLCYSGISSEPR  265



>ref|XP_008461193.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Cucumis melo]
Length=416

 Score =   179 bits (453),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlglltt---vlsvVYSAVRAGssttllsppssPRAGGGKP  460
            DYECN LHKHS  +S GT  + + +      S+ +    +                 GKP
Sbjct  266  DYECNGLHKHSVEISCGTSXISISSKEGDFFSLHFVCSVSYIEFIRCHILDFSIKWAGKP  325

Query  459  LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
            LLPL+K+DEHEE EKSK VTYSYSFFHIIFSLASMYSAMLLTGW+TSVG SGKLVDVGWA
Sbjct  326  LLPLEKSDEHEEKEKSKPVTYSYSFFHIIFSLASMYSAMLLTGWTTSVGGSGKLVDVGWA  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+VTGW TAALF+WSL+AP+LFPDRDF
Sbjct  386  SVWVRIVTGWATAALFIWSLIAPVLFPDRDF  416


 Score = 60.5 bits (145),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP++ GS+ PASVISLYC YLCYS LASEPR
Sbjct  231  VVALHPAIGGSVLPASVISLYCMYLCYSGLASEPR  265



>gb|ABK96018.1| unknown [Populus trichocarpa]
Length=414

 Score =   178 bits (452),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LH+HSK+VST T T+GLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  EYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGADKPLLP  325

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD K  E EE EK+K VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  LDNKPSEKEEKEKAKPVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  386  WVRILTGWATAGLYIWSLVAPILFPDREF  414


 Score = 59.3 bits (142),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I  LHP+V GS+ PASVISLYC YLCYS L+SEPR
Sbjct  231  IAALHPAVNGSVLPASVISLYCMYLCYSGLSSEPR  265



>ref|XP_006307669.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
 gb|EOA40567.1| hypothetical protein CARUB_v10009295mg [Capsella rubella]
Length=412

 Score =   175 bits (443),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRA   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KADE EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKADEKEEKENKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDREF  412


 Score = 62.4 bits (150),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVVLHPTVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_010929190.1| PREDICTED: probable serine incorporator isoform X1 [Elaeis guineensis]
Length=423

 Score =   176 bits (445),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 135/158 (85%), Gaps = 10/158 (6%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRA--------  475
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSST+LLSPPSSPRA        
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSTSLLSPPSSPRAISCVQPGV  325

Query  474  GGGKPLLPLDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGK  301
            G  KPLLP DK ++ E+ +K +A  ++YSY FFH+IFSLASMYSAMLLTGWSTS+GESGK
Sbjct  326  GSEKPLLPFDKVEQQEDRKKDEAKLISYSYPFFHLIFSLASMYSAMLLTGWSTSIGESGK  385

Query  300  LVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LVDVGW SVWVR+VTGW TAAL++WSL+AP+LFPDR+F
Sbjct  386  LVDVGWPSVWVRIVTGWATAALYIWSLIAPMLFPDREF  423


 Score = 61.6 bits (148),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVISLYCTYLCYS L+SEPR
Sbjct  231  VVALHPKVNGSLLPASVISLYCTYLCYSGLSSEPR  265



>ref|XP_004954190.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=413

 Score =   176 bits (447),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTT+LSVVYSAVRAGSS T+LSPP SPR G  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTILSVVYSAVRAGSSATVLSPPDSPR-GTDKPLLP  324

Query  450  LDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE E+ +   + VTYSYSFFH+IFSLASMYSAMLLTGWSTS+GESGKLVDVGW SV
Sbjct  325  FSKADEQEDKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSIGESGKLVDVGWPSV  384

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  385  WVRIATQWATAGLFIWSLVAPILFPDREF  413


 Score = 60.8 bits (146),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP V GS+ PASVI LYCTYLCYS L+SEPR
Sbjct  231  IVALHPKVNGSLLPASVIGLYCTYLCYSGLSSEPR  265



>ref|XP_002454688.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
 gb|EES07664.1| hypothetical protein SORBIDRAFT_04g035670 [Sorghum bicolor]
Length=413

 Score =   177 bits (448),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSS T+LSPP SPR G  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSATVLSPPDSPR-GTDKPLLP  324

Query  450  LDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE E+ +   + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  325  FSKADEQEDKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  384

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA LF+WSLVAPILFPDR+F
Sbjct  385  WVRIATQWATAGLFIWSLVAPILFPDREF  413


 Score = 60.5 bits (145),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI LYCTYLCYS L+SEPR
Sbjct  231  IVALHPKINGSLLPASVIGLYCTYLCYSGLSSEPR  265



>ref|XP_010929191.1| PREDICTED: probable serine incorporator isoform X2 [Elaeis guineensis]
Length=415

 Score =   175 bits (444),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSST+LLSPPSSPRA   KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSTSLLSPPSSPRASSEKPLLP  325

Query  450  LDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             DK ++ E+ +K +A  ++YSY FFH+IFSLASMYSAMLLTGWSTS+GESGKLVDVGW S
Sbjct  326  FDKVEQQEDRKKDEAKLISYSYPFFHLIFSLASMYSAMLLTGWSTSIGESGKLVDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+VTGW TAAL++WSL+AP+LFPDR+F
Sbjct  386  VWVRIVTGWATAALYIWSLIAPMLFPDREF  415


 Score = 61.6 bits (148),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVISLYCTYLCYS L+SEPR
Sbjct  231  VVALHPKVNGSLLPASVISLYCTYLCYSGLSSEPR  265



>ref|XP_010914044.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=415

 Score =   178 bits (451),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HS++VSTG+ TLGLLTTVLSV+YSAVRAGSSTT+LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHNHSEAVSTGSLTLGLLTTVLSVIYSAVRAGSSTTVLSPPSSPRAGAEKPLLP  325

Query  450  LDKADEHEEM--EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D  ++ E+   +++K V+YSYSFF++IFSLASMY+AMLLTGWSTSVGESGKLVDVGW+S
Sbjct  326  FDTVEQQEDRKNDEAKPVSYSYSFFYLIFSLASMYAAMLLTGWSTSVGESGKLVDVGWSS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+VT W TAAL++WSL+APILFPDR+F
Sbjct  386  VWVRIVTQWATAALYIWSLIAPILFPDREF  415


 Score = 58.9 bits (141),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASV+SLYC YLCYS L+SEPR
Sbjct  231  VVALHPKVNGSLLPASVLSLYCAYLCYSGLSSEPR  265



>ref|XP_010063622.1| PREDICTED: probable serine incorporator isoform X1 [Eucalyptus 
grandis]
Length=414

 Score =   175 bits (444),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTGT TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRA  GKPLLP
Sbjct  266  DYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSSTTLLSPPSSPRAAAGKPLLP  325

Query  450  LDKADEHEEMEKSK-AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD   E EE ++    VTYSYSFFHIIFSLASMYSAM+LTGWSTSVGESG+LVDVGW SV
Sbjct  326  LDNKAEEEEEKEKSKTVTYSYSFFHIIFSLASMYSAMILTGWSTSVGESGRLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  386  WVRIVTGWATAALYIWSLAAPILFPEREF  414


 Score = 61.2 bits (147),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GSI PA+VISLYC YLCYS LASEPR
Sbjct  231  VVALHPAVNGSILPAAVISLYCMYLCYSGLASEPR  265



>ref|XP_009759116.1| PREDICTED: probable serine incorporator isoform X2 [Nicotiana 
sylvestris]
Length=411

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  699  SQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRA  520
            S L LY CT   ++   L     DYECN LHKHSK+VS+G+  LGLLTTVLSVVYSAVRA
Sbjct  246  SVLSLY-CTYLCYSA--LASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRA  302

Query  519  GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAML  340
            GSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYSAML
Sbjct  303  GSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYSAML  360

Query  339  LTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFPDR+F
Sbjct  361  LTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPDREF  411


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>gb|ACL54492.1| unknown [Zea mays]
Length=413

 Score =   176 bits (446),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSS T+LSPP SPR G  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSATVLSPPDSPR-GTDKPLLP  324

Query  450  LDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE E+ +   + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  325  FSKADEQEDKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  384

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  385  WVRIATQWATAGLFIWSLVAPVLFPDREF  413


 Score = 59.7 bits (143),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI +YCTYLCYS L+SEPR
Sbjct  231  IVALHPKINGSLLPASVIGMYCTYLCYSGLSSEPR  265



>ref|XP_010532058.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
 ref|XP_010532059.1| PREDICTED: serine incorporator 3 [Tarenaya hassleriana]
Length=414

 Score =   177 bits (449),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKH+K+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHAKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGSEKPLLP  325

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA+E E+ EKSK VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESG+LVDVGW SV
Sbjct  326  LDGKAEEKEDKEKSKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGRLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+VTGW TAAL++WSLVAPILFPDR+F
Sbjct  386  WVRIVTGWATAALYIWSLVAPILFPDREF  414


 Score = 58.9 bits (141),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS+YC YLCYS LASEPR
Sbjct  234  LHPTVGGSILPASVISMYCMYLCYSGLASEPR  265



>ref|NP_001130490.1| hypothetical protein precursor [Zea mays]
 gb|ACF78724.1| unknown [Zea mays]
 gb|ACN28943.1| unknown [Zea mays]
 gb|AFW73836.1| hypothetical protein ZEAMMB73_916907 [Zea mays]
Length=413

 Score =   176 bits (446),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTG+ TLGLLTTVLSVVYSAVRAGSS T+LSPP SPR G  KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGSLTLGLLTTVLSVVYSAVRAGSSATVLSPPDSPR-GTDKPLLP  324

Query  450  LDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              KADE E+ +   + VTYSYSFFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  325  FSKADEQEDKKDVPRPVTYSYSFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  384

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  385  WVRIATQWATAGLFIWSLVAPVLFPDREF  413


 Score = 59.7 bits (143),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP + GS+ PASVI +YCTYLCYS L+SEPR
Sbjct  231  IVALHPKINGSLLPASVIGMYCTYLCYSGLSSEPR  265



>ref|XP_002297693.2| TMS membrane family protein [Populus trichocarpa]
 gb|EEE82498.2| TMS membrane family protein [Populus trichocarpa]
Length=414

 Score =   176 bits (446),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 134/149 (90%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LH+HSK+VST T T+GLLTTVLSVVYSAVRAGSSTTLLSPPSSP AG  KPLLP
Sbjct  266  EYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSSTTLLSPPSSPHAGADKPLLP  325

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD K  E EE EK+K VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  326  LDNKPSEKEEKEKAKPVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  386  WVRILTGWATAGLYIWSLVAPILFPDREF  414


 Score = 59.3 bits (142),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I  LHP+V GS+ PASVISLYC YLCYS L+SEPR
Sbjct  231  IAALHPAVNGSVLPASVISLYCMYLCYSGLSSEPR  265



>ref|XP_009615681.1| PREDICTED: probable serine incorporator isoform X3 [Nicotiana 
tomentosiformis]
Length=411

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 145/171 (85%), Gaps = 5/171 (3%)
 Frame = -1

Query  699  SQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRA  520
            S L LY CT   ++   L     DYECN LHKHSK+VS+G+  LGLLTTVLSVVYSAVRA
Sbjct  246  SVLSLY-CTYLCYSA--LASEPRDYECNGLHKHSKAVSSGSLALGLLTTVLSVVYSAVRA  302

Query  519  GssttllsppssPRAGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAML  340
            GSSTTLLSPPSSPRAG  KPLLPLDK DE EE E++K VTYSYSFFH+IFSLASMYSAML
Sbjct  303  GSSTTLLSPPSSPRAG--KPLLPLDKVDEEEEKERAKPVTYSYSFFHLIFSLASMYSAML  360

Query  339  LTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LTGWSTSVGESGKLVDVGW SVWVR+VTGW TAALF+WS VAPILFP+R+F
Sbjct  361  LTGWSTSVGESGKLVDVGWPSVWVRIVTGWATAALFIWSQVAPILFPEREF  411


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +VTLHPSV GSI PASV+SLYCTYLCYSALASEPR
Sbjct  231  VVTLHPSVGGSILPASVLSLYCTYLCYSALASEPR  265



>ref|XP_011034606.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034607.1| PREDICTED: probable serine incorporator [Populus euphratica]
 ref|XP_011034608.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=414

 Score =   176 bits (447),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LH+HSK+VST T T+GLLTTVLSVVYSAVRAGSS TLLSPPSSPRAG  KPLLP
Sbjct  266  EYECNGLHRHSKAVSTSTLTIGLLTTVLSVVYSAVRAGSSNTLLSPPSSPRAGADKPLLP  325

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD K  E EE EK+K VTYSYSFFHIIFSLASMYSAMLLTGWS SVGESGKLVDVGW SV
Sbjct  326  LDNKPSEKEEKEKAKPVTYSYSFFHIIFSLASMYSAMLLTGWSASVGESGKLVDVGWPSV  385

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR++TGW TA L++WSLVAPILFPDR+F
Sbjct  386  WVRILTGWATAGLYIWSLVAPILFPDREF  414


 Score = 58.2 bits (139),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GS+ PASVISLYC YLCYS L+SEPR
Sbjct  234  LHPAVNGSVLPASVISLYCMYLCYSGLSSEPR  265



>ref|XP_010459155.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   175 bits (443),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRA   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KADE EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKADEKEEKECKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDREF  412


 Score = 59.3 bits (142),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_010497691.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497697.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497701.1| PREDICTED: probable serine incorporator [Camelina sativa]
 ref|XP_010497705.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=412

 Score =   174 bits (442),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRA   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KADE EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKADEKEEKECKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSL+APILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLIAPILFPDREF  412


 Score = 59.3 bits (142),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_010246591.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=409

 Score =   169 bits (428),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK+V TGT  LGLLTTV+SVVYSAVRAGSST+L S  +  R G  K L+P
Sbjct  261  DYECNGLHQHSKTVPTGTIILGLLTTVVSVVYSAVRAGSSTSLFSESTLSRVGEEKHLIP  320

Query  450  LDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            L+K DE EE E  S+  TYSY+FFH+IFSLASMYSAMLLTGWSTSVGE GKLVDVGW SV
Sbjct  321  LNKTDEEEEEEDESRPATYSYAFFHVIFSLASMYSAMLLTGWSTSVGEIGKLVDVGWPSV  380

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+VTGW TAA+++WSLVAP+LFPDR+F
Sbjct  381  WVRIVTGWATAAVYIWSLVAPLLFPDREF  409


 Score = 64.3 bits (155),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSIFPAS ISL+CTYLCYS LASEPR
Sbjct  226  IVALHPAVGGSIFPASAISLFCTYLCYSGLASEPR  260



>ref|XP_010268463.1| PREDICTED: serine incorporator 3-like [Nelumbo nucifera]
Length=414

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = -1

Query  699  SQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRA  520
            S + LY CT   F+   L     DYECN  H+H+K+VSTGT TLGL TTVLSVVYSAVRA
Sbjct  246  SVISLY-CTYLCFSG--LASEPRDYECNGFHRHTKAVSTGTLTLGLFTTVLSVVYSAVRA  302

Query  519  GssttllsppssPRAGGGKPLLPLDK-ADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  343
            GSSTTLL  P SPR G  KPLLP++K ADE E+ ++++ VTYSY+FFH+IFSLASMYSAM
Sbjct  303  GSSTTLLLEPDSPRGGADKPLLPMNKTADEDEKKDEARPVTYSYAFFHVIFSLASMYSAM  362

Query  342  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            LLTGWSTSVGESG LVDVGW SVWVR+VTGWVTAAL++WSLVAP+LFP+R+F
Sbjct  363  LLTGWSTSVGESGNLVDVGWPSVWVRIVTGWVTAALYIWSLVAPLLFPEREF  414


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYCTYLC+S LASEPR
Sbjct  231  IVALHPAVGGSILPASVISLYCTYLCFSGLASEPR  265



>ref|XP_006845424.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
 gb|ERN07099.1| hypothetical protein AMTR_s00019p00091080 [Amborella trichopoda]
Length=415

 Score =   172 bits (435),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLL 
Sbjct  266  DYECNGLHHHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGSEKPLLS  325

Query  450  LDKADEHEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             DK ++ E+ +K  +K V+YSYSFFH+IFSLASMYSAMLLTGWS+SVGESG+LVDVGW S
Sbjct  326  FDKLEKQEDKKKHEAKPVSYSYSFFHLIFSLASMYSAMLLTGWSSSVGESGQLVDVGWPS  385

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR++T W TA LF+WSL+AP LFP+R+F
Sbjct  386  VWVRIITQWATAGLFVWSLIAPHLFPEREF  415


 Score = 60.1 bits (144),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  733  VTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            + LHP V GS+ PASVIS+YCTYLCYSAL+SEPR
Sbjct  232  IALHPKVNGSLLPASVISVYCTYLCYSALSSEPR  265



>ref|XP_003532291.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN07179.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   166 bits (419),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT TLGL TTVLSVVYSAVRAGSS  +LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTLTLGLATTVLSVVYSAVRAGSSAAVLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD  ++ E+ +    VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  LDAKEDEEKEKAKP-VTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  382

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++T W TA L+LWSLVAPI+FP+R+F
Sbjct  383  VRIITSWATALLYLWSLVAPIMFPEREF  410


 Score = 65.5 bits (158),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVISLYCTYLCYSALASEPR
Sbjct  231  IVALHPAVNGSVLPASVISLYCTYLCYSALASEPR  265



>ref|XP_010476724.1| PREDICTED: serine incorporator 3 [Camelina sativa]
Length=412

 Score =   172 bits (435),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SP A   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPPAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KADE EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKADEKEEKECKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDREF  412


 Score = 59.3 bits (142),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_010063623.1| PREDICTED: probable serine incorporator isoform X2 [Eucalyptus 
grandis]
 gb|KCW70852.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=412

 Score =   170 bits (430),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTGT TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSK-AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD   E EE ++    VTYSYSFFHIIFSLASMYSAM+LTGWSTSVGESG+LVDVGW SV
Sbjct  324  LDNKAEEEEEKEKSKTVTYSYSFFHIIFSLASMYSAMILTGWSTSVGESGRLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  384  WVRIVTGWATAALYIWSLAAPILFPEREF  412


 Score = 61.2 bits (147),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GSI PA+VISLYC YLCYS LASEPR
Sbjct  231  VVALHPAVNGSILPAAVISLYCMYLCYSGLASEPR  265



>gb|KCW70853.1| hypothetical protein EUGRSUZ_F03990 [Eucalyptus grandis]
Length=316

 Score =   170 bits (430),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTGT TLGL+TTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  170  DYECNGLHAHSKAVSTGTLTLGLVTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  227

Query  450  LDKADEHEEMEKSK-AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD   E EE ++    VTYSYSFFHIIFSLASMYSAM+LTGWSTSVGESG+LVDVGW SV
Sbjct  228  LDNKAEEEEEKEKSKTVTYSYSFFHIIFSLASMYSAMILTGWSTSVGESGRLVDVGWPSV  287

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  288  WVRIVTGWATAALYIWSLAAPILFPEREF  316


 Score = 61.2 bits (147),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP+V GSI PA+VISLYC YLCYS LASEPR
Sbjct  135  VVALHPAVNGSILPAAVISLYCMYLCYSGLASEPR  169



>ref|XP_003552131.1| PREDICTED: probable serine incorporator-like [Glycine max]
 gb|KHN15373.1| Putative serine incorporator [Glycine soja]
Length=410

 Score =   165 bits (418),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 132/148 (89%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT TLGL TTVLSVVYSAVRAGSS  +LSPPSSPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTITLGLATTVLSVVYSAVRAGSSAAVLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            LD  ++ EE EK+K VTYSY+FFH+IFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVW
Sbjct  324  LDAKED-EEKEKAKPVTYSYAFFHLIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVW  382

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR++T W TA L+LWSL+API+FP+R+F
Sbjct  383  VRIITSWATALLYLWSLIAPIMFPEREF  410


 Score = 65.5 bits (158),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVISLYCTYLCYSALASEPR
Sbjct  231  IVALHPAVNGSVLPASVISLYCTYLCYSALASEPR  265



>emb|CDY52849.1| BnaA09g56410D [Brassica napus]
Length=400

 Score =   172 bits (436),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLS P SPRAG  KPLLP
Sbjct  253  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSSPDSPRAGE-KPLLP  311

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA++ EE E+ K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  312  LDGKAEDKEEKEQKKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  371

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  372  WVRVVTSWATAGLFIWSLVAPILFPDREF  400


 Score = 58.2 bits (139),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS+YC YLCYS LASEPR
Sbjct  221  LHPAVGGSILPASVISVYCMYLCYSGLASEPR  252



>ref|XP_009117776.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
 ref|XP_009117777.1| PREDICTED: serine incorporator 3 isoform X2 [Brassica rapa]
Length=413

 Score =   172 bits (436),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 134/149 (90%), Gaps = 2/149 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLS P SPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSSPDSPRAGE-KPLLP  324

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA++ EE E+ K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  325  LDGKAEDKEEKEQKKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  384

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  385  WVRVVTSWATAGLFIWSLVAPILFPDREF  413


 Score = 58.2 bits (139),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS+YC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISVYCMYLCYSGLASEPR  265



>emb|CDX81752.1| BnaC08g38490D [Brassica napus]
Length=412

 Score =   171 bits (434),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLS P SPRA   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSSPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA+E EE E+ K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDRDF
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDRDF  412


 Score = 58.2 bits (139),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS YC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPR  265



>emb|CDY70974.1| BnaAnng35710D [Brassica napus]
Length=412

 Score =   171 bits (432),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAG--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA+E EE E+ K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WS+VAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSVVAPILFPDREF  412


 Score = 58.2 bits (139),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS YC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPR  265



>ref|XP_009110458.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
 ref|XP_009110459.1| PREDICTED: serine incorporator 3-like [Brassica rapa]
Length=412

 Score =   171 bits (432),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAG--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA+E EE E+ K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WS+VAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSVVAPILFPDREF  412


 Score = 58.2 bits (139),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS YC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPR  265



>ref|XP_002512768.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF49271.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=413

 Score =   168 bits (426),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 133/150 (89%), Gaps = 4/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKHSK+VSTGT ++GLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG  KPLLP
Sbjct  266  EYECNGLHKHSKAVSTGTLSIGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG--KPLLP  323

Query  450  LDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
            L+     E  EK KA  VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW S
Sbjct  324  LENKIAEEHEEKEKAKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPS  383

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR++TGW TA L++WSL+APILFPDR+F
Sbjct  384  VWVRIITGWATAGLYVWSLLAPILFPDREF  413


 Score = 60.1 bits (144),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS YC YLCYS LASEPR
Sbjct  231  IVALHPAVSGSILPASVISAYCMYLCYSGLASEPR  265



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   170 bits (430),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 134/148 (91%), Gaps = 3/148 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRAG  KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAG--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA+E EE E+ K VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  LDGKAEEKEEKEQKKPVTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRD  190
            WVRVVT W TA LF+WSL+APILFPDR+
Sbjct  384  WVRVVTSWATAGLFIWSLIAPILFPDRE  411


 Score = 57.8 bits (138),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS YC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPR  265



>ref|NP_173069.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 ref|NP_001185008.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAF18512.1|AC010924_25 Contains similarity to gb|AF181686 membrane protein TMS1d from 
Drosophila melanogaster. ESTs gb|R64994, gb|AI994832, gb|Z47674 
come from this gene [Arabidopsis thaliana]
 gb|AEE29416.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEE29417.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=412

 Score =   165 bits (418),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH HSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRA   KPLLP
Sbjct  266  DYECNGLHNHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            +D KA+E EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  IDGKAEEKEEKENKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDREF  412


 Score = 62.4 bits (150),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  231  IVVLHPTVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_002890152.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66411.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   167 bits (423),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 133/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRA   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            +D KA+E EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SV
Sbjct  324  IDGKAEEKEEKENKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDREF  412


 Score = 59.3 bits (142),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVISLYC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_006416842.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 ref|XP_006416843.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35195.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
 gb|ESQ35196.1| hypothetical protein EUTSA_v10007762mg [Eutrema salsugineum]
Length=412

 Score =   166 bits (420),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 132/149 (89%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT T+GLLTTVLSVVYSAVRAGSSTTLLSPP SPRA   KPLLP
Sbjct  266  DYECNGLHKHSKAVSTGTMTIGLLTTVLSVVYSAVRAGSSTTLLSPPDSPRAE--KPLLP  323

Query  450  LD-KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
            LD KA+E EE E  K V+YSY+FFHIIFSLASMYSAMLLTGWSTSVGESG LVDVGW SV
Sbjct  324  LDGKAEEKEEKENKKPVSYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGNLVDVGWPSV  383

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  384  WVRVVTSWATAGLFIWSLVAPILFPDREF  412


 Score = 58.2 bits (139),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  727  LHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            LHP+V GSI PASVIS YC YLCYS LASEPR
Sbjct  234  LHPAVGGSILPASVISFYCMYLCYSGLASEPR  265



>gb|ABR17762.1| unknown [Picea sitchensis]
 gb|ABR17907.1| unknown [Picea sitchensis]
Length=417

 Score =   161 bits (407),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH H K+VST T  LG++TTVLSVVYSAVRAGSST LLSPPSSPRAG GKPLL 
Sbjct  266  DYECNGLHGHVKAVSTSTLLLGMITTVLSVVYSAVRAGSSTALLSPPSSPRAGSGKPLLS  325

Query  450  LDKADE-HEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
             D+ +E H+  +K   + VTYSYSFFH+IF+LASMYSAMLLTGW++S  +  KL+ VGW 
Sbjct  326  FDEIEEGHKNTQKDEERPVTYSYSFFHVIFALASMYSAMLLTGWTSSTADGEKLIGVGWH  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +VWVR+ T W+TAAL++WSLVAP+LFPDR+F
Sbjct  386  TVWVRICTEWITAALYIWSLVAPLLFPDREF  416


 Score = 60.5 bits (145),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVIS+YCTYLCYS L+SEPR
Sbjct  231  VVALHPKVNGSLLPASVISVYCTYLCYSGLSSEPR  265



>ref|XP_006850791.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
 gb|ERN12372.1| hypothetical protein AMTR_s00025p00104130 [Amborella trichopoda]
Length=339

 Score =   152 bits (385),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 126/150 (84%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT  +G++TTVLSVVYSAVRAGSSTT LSPPSSP+AG  KPLL 
Sbjct  190  DYECNGLHKHSKAVSTGTLIMGMITTVLSVVYSAVRAGSSTTFLSPPSSPKAGEKKPLLE  249

Query  450  LDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D  DE E+ ++++A  V+YSY+FFH+IF+LASMYSAMLLTGW TS+ +S  L+DVGW S
Sbjct  250  SDNLDEVEKNKQNEARPVSYSYTFFHLIFALASMYSAMLLTGW-TSLSDSEDLIDVGWTS  308

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++WSLVAP++  DR+F
Sbjct  309  VWVRMCTEWVTAGLYVWSLVAPLILSDREF  338


 Score = 62.0 bits (149),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP V GS+FPASVIS+YC YLCY+ L+SEPR
Sbjct  155  IVALHPKVNGSLFPASVISMYCAYLCYTGLSSEPR  189



>ref|NP_001130812.1| uncharacterized protein LOC100191916 [Zea mays]
 gb|ACF79174.1| unknown [Zea mays]
 gb|ACF82535.1| unknown [Zea mays]
 gb|ACF85768.1| unknown [Zea mays]
 gb|ACG39558.1| serine incorporator 3 [Zea mays]
 tpg|DAA49275.1| TPA: Serine incorporator 3 isoform 1 [Zea mays]
 tpg|DAA49276.1| TPA: Serine incorporator 3 isoform 2 [Zea mays]
Length=415

 Score =   153 bits (387),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  266  DYECNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG  325

Query  450  LDKADEHEEMEKS--KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+ D   + ++S  + V+YSY+FFH+IF+LASMYSAMLLTGW+++  ES +L+DVGW +
Sbjct  326  -DEEDGKGDGKESEPRPVSYSYTFFHLIFALASMYSAMLLTGWTSAASESSELMDVGWTT  384

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  385  VWVRICTEWVTAGLYIWTLIAPLLFPDRDF  414


 Score = 55.5 bits (132),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  231  IVALHPQVHGSVMPASVISVYCAYLCYTSLSSEP  264



>ref|XP_002466928.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
 gb|EER93926.1| hypothetical protein SORBIDRAFT_01g016840 [Sorghum bicolor]
Length=415

 Score =   152 bits (385),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 123/150 (82%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK VS G   LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  266  DYECNGLHRHSKQVSLGALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG  325

Query  450  LDKADEHEEMEKS--KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+ D   + ++S  + V+YSY+FFH+IF+LASMYSAMLLTGW+++  E  +L+DVGW +
Sbjct  326  -DEEDGKGDGKESEPRPVSYSYTFFHLIFALASMYSAMLLTGWTSAASERSELMDVGWTT  384

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTAAL++W+L+AP+LFPDRDF
Sbjct  385  VWVRICTEWVTAALYIWTLIAPLLFPDRDF  414


 Score = 55.8 bits (133),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  231  IVALHPQVNGSVMPASVISVYCAYLCYTSLSSEP  264



>ref|XP_008673654.1| PREDICTED: uncharacterized protein LOC100191916 isoform X1 [Zea 
mays]
Length=339

 Score =   153 bits (386),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  190  DYECNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG  249

Query  450  LDKADEHEEMEKS--KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+ D   + ++S  + V+YSY+FFH+IF+LASMYSAMLLTGW+++  ES +L+DVGW +
Sbjct  250  -DEEDGKGDGKESEPRPVSYSYTFFHLIFALASMYSAMLLTGWTSAASESSELMDVGWTT  308

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  309  VWVRICTEWVTAGLYIWTLIAPLLFPDRDF  338


 Score = 55.5 bits (132),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  155  IVALHPQVHGSVMPASVISVYCAYLCYTSLSSEP  188



>ref|XP_004982576.1| PREDICTED: probable serine incorporator-like [Setaria italica]
Length=415

 Score =   148 bits (374),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLPL  448
            YECN LH HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL  
Sbjct  267  YECNGLHMHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLGD  326

Query  447  DKADEHEEME-KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            ++  +  + + + + V+YSY+FFH+IF+LASMYSAMLLTGW+++  E  +L+DVGW +VW
Sbjct  327  EETGKGVDKDTEPRPVSYSYTFFHLIFALASMYSAMLLTGWTSAASEKSELMDVGWTTVW  386

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T WVTAAL++W+L+AP+LFPDRDF
Sbjct  387  VRICTEWVTAALYIWTLIAPLLFPDRDF  414


 Score = 60.1 bits (144),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            IV LHP V GSI PASVIS+YC YLCYS+L+SEP G
Sbjct  231  IVALHPQVNGSIMPASVISVYCAYLCYSSLSSEPDG  266



>tpg|DAA49274.1| TPA: hypothetical protein ZEAMMB73_017777 [Zea mays]
Length=359

 Score =   153 bits (386),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LH+HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  210  DYECNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGAKNPLLG  269

Query  450  LDKADEHEEMEKS--KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+ D   + ++S  + V+YSY+FFH+IF+LASMYSAMLLTGW+++  ES +L+DVGW +
Sbjct  270  -DEEDGKGDGKESEPRPVSYSYTFFHLIFALASMYSAMLLTGWTSAASESSELMDVGWTT  328

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++W+L+AP+LFPDRDF
Sbjct  329  VWVRICTEWVTAGLYIWTLIAPLLFPDRDF  358


 Score = 55.5 bits (132),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  175  IVALHPQVHGSVMPASVISVYCAYLCYTSLSSEP  208



>ref|NP_001050476.1| Os03g0454100 [Oryza sativa Japonica Group]
 gb|AAO73245.1| putative membrane protein [Oryza sativa Japonica Group]
 gb|ABF97019.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12390.1| Os03g0454100 [Oryza sativa Japonica Group]
 dbj|BAG90227.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75563.1| hypothetical protein OsI_12232 [Oryza sativa Indica Group]
 gb|EEE59340.1| hypothetical protein OsJ_11423 [Oryza sativa Japonica Group]
Length=417

 Score =   151 bits (382),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH+HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  266  DYACNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGIKNPLLG  325

Query  450  LDKADEHEEMEK---SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
             D  +  +   K   ++ V+YSY+FFH+IF+LASMYSAMLLTGW+++  +S +L+DVGW 
Sbjct  326  DDNVEAGKSNSKEIDARPVSYSYTFFHVIFALASMYSAMLLTGWTSAASDSSELMDVGWT  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  386  TVWVRICTEWATAALYIWTLVAPLLFPDRDF  416


 Score = 55.5 bits (132),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  231  IIALHPQVNGSVMPASVISVYCAYLCYTSLSSEP  264



>gb|ABR16232.1| unknown [Picea sitchensis]
Length=407

 Score =   149 bits (377),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH H+ +VSTGT  LG+LTTVLSV+YSAVRAGSSTT LSPP+SPR G  KPLL 
Sbjct  257  DYGCNGLHNHTAAVSTGTLILGMLTTVLSVIYSAVRAGSSTTFLSPPTSPRTGSEKPLLE  316

Query  450  LDKADEHEEMEKS---KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
                +E ++ EK    + VTYSY+FFH+IF+LASMYSAMLLTGW++S  +S +LVDVGW 
Sbjct  317  SKDVEEGQKDEKKDEGRPVTYSYTFFHLIFALASMYSAMLLTGWTSSTKDSEELVDVGWP  376

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T W+TA L++W+L+API FPDR+F
Sbjct  377  SVWVRICTEWITAGLYVWTLLAPIFFPDREF  407


 Score = 55.5 bits (132),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC YLCY  L+SEPR
Sbjct  222  VIALHPQVSGSLLPASVISVYCAYLCYCGLSSEPR  256



>ref|XP_010546829.1| PREDICTED: serine incorporator 3 isoform X1 [Tarenaya hassleriana]
Length=410

 Score =   147 bits (372),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 118/150 (79%), Gaps = 4/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            DYECN LH  SK+V+T T  LG+LTTVLSV+YSAVRAGSSTT LSPPSSPRA G  PLL 
Sbjct  262  DYECNGLHNKSKAVTTSTLILGMLTTVLSVIYSAVRAGSSTTFLSPPSSPRAAGATPLLE  321

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             P D   +  E E  + V+YSYSFFH+IF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  322  DPEDGKKKSNETEP-RPVSYSYSFFHVIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ TGWVTA L++W+LVAP + PDR+F
Sbjct  380  VWVRICTGWVTAGLYIWTLVAPFVLPDREF  409


 Score = 56.2 bits (134),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  227  VIALHPAVNGSLLPASVISVYCVYVCYTGLSSEPR  261



>ref|XP_006650244.1| PREDICTED: probable serine incorporator-like [Oryza brachyantha]
Length=417

 Score =   148 bits (374),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH+HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  266  DYACNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGTKNPLLG  325

Query  450  LDKADEHEEMEK---SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
             D  +      K   ++ V+YSY+FFH+IF+LASMYSAMLLTGW+++  +S +L+DVGW 
Sbjct  326  DDNVEAGNGNGKELDARPVSYSYTFFHLIFALASMYSAMLLTGWTSAASDSSELMDVGWT  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +VWVR+ T W TA L++W+LVAP+LFPDRDF
Sbjct  386  TVWVRICTEWATAGLYIWTLVAPLLFPDRDF  416


 Score = 55.1 bits (131),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP V GS+ PAS+IS+YC YLCY++L+SEP
Sbjct  231  IIALHPQVNGSVMPASIISVYCAYLCYTSLSSEP  264



>ref|XP_010237604.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
 ref|XP_010237605.1| PREDICTED: probable serine incorporator [Brachypodium distachyon]
Length=418

 Score =   147 bits (370),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH HSK VS G   LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  266  DYACNGLHMHSKQVSVGALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGTKNPLLG  325

Query  450  LDKADEHEEMEKS----KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
                +E +  + +    + V+YSY+FFH+IF+LASMYSAMLLTGW+++  ESG+L+DVGW
Sbjct  326  DANVEEGKGEDTTGSEPRPVSYSYTFFHLIFALASMYSAMLLTGWTSAGSESGELMDVGW  385

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             +VWVR+   W TAAL++W+LVAP+LFPDRDF
Sbjct  386  TTVWVRICMEWATAALYIWTLVAPLLFPDRDF  417


 Score = 56.2 bits (134),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP V GS+ PASVIS+YC YLCYS+L+SEP
Sbjct  231  IIALHPQVNGSVMPASVISVYCAYLCYSSLSSEP  264



>ref|XP_008458551.1| PREDICTED: serine incorporator 3 [Cucumis melo]
Length=411

 Score =   147 bits (371),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 120/151 (79%), Gaps = 4/151 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+VS GT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG KPLL 
Sbjct  261  DYVCNGLHTKSKAVSVGTLVLGMLTTVLSVIYSALRAGSSTTFLSPPSSPRAGGSKPLLE  320

Query  450  ---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
               L+     +   + + V+YSY+FFH+IF+LASMYSAMLL+GW TS+ ES  L+DVGW 
Sbjct  321  SEDLEDGKNKKTEGEGQPVSYSYTFFHLIFALASMYSAMLLSGW-TSLNESSDLIDVGWT  379

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  380  SVWVRICTEWVTAGLYIWSLVAPLLFPDREF  410


 Score = 56.2 bits (134),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  226  VIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPR  260



>dbj|BAJ86142.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99044.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   146 bits (368),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  266  DYACNGLHMHSKQVSMSALVLGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGARNPLLG  325

Query  450  LDKADE---HEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
                +E     E  ++  V+YSY+FFH+IF+LASMYSAMLLTGW+++  +  +L+DVGW 
Sbjct  326  DANVEEGKGSSEGSEAHPVSYSYTFFHLIFALASMYSAMLLTGWTSATSDRSELMDVGWT  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  386  TVWVRICTEWSTAALYIWTLVAPLLFPDRDF  416


 Score = 55.5 bits (132),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  231  IIALHPQVNGSVMPASVISVYCAYLCYTSLSSEP  264



>gb|EYU43840.1| hypothetical protein MIMGU_mgv1a006662mg [Erythranthe guttata]
Length=436

 Score =   144 bits (363),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK VST T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG KPLL 
Sbjct  287  DYVCNGLHNKSKVVSTSTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGGKKPLLE  346

Query  450  LDKAD--EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+ +  + +   ++K VTYSY FFH+IF+LASMYSAMLL+GW TS  E+ +L+DVGW S
Sbjct  347  GDELESGKGKNETENKPVTYSYMFFHLIFALASMYSAMLLSGW-TSDSENPQLIDVGWTS  405

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++WSL+AP++ PDR+F
Sbjct  406  VWVRICTEWVTAGLYVWSLIAPLILPDREF  435


 Score = 57.0 bits (136),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  252  IIALHPKVNGSLLPASVISMYCAYVCYTGLSSEPR  286



>ref|XP_008799134.1| PREDICTED: probable serine incorporator [Phoenix dactylifera]
Length=416

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LHKHSK VSTGT  LGLLTTV+SVVYSAVR GSST+ LSPPSSP++G  KPLL 
Sbjct  266  DYACNGLHKHSKQVSTGTLVLGLLTTVISVVYSAVRTGSSTSFLSPPSSPKSGSTKPLLE  325

Query  450  ---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
               L+   + ++  +++ V+YSY+FFH+IF+LASMYSAM+LTGW++S  +S +L+DVGW 
Sbjct  326  DGELESGKDDKKEGEARPVSYSYTFFHLIFALASMYSAMVLTGWTSSTSDSSELIDVGWT  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T W TAAL++W+LVAP++ PDR+F
Sbjct  386  SVWVRICTEWATAALYIWTLVAPLILPDREF  416


 Score = 58.5 bits (140),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVIS+YC YLCYS L+SEPR
Sbjct  231  VVALHPQVNGSLLPASVISVYCAYLCYSGLSSEPR  265



>ref|XP_004169518.1| PREDICTED: LOW QUALITY PROTEIN: serine incorporator 3-like [Cucumis 
sativus]
Length=411

 Score =   145 bits (365),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+VS GT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG KPLL 
Sbjct  261  DYVCNDLHTKSKAVSVGTLVLGMLTTVLSVIYSALRAGSSTTFLSPPSSPRAGGSKPLLE  320

Query  450  ---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
               L+     +   + + V+YSY+FFH+IF+LASMYSAMLL+GW TS+ ES  L+DVGW 
Sbjct  321  SEDLEDGKNKKTEGEGQPVSYSYTFFHLIFALASMYSAMLLSGW-TSLNESSDLIDVGWT  379

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVT  L++WSLVAP+LFPDR+F
Sbjct  380  SVWVRICTEWVTGGLYIWSLVAPLLFPDREF  410


 Score = 56.2 bits (134),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  226  VIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPR  260



>ref|XP_004150322.1| PREDICTED: serine incorporator 3-like [Cucumis sativus]
 gb|KGN47263.1| hypothetical protein Csa_6G238640 [Cucumis sativus]
Length=411

 Score =   145 bits (365),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+VS GT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG KPLL 
Sbjct  261  DYVCNDLHTKSKAVSVGTLVLGMLTTVLSVIYSALRAGSSTTFLSPPSSPRAGGSKPLLE  320

Query  450  ---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
               L+     +   + + V+YSY+FFH+IF+LASMYSAMLL+GW TS+ ES  L+DVGW 
Sbjct  321  SEDLEDGKNKKTEGEGQPVSYSYTFFHLIFALASMYSAMLLSGW-TSLNESSDLIDVGWT  379

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVT  L++WSLVAP+LFPDR+F
Sbjct  380  SVWVRICTEWVTGGLYIWSLVAPLLFPDREF  410


 Score = 56.2 bits (134),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  226  VIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPR  260



>ref|XP_011090806.1| PREDICTED: probable serine incorporator [Sesamum indicum]
Length=411

 Score =   144 bits (362),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+VST T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAG  KPLL 
Sbjct  262  DYVCNGLHNKSKAVSTSTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGDKKPLLE  321

Query  450  LDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+ +  +    ++A  V+YSY+FFH+IF+LASMYSAMLL+GW TS  E+ +L+D+GW S
Sbjct  322  SDELESGKGKNDAEARPVSYSYTFFHLIFALASMYSAMLLSGW-TSSSENPELIDIGWTS  380

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  381  VWVRICTEWVTAGLYIWSLIAPLLFPDREF  410


 Score = 57.0 bits (136),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC YLCY+ L+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYCAYLCYTGLSSEPR  261



>ref|XP_010546830.1| PREDICTED: serine incorporator 3 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   142 bits (359),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            DYECN LH  SK+V+T T  LG+LTTVLSV+YSAVRAGSSTT LSPPSSPRAG   PLL 
Sbjct  262  DYECNGLHNKSKAVTTSTLILGMLTTVLSVIYSAVRAGSSTTFLSPPSSPRAGA-TPLLE  320

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             P D   +  E E  + V+YSYSFFH+IF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  321  DPEDGKKKSNETEP-RPVSYSYSFFHVIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  378

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ TGWVTA L++W+LVAP + PDR+F
Sbjct  379  VWVRICTGWVTAGLYIWTLVAPFVLPDREF  408


 Score = 56.2 bits (134),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  227  VIALHPAVNGSLLPASVISVYCVYVCYTGLSSEPR  261



>ref|XP_010938752.1| PREDICTED: probable serine incorporator [Elaeis guineensis]
Length=416

 Score =   137 bits (346),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LHKHSK VSTGT  LGLLTTV+SVVYSAVR GSST+ LSPPSSP++G  KPLL 
Sbjct  266  DYACNGLHKHSKQVSTGTLVLGLLTTVISVVYSAVRTGSSTSFLSPPSSPKSGSSKPLLE  325

Query  450  ---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
               ++   + ++  +++ VTYSY+FFH+IF+LASMYSAMLLTGW++S  +S +L+DVGW 
Sbjct  326  EGEVESGKDDKKESEARPVTYSYTFFHLIFALASMYSAMLLTGWTSSTSDSSELIDVGWT  385

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T W TAAL++W+L+AP++ PDR+F
Sbjct  386  SVWVRICTEWATAALYIWTLIAPLVLPDREF  416


 Score = 58.9 bits (141),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +V LHP V GS+ PASVIS+YC YLCYS L+SEPR
Sbjct  231  VVALHPQVNGSLLPASVISVYCAYLCYSGLSSEPR  265



>ref|XP_009391591.1| PREDICTED: serine incorporator 3 [Musa acuminata subsp. malaccensis]
Length=417

 Score =   138 bits (347),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 5/152 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH H K VSTGT  LG+LTTVLSVVYSAVRAGSSTT LSPPSSP++G   PLL 
Sbjct  266  DYACNGLHNHVKQVSTGTLVLGMLTTVLSVVYSAVRAGSSTTFLSPPSSPKSGSRSPLLE  325

Query  450  LDKAD----EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
               A+    E +E E ++ V+YSY+FFH+IF+LASMYSAMLLTGWS S+ ES +L+DVGW
Sbjct  326  AGDAESGKPEKKENE-ARPVSYSYTFFHLIFALASMYSAMLLTGWSGSISESSELIDVGW  384

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             SVWVR+ T W TAAL++W+LVAP++ PDR+F
Sbjct  385  TSVWVRICTEWATAALYIWTLVAPLILPDREF  416


 Score = 58.2 bits (139),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP V GS+ P+SVIS+YC YLCYS L+SEPR
Sbjct  231  IVALHPQVNGSLLPSSVISIYCAYLCYSGLSSEPR  265



>ref|XP_002280143.1| PREDICTED: serine incorporator 3 [Vitis vinifera]
 emb|CBI26177.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   139 bits (349),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+VST T  LG+LTTVLSV+YSAVRAGSSTT LSPPSSP++GG KPLL 
Sbjct  262  DYACNGLHNKSKAVSTSTLILGMLTTVLSVLYSAVRAGSSTTFLSPPSSPKSGGKKPLLE  321

Query  450  LDKADE--HEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             +  +    ++ E++K V+YSY+FFH+IF+LASMYSAMLL+GW TS  +S  ++DVGW S
Sbjct  322  SEDTESGKEKKEEEAKPVSYSYTFFHLIFALASMYSAMLLSGW-TSSNDSSDMIDVGWTS  380

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++WSL+APILFPDR+F
Sbjct  381  VWVRICTEWVTALLYVWSLLAPILFPDREF  410


 Score = 56.6 bits (135),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVISLYC Y+CY+ L+SEPR
Sbjct  227  VIALHPRVNGSLLPASVISLYCAYVCYTGLSSEPR  261



>ref|XP_004296950.1| PREDICTED: probable serine incorporator [Fragaria vesca subsp. 
vesca]
Length=409

 Score =   141 bits (355),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH HS +VS GT  LG+ TT+LSV+YSA+RAGSSTT LSPPSSPRA   KPLL 
Sbjct  262  DYACNGLH-HSSAVSVGTLLLGMATTILSVLYSALRAGSSTTFLSPPSSPRAAEKKPLLE  320

Query  450  ---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
               L++  +  E E +K V+YSY+FFH+IF+LASMYSAMLL+GW+ S  ES  L+DVGW 
Sbjct  321  GKELEEGKDKNEKE-AKPVSYSYTFFHLIFALASMYSAMLLSGWTNS-AESSDLIDVGWT  378

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVTAAL++WSLVAP+LFPDR+F
Sbjct  379  SVWVRICTEWVTAALYVWSLVAPLLFPDREF  409


 Score = 53.9 bits (128),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+Y  Y+CY+AL+SEPR
Sbjct  227  VIALHPTVNGSLLPASVISVYSAYVCYTALSSEPR  261



>ref|XP_009365800.1| PREDICTED: probable serine incorporator isoform X2 [Pyrus x bretschneideri]
Length=409

 Score =   140 bits (353),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 119/150 (79%), Gaps = 6/150 (4%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL--  454
            Y CN LH HSK+VS  T  LG+ TTVLSV+YSA+RAGSST  LSPPSSPR     PLL  
Sbjct  263  YACNGLH-HSKAVSLSTLLLGMATTVLSVLYSALRAGSSTNFLSPPSSPRGAEKTPLLDG  321

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
              L++A E  + E +K V+YSY+FFH+IF+LASMYSAMLL+GW++S+ ES  L+DVGW S
Sbjct  322  KELEEAKEKNDKE-AKPVSYSYTFFHLIFALASMYSAMLLSGWTSSL-ESSDLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  380  VWVRICTEWVTAALYVWSLIAPILFPDREF  409


 Score = 53.1 bits (126),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            ++ L+P V GS+ PASVIS+Y  Y+CY+AL+SEPRG
Sbjct  227  VIALYPKVNGSLLPASVISVYSAYVCYTALSSEPRG  262



>ref|XP_009365799.1| PREDICTED: probable serine incorporator isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   139 bits (351),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 6/151 (4%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLPL  448
            Y CN LH HSK+VS  T  LG+ TTVLSV+YSA+RAGSST  LSPPSSPR G  +    L
Sbjct  263  YACNGLH-HSKAVSLSTLLLGMATTVLSVLYSALRAGSSTNFLSPPSSPRGGAAEKTPLL  321

Query  447  DKADEHEEMEK----SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
            D  +  E  EK    +K V+YSY+FFH+IF+LASMYSAMLL+GW++S+ ES  L+DVGW 
Sbjct  322  DGKELEEAKEKNDKEAKPVSYSYTFFHLIFALASMYSAMLLSGWTSSL-ESSDLIDVGWT  380

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  381  SVWVRICTEWVTAALYVWSLIAPILFPDREF  411


 Score = 53.1 bits (126),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            ++ L+P V GS+ PASVIS+Y  Y+CY+AL+SEPRG
Sbjct  227  VIALYPKVNGSLLPASVISVYSAYVCYTALSSEPRG  262



>dbj|BAK02293.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=186

 Score =   147 bits (371),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 3/151 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR+G   PLL 
Sbjct  35   DYACNGLHMHSKQVSMSALVLGMLTTVLSVVYSAVRAGSSTTFLSPPSSPRSGARNPLLG  94

Query  450  LDKADE---HEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
                +E     E  ++  V+YSY+FFH+IF+LASMYSAMLLTGW+++  +  +L+DVGW 
Sbjct  95   DANVEEGKGSSEGSEAHPVSYSYTFFHLIFALASMYSAMLLTGWTSATSDRSELMDVGWT  154

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +VWVR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  155  TVWVRICTEWSTAALYIWTLVAPLLFPDRDF  185


 Score = 45.1 bits (105),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  715  VKGSIFPASVISLYCTYLCYSALASEP  635
            V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  7    VNGSVMPASVISVYCAYLCYTSLSSEP  33



>ref|XP_009342179.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=411

 Score =   139 bits (351),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 121/152 (80%), Gaps = 8/152 (5%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGK--PLL  454
            Y CN LH HSK+VS  T  LG+ TTVLSV+YSA+RAGSST  LSPPSSPR G  +  PLL
Sbjct  263  YACNGLH-HSKAVSLSTLLLGMATTVLSVLYSALRAGSSTNFLSPPSSPRGGAAERTPLL  321

Query  453  ---PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
                L++A E  + E +K V+YSY+FFH+IF+LASMYSAMLL+GW++S+ ES  L+DVGW
Sbjct  322  DGKELEEAKEKNDKE-AKPVSYSYTFFHLIFALASMYSAMLLSGWTSSL-ESSDLIDVGW  379

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             SVWVR+ T WVTAAL++WSL+APILFPDR+F
Sbjct  380  TSVWVRICTEWVTAALYVWSLIAPILFPDREF  411


 Score = 53.1 bits (126),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            ++ L+P V GS+ PASVIS+Y  Y+CY+AL+SEPRG
Sbjct  227  VIALYPKVNGSLLPASVISVYSAYVCYTALSSEPRG  262



>emb|CDY05246.1| BnaC05g45570D [Brassica napus]
Length=408

 Score =   137 bits (345),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L++ SK+V+  T TLG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG + LL 
Sbjct  262  DYVCNGLNR-SKAVTASTLTLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGGKEALLE  320

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              +  +     +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW SVW
Sbjct  321  DPEDGKKNGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTSVW  379

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  380  VRICTGWVTAALYIWTLIAPLILPDREF  407


 Score = 54.7 bits (130),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  227  IVALHPAVNGSLLPASVISVYCAYICYTGLSSEP  260



>ref|XP_010693925.1| PREDICTED: serine incorporator 3 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   135 bits (340),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+V+T T  LG++TTVLSV+YSA+RAGSS   LSPPSSPRAG  K LL 
Sbjct  261  DYVCNGLHNKSKAVTTSTLVLGMITTVLSVLYSALRAGSSKAFLSPPSSPRAGATKSLLS  320

Query  450  LDKADEHEEMEKS--KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             +  +   + + S  + V+YSY FFH+IF+LASMYSAMLL+GW++S   S  L+D+GWAS
Sbjct  321  SEDTEAGRDKKDSEPRPVSYSYMFFHLIFALASMYSAMLLSGWTSSTDNS-DLIDIGWAS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ T WVTA L++WSLVAP+L PDR+F
Sbjct  380  VWVKICTEWVTAGLYVWSLVAPLLLPDREF  409


 Score = 55.8 bits (133),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  226  VIALHPKVNGSLLPASVISVYCAYVCYTGLSSEPR  260



>ref|XP_006419802.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
 ref|XP_006489289.1| PREDICTED: probable serine incorporator-like [Citrus sinensis]
 gb|ESR33042.1| hypothetical protein CICLE_v10005070mg [Citrus clementina]
Length=414

 Score =   138 bits (348),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP++ G KPLL 
Sbjct  264  DYVCNGLHNKSKAVTISTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPKSAGKKPLLE  323

Query  450  LDKADEHEEMEKS---KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
             +  +E  E +K    + V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW 
Sbjct  324  GEDVEEGTENKKDIEGRPVSYSYSFFHLIFALASMYSAMLLSGW-TSSSESSDLIDVGWT  382

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ + WVTA L++W+LVAP+LFPDR+F
Sbjct  383  SVWVRICSQWVTAGLYIWTLVAPLLFPDREF  413


 Score = 53.1 bits (126),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ L+PSV GS+ PASVIS+YC Y+CY+AL+SEP 
Sbjct  229  VIALNPSVNGSLLPASVISVYCAYVCYTALSSEPH  263



>gb|ACJ84561.1| unknown [Medicago truncatula]
 gb|AFK35204.1| unknown [Medicago truncatula]
 gb|KEH36756.1| TMS membrane protein/tumor differentially protein [Medicago truncatula]
Length=409

 Score =   132 bits (331),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLPL  448
            YECN L+K S++VSTGT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP+AG  KPLL  
Sbjct  263  YECNGLNK-SRAVSTGTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPKAGESKPLLEE  321

Query  447  DKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
             +  + ++ EK ++ V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW SVW
Sbjct  322  VEEGKSKKEEKEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSTSESSDLIDVGWTSVW  380

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T WVTA L+LWSL+AP+LFPDR+F
Sbjct  381  VRIGTEWVTAGLYLWSLLAPLLFPDREF  408


 Score = 59.7 bits (143),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            +V LHP V GS+ PASVISLYC Y+CY+ L+SEPRG
Sbjct  227  VVALHPKVNGSLLPASVISLYCAYVCYTGLSSEPRG  262



>emb|CDO98987.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   135 bits (339),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +Y CN LHK S++VST T  LGLLTT++SV+YSA+RAGSSTT LSPPSSPR+GG KPLL 
Sbjct  262  NYVCNGLHKASRAVSTSTLILGLLTTIISVLYSALRAGSSTTFLSPPSSPRSGGQKPLLE  321

Query  450  LDK--ADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D+  A + ++  + + V+YSYSFF +IF+LASMYSAMLL+GW TS  ES  L+DVGW S
Sbjct  322  SDELEAGKDKKDAEPRPVSYSYSFFLLIFALASMYSAMLLSGW-TSSSESSDLIDVGWTS  380

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++WSLVAP++FPDR+F
Sbjct  381  VWVRMCTEWVTAGLYVWSLVAPLIFPDREF  410


 Score = 56.2 bits (134),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  227  VIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPR  261



>ref|XP_006356686.1| PREDICTED: serine incorporator 3-like [Solanum tuberosum]
Length=409

 Score =   134 bits (336),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+V+T T  LG+LTTVLSV+YSA+RAGS+TT +SPPSSPR+G  K LL 
Sbjct  262  DYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLYSALRAGSATTFMSPPSSPRSGEKKSLLA  321

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
             ++ +  +   +++ V+YSY+FFH+IF+LASMYSAMLL+GW TS  ES +L+DVGW S+W
Sbjct  322  SEELESGKGSPEARPVSYSYTFFHLIFALASMYSAMLLSGW-TSSSESSELIDVGWTSLW  380

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T WVTA L++WSLVAP+ FPDR+F
Sbjct  381  VRICTEWVTAGLYVWSLVAPLFFPDREF  408


 Score = 56.6 bits (135),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC Y+CYS L+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYCAYVCYSGLSSEPR  261



>emb|CDY24707.1| BnaA05g31060D [Brassica napus]
Length=408

 Score =   135 bits (341),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L++ SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG + LL 
Sbjct  262  DYVCNGLNR-SKAVTASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGGKEALLE  320

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              +  +     +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW SVW
Sbjct  321  DPEDGKKNGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTSVW  379

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            V++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  380  VKICTGWVTAALYIWTLIAPLILPDREF  407


 Score = 54.3 bits (129),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  227  IVALHPAVNGSLLPASVISVYCAYVCYTGLSSEP  260



>ref|XP_010486107.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   135 bits (339),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG + LL 
Sbjct  263  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGGREALLE  321

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             P D   +  E E ++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  322  DPEDGKKKGGEAE-ARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  380  VWVKICTGWVTAVLYIWTLIAPLILPDREF  409


 Score = 53.9 bits (128),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  228  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEP  261



>ref|XP_009129653.1| PREDICTED: probable serine incorporator [Brassica rapa]
Length=408

 Score =   134 bits (337),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L++ SK+V+  T TLG+LTTVLSV+YSA+RAGSSTT LSPPSSPRAGG + LL 
Sbjct  262  DYVCNGLNR-SKAVTASTLTLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGGKEALLE  320

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              +  +     +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW SVW
Sbjct  321  DPEDGKKNGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTSVW  379

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            V++ TGW TAAL++W+L+AP++ PDR+F
Sbjct  380  VKICTGWATAALYIWTLIAPLILPDREF  407


 Score = 54.3 bits (129),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  227  IVALHPAVNGSLLPASVISVYCAYVCYTGLSSEP  260



>ref|XP_010464184.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=409

 Score =   135 bits (339),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+GG + LL 
Sbjct  263  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGGKEALLE  321

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              +  +     +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW SVW
Sbjct  322  DPEDGKKGSEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTSVW  380

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            V++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  381  VKICTGWVTAALYIWTLIAPLILPDREF  408


 Score = 53.9 bits (128),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  228  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPH  262



>gb|KHN37564.1| Putative serine incorporator [Glycine soja]
Length=407

 Score =   135 bits (340),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN L+K S++VSTGT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR GG KPLL 
Sbjct  260  DYECNGLNK-SRAVSTGTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRLGGSKPLLE  318

Query  450  LDKADEHEEMEKS-KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              +  + ++ EK  + V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW SV
Sbjct  319  EAEEGKAKKEEKEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSTSESSDLIDVGWTSV  377

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  378  WVRIGTEWVTAGLYIWSLLAPLLFPDREF  406


 Score = 53.1 bits (126),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP V GS+ PA+V+SLYC Y+CY+ L+SEP
Sbjct  225  IIALHPQVNGSLLPAAVVSLYCAYVCYTGLSSEP  258



>ref|XP_010436570.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=410

 Score =   134 bits (336),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+GG + LL 
Sbjct  263  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGGREALLE  321

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             P D   +  E E ++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  322  DPEDGKKKGGEAE-ARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  380  VWVKICTGWVTAVLYIWTLIAPLILPDREF  409


 Score = 53.9 bits (128),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  228  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEP  261



>ref|XP_006297798.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
 gb|EOA30696.1| hypothetical protein CARUB_v10013833mg [Capsella rubella]
Length=410

 Score =   133 bits (335),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+GG + LL 
Sbjct  263  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGGREALLE  321

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             P D   +  E E ++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  322  DPEDGKKKGGEAE-ARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  380  VWVKICTGWVTAGLYIWTLIAPLILPDREF  409


 Score = 53.9 bits (128),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  228  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPH  262



>gb|KDO74827.1| hypothetical protein CISIN_1g039061mg [Citrus sinensis]
Length=399

 Score =   134 bits (337),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP++ G K LL 
Sbjct  249  DYVCNGLHNKSKAVTISTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPKSAGKKLLLE  308

Query  450  LDKADEHEEMEKS---KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
             +  +E  E +K    + V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW 
Sbjct  309  GEDVEEGTENKKDIEGRPVSYSYSFFHLIFALASMYSAMLLSGW-TSSSESSDLIDVGWT  367

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ + WVTA L++W+LVAP+LFPDR+F
Sbjct  368  SVWVRICSQWVTAGLYIWTLVAPLLFPDREF  398


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ L+PSV GS+ PASVIS+YC Y+CY+AL+SEP 
Sbjct  214  VIALNPSVNGSLLPASVISVYCAYVCYTALSSEPH  248



>ref|XP_009799680.1| PREDICTED: probable serine incorporator [Nicotiana sylvestris]
Length=408

 Score =   131 bits (330),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L+K SK+V+T T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+G  K LL 
Sbjct  262  DYVCNGLNK-SKAVTTSTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGEKKSLLA  320

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
             ++ +  +   +++ V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW S+W
Sbjct  321  SEELESGKGSAEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSSSESSDLIDVGWTSLW  379

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T WVTA L++WSLVAP+LFPDR+F
Sbjct  380  VRICTEWVTAGLYIWSLVAPLLFPDREF  407


 Score = 55.8 bits (133),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYCAYVCYTGLSSEPR  261



>ref|XP_007147778.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
 gb|ESW19772.1| hypothetical protein PHAVU_006G154400g [Phaseolus vulgaris]
Length=409

 Score =   128 bits (321),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN L+K S++VST T  LG+LTTVLSV+YSA+RAGSS T LSPPSSP+ G  KPLL 
Sbjct  262  DYECNGLNK-SRAVSTSTLVLGMLTTVLSVLYSALRAGSSKTFLSPPSSPKLGESKPLLE  320

Query  450  LDKADEHEEMEKS-KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              +  + ++ EK  + V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW SV
Sbjct  321  EAEEGKAKKEEKEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSTYESSDLIDVGWTSV  379

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T WVTA L++WSL AP+ FPDR+F
Sbjct  380  WVRIGTEWVTAVLYIWSLTAPLFFPDREF  408


 Score = 57.0 bits (136),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASV+SLYC Y+CY+ L+SEPR
Sbjct  227  IIALHPTVNGSLLPASVMSLYCAYVCYTGLSSEPR  261



>gb|KJB28193.1| hypothetical protein B456_005G040500 [Gossypium raimondii]
Length=410

 Score =   129 bits (323),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  + +VS  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP+AG  KPLL 
Sbjct  261  DYVCNGLHNKASAVSLSTLILGMLTTVLSVIYSALRAGSSTTFLSPPSSPKAGTKKPLLE  320

Query  450  LDKADEHEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D  +E +E ++  ++ V+YSYSFFH+IF+LASMYSAMLL+GW TS  +S  LVDVGW S
Sbjct  321  GDDVEEGKETKEKEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSSSDSSDLVDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTAAL++W+LVAP++ PDR+F
Sbjct  380  VWVRICTEWVTAALYVWTLVAPLIIPDREF  409


 Score = 56.2 bits (134),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  226  VIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPR  260



>ref|XP_010322266.1| PREDICTED: serine incorporator 3 [Solanum lycopersicum]
Length=411

 Score =   128 bits (321),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRA--GGGKPL  457
            DY CN LH  SK+V+T T  LG+LTTVLSV+YSA+RAGS+TT +SPPSSPR+  G  K L
Sbjct  262  DYVCNGLHNKSKAVTTSTLVLGMLTTVLSVLYSALRAGSATTFMSPPSSPRSVVGEKKSL  321

Query  456  LPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
            L  ++ +  +   +++ V+YSY+FFH+IF+LASMYSAMLL+GW TS  ES +L+DVGW S
Sbjct  322  LASEELESGKGSPEARPVSYSYTFFHLIFALASMYSAMLLSGW-TSSSESSELIDVGWTS  380

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +WVR+ T WVTA L++WSLVAP+L PDR+F
Sbjct  381  LWVRICTEWVTAGLYVWSLVAPLLLPDREF  410


 Score = 56.6 bits (135),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC Y+CYS L+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYCAYVCYSGLSSEPR  261



>ref|XP_002882452.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58711.1| TMS membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   130 bits (328),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+G    LL 
Sbjct  263  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGVKDSLLE  321

Query  453  -PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             P D   +  E E ++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  322  DPEDGKKKSGEAE-ARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESATLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  380  VWVKICTGWVTAVLYIWTLIAPLILPDREF  409


 Score = 53.9 bits (128),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  228  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEP  261



>ref|XP_001765634.1| predicted protein [Physcomitrella patens]
 gb|EDQ69473.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   123 bits (309),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 110/154 (71%), Gaps = 11/154 (7%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLL-  454
            +YECN LHKH  +VS GT  LG+LTT+LSVVYSAVRAGSSTT LSPP+SPR G    LL 
Sbjct  266  NYECNGLHKHVNAVSKGTLGLGMLTTLLSVVYSAVRAGSSTTFLSPPNSPREGN---LLF  322

Query  453  -----PLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDV  289
                 P+ +   H +  + + VTY YSFFH+IF+LASMYSAMLLTGW  +      ++DV
Sbjct  323  DDDDKPIRRGGRHSK--EPRPVTYVYSFFHLIFALASMYSAMLLTGWGNANMAEKDIIDV  380

Query  288  GWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            GW S WVR  T  +TA L++WSLVAP LFPDRDF
Sbjct  381  GWPSFWVRFSTEMITAGLYIWSLVAPQLFPDRDF  414


 Score = 59.7 bits (143),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV+LHP V GS+ PA VI+ YCTYLCYSAL+SEPR
Sbjct  231  IVSLHPQVNGSLLPAGVIAAYCTYLCYSALSSEPR  265



>ref|NP_187268.2| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAZ23918.1| At3g06170 [Arabidopsis thaliana]
 gb|AEE74356.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score =   129 bits (324),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+G    LL 
Sbjct  263  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGVKDALLG  321

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              +  +     +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW SVW
Sbjct  322  DPEDGKKSGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESATLIDVGWTSVW  380

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            V++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  381  VKICTGWVTAGLYIWTLIAPLILPDREF  408


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  228  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPH  262



>gb|AAF30310.1|AC018907_10 hypothetical protein [Arabidopsis thaliana]
Length=315

 Score =   129 bits (323),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L+K SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+G    LL 
Sbjct  169  DYVCNGLNK-SKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGVKDALLG  227

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
              +  +     +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW SVW
Sbjct  228  DPEDGKKSGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESATLIDVGWTSVW  286

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            V++ TGWVTA L++W+L+AP++ PDR+F
Sbjct  287  VKICTGWVTAGLYIWTLIAPLILPDREF  314


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  134  IIALHPAVNGSLLPASVISVYCAYVCYTGLSSEPH  168



>ref|XP_004486156.1| PREDICTED: probable serine incorporator-like [Cicer arietinum]
Length=409

 Score =   123 bits (308),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 123/148 (83%), Gaps = 3/148 (2%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLPL  448
            YECN L+K S++V+TGT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP+AG  KPLL  
Sbjct  263  YECNGLNK-SRAVNTGTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPKAGESKPLLEE  321

Query  447  DKADEHEEME-KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
             +  + ++ E +++ V+YSYSFFH+IF+LA+MYSAMLL+GW TS  ES  L+DVGW SVW
Sbjct  322  MEEGKTKKEEKQARPVSYSYSFFHLIFALATMYSAMLLSGW-TSSSESSDLIDVGWTSVW  380

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T WVTA L+LW+L+AP++FPDR+F
Sbjct  381  VRIGTEWVTAGLYLWTLLAPLMFPDREF  408


 Score = 59.7 bits (143),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            +V LHP V GS+ PASVISLYC Y+CY+ L+SEPRG
Sbjct  227  VVALHPKVNGSLLPASVISLYCAYVCYTGLSSEPRG  262



>ref|XP_009117775.1| PREDICTED: wall-associated receptor kinase-like 5 isoform X1 
[Brassica rapa]
Length=796

 Score =   149 bits (376),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 66/73 (90%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  405  VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLW  226
            VTYSY+FFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+W
Sbjct  724  VTYSYAFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIW  783

Query  225  SLVAPILFPDRDF  187
            SLVAPILFPDR+F
Sbjct  784  SLVAPILFPDREF  796



>ref|XP_010255869.1| PREDICTED: probable serine incorporator [Nelumbo nucifera]
Length=416

 Score =   125 bits (315),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LHK+SK+VSTGT  LG+LTTVLSV+YSAVRAGSSTT LSPPSSP++GG +PLL 
Sbjct  263  DYICNGLHKNSKAVSTGTLILGMLTTVLSVLYSAVRAGSSTTFLSPPSSPKSGGKQPLLE  322

Query  450  LDKADEHEEMEK-----SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVG  286
             D+ +  +E ++     ++ V+Y+Y+FFH+IF+LASMYSAMLLTGW++S   S  L+DVG
Sbjct  323  SDELEAGKEKKEKKETEAQPVSYNYTFFHLIFALASMYSAMLLTGWTSSTSGSSDLIDVG  382

Query  285  WASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            W SVWVR+ T WVTAAL++W+LVA ++FPDR+F
Sbjct  383  WTSVWVRICTEWVTAALYVWTLVASLIFPDREF  415


 Score = 57.0 bits (136),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC YLCY+ L+SEPR
Sbjct  228  VIALHPKVNGSLLPASVISVYCAYLCYTGLSSEPR  262



>ref|XP_009623079.1| PREDICTED: probable serine incorporator [Nicotiana tomentosiformis]
Length=408

 Score =   126 bits (317),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L+K SK+V+T T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+G  K LL 
Sbjct  262  DYVCNGLNK-SKAVTTSTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGEKKSLLA  320

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
             ++ +  +   + + V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW S+W
Sbjct  321  SEELESGKGSTEPRPVSYSYSFFHLIFALASMYSAMLLSGW-TSSSESSDLIDVGWTSLW  379

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T  VTA L++WSLVAP+LFPDR+F
Sbjct  380  VRICTELVTAGLYIWSLVAPLLFPDREF  407


 Score = 55.8 bits (133),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+YC Y+CY+ L+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYCAYVCYTGLSSEPR  261



>ref|XP_006595390.1| PREDICTED: probable serine incorporator-like [Glycine max]
Length=375

 Score =   135 bits (341),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN L+K S++VSTGT  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR GG KPLL 
Sbjct  228  DYECNGLNK-SRAVSTGTLVLGMLTTVLSVLYSALRAGSSTTFLSPPSSPRLGGSKPLLE  286

Query  450  LDKADEHEEMEKS-KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
              +  + ++ EK  + V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW SV
Sbjct  287  EAEEGKAKKEEKEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSTSESSDLIDVGWTSV  345

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ T WVTA L++WSL+AP+LFPDR+F
Sbjct  346  WVRIGTEWVTAGLYIWSLLAPLLFPDREF  374


 Score = 46.6 bits (109),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ +   V GS+ PA+V+SLYC Y+CY+ L+SEP
Sbjct  193  IIGVQKQVNGSLLPAAVVSLYCAYVCYTGLSSEP  226



>ref|XP_008390818.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=411

 Score =   128 bits (321),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 6/151 (4%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLPL  448
            Y CN LH HSK+VS  T  LG+  TVLSV+YSA+RAGSST  LSPPSSPR G  +     
Sbjct  263  YACNGLH-HSKAVSLSTLLLGMAMTVLSVLYSALRAGSSTNFLSPPSSPRGGAAEKTPLF  321

Query  447  DKADEHEEMEKS----KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
            D  +  E  EK+    K V YSY+FFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW 
Sbjct  322  DGKELEEGKEKNDKEVKPVXYSYTFFHLIFALASMYSAMLLSGW-TSSSESSDLIDVGWT  380

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVTAAL++WSL+APIL PDR+F
Sbjct  381  SVWVRICTEWVTAALYVWSLIAPILIPDREF  411


 Score = 53.1 bits (126),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            ++ LHP V GS+ PASVIS+Y  Y+CY+AL+SEP G
Sbjct  227  VIALHPKVNGSLLPASVISVYSAYVCYTALSSEPHG  262



>ref|XP_008340909.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=409

 Score =   129 bits (323),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 4/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH HSK+VS  T  LG+ TTVLSV+YSA+RAGSSTT LSPP+SPR     PLL 
Sbjct  262  DYACNGLH-HSKAVSVSTLLLGMATTVLSVLYSALRAGSSTTFLSPPTSPRGAEKTPLLD  320

Query  450  --LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
                +  + +E +++K V+YSY+FFH+IF+LASMYSAMLL+GW+ S  ES  L+DVGW S
Sbjct  321  GKKLEEGKEKEDKEAKPVSYSYTFFHLIFALASMYSAMLLSGWTDS-SESSDLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTAAL++WSL+AP+LFPDR+F
Sbjct  380  VWVRICTEWVTAALYVWSLLAPLLFPDREF  409


 Score = 52.0 bits (123),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+Y  Y+C++AL+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYSAYVCFTALSSEPR  261



>emb|CAN71158.1| hypothetical protein VITISV_036762 [Vitis vinifera]
Length=309

 Score =   124 bits (310),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 18/153 (12%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  SK+VST T  LG+LTTVLSV+YSAVRAGSSTT L            P  P
Sbjct  169  DYACNGLHNKSKAVSTSTLILGMLTTVLSVLYSAVRAGSSTTFL----------SPPSSP  218

Query  450  LDKADEHEE-----MEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVG  286
              K+++ E       E++K V+YSY+FFH+IF+LASMYSAMLL+GW++S  +S  ++DVG
Sbjct  219  --KSEDTESGKEKKEEEAKPVSYSYTFFHLIFALASMYSAMLLSGWTSS-NDSSDMIDVG  275

Query  285  WASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            W SVWVR+ T WVTA L++WSL+APILFPDR+F
Sbjct  276  WTSVWVRICTEWVTALLYVWSLLAPILFPDREF  308


 Score = 57.0 bits (136),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVISLYC Y+CY+ L+SEPR
Sbjct  134  VIALHPRVNGSLLPASVISLYCAYVCYTGLSSEPR  168



>ref|XP_007034589.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
 gb|EOY05515.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Theobroma cacao]
Length=410

 Score =   124 bits (312),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH  S +VST T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP++GG KPLL 
Sbjct  261  DYVCNGLHNKSSAVSTSTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPKSGGKKPLLE  320

Query  450  LDKADEHEEMEK--SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             +  +E +E ++  ++ V+YSYSFFH+IF+LASMYSAMLL+GW TS  ES  LVDVGW S
Sbjct  321  GEDVEEGKEKKEKEARPVSYSYSFFHLIFALASMYSAMLLSGW-TSSSESSVLVDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTAAL++W+LVAP +  DR+F
Sbjct  380  VWVRICTEWVTAALYVWTLVAPTILHDREF  409


 Score = 55.8 bits (133),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVIS+YC Y+C++ L+SEPR
Sbjct  226  IIALHPAVNGSLLPASVISIYCAYVCFTGLSSEPR  260



>ref|XP_010103434.1| putative serine incorporator [Morus notabilis]
 gb|EXB95837.1| putative serine incorporator [Morus notabilis]
Length=409

 Score =   125 bits (314),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 123/149 (83%), Gaps = 3/149 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY+CN L+K SK+VS  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSP++G  KPLL 
Sbjct  262  DYKCNGLNK-SKAVSLSTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPKSGAKKPLLE  320

Query  450  LDKADEHEEMEK-SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASV  274
             +  +  E+ EK ++ V+YSYSFFH+IF+LASMY+AMLL+GW+ S  ES  L+D+GW +V
Sbjct  321  EELEEGKEKKEKETRPVSYSYSFFHLIFALASMYAAMLLSGWTNS-SESSDLIDIGWTTV  379

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            WVR+ TGWVTAALF+WS+VAP+ FPDR+F
Sbjct  380  WVRICTGWVTAALFVWSIVAPLFFPDREF  408


 Score = 55.1 bits (131),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVISLYC Y+CY+ L+SEP 
Sbjct  227  IIALHPAVNGSLLPASVISLYCAYVCYTGLSSEPH  261



>ref|XP_008223013.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=411

 Score =   130 bits (328),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 6/152 (4%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGG--KPL  457
            DY CN LH HSK+VS  T  LG++TTVLSV+YSA+RAGSSTT LSPPSSPRAG    KPL
Sbjct  262  DYACNGLH-HSKAVSVSTLLLGMVTTVLSVLYSALRAGSSTTFLSPPSSPRAGAAEKKPL  320

Query  456  LP--LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
            L     +  +  + +++K V+YSY+FFH+IF+LASMYSAMLL+GW+ S  ES  L+DVGW
Sbjct  321  LDGKELEEGKETKEKEAKPVSYSYTFFHLIFALASMYSAMLLSGWTNS-SESSDLIDVGW  379

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             SVWVR+ T WVTA L++WSLVAP LFPDR+F
Sbjct  380  TSVWVRICTEWVTAGLYVWSLVAPFLFPDREF  411


 Score = 49.7 bits (117),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP V GS+ PASVIS+Y  Y+ Y+AL+SEPR
Sbjct  227  VIALHPKVNGSLLPASVISVYSAYVLYTALSSEPR  261



>ref|XP_011010290.1| PREDICTED: probable serine incorporator [Populus euphratica]
Length=417

 Score =   125 bits (313),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 5/152 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKP---  460
            DY CN LH  SK+VST T  LG+LTTVLSV+YSAVRAGSSTT LSPPSSP+A  GK    
Sbjct  266  DYACNGLHNKSKAVSTSTLVLGMLTTVLSVLYSAVRAGSSTTFLSPPSSPKASAGKKPLL  325

Query  459  -LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
                L++  E ++  + + V+YSY+FFH+IF+LASMYSAMLL+GW T   ES  L+DVGW
Sbjct  326  EAEELEEGKEKKKEAEGQPVSYSYTFFHLIFALASMYSAMLLSGW-TDTSESSSLIDVGW  384

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             SVWVR+ T W+T  L++W+L+AP+ FPDR+F
Sbjct  385  TSVWVRICTEWITGLLYIWTLLAPLFFPDREF  416


 Score = 53.5 bits (127),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  231  VIALHPAVNGSLLPASVISIYCAYVCYTGLSSEPH  265



>ref|XP_007222705.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
 gb|EMJ23904.1| hypothetical protein PRUPE_ppa006444mg [Prunus persica]
Length=411

 Score =   125 bits (314),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 6/151 (4%)
 Frame = -1

Query  627  YECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGG--KPLL  454
            Y CN LH HSK+VS  T  LG+ TTVLSV+YSA+RAGSSTT LSPPSSPRAG    KPLL
Sbjct  263  YACNGLH-HSKAVSVSTLLLGMATTVLSVLYSALRAGSSTTFLSPPSSPRAGAAEKKPLL  321

Query  453  P--LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWA  280
                 +  +  + +++K V+YSY+FFH+IF+LASMYSAMLL+GW+ S  ES  L+DVGW 
Sbjct  322  DGKELEEGKETKEKEAKPVSYSYTFFHLIFALASMYSAMLLSGWTDS-SESSDLIDVGWT  380

Query  279  SVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            SVWVR+ T WVTA L++WSLVAP L PDR+F
Sbjct  381  SVWVRICTEWVTAGLYVWSLVAPFLLPDREF  411


 Score = 52.4 bits (124),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            ++ LHP V GS+ PASVIS+Y  Y+ Y+AL+SEPRG
Sbjct  227  VIALHPQVNGSLLPASVISVYSAYVLYTALSSEPRG  262



>gb|KDP40096.1| hypothetical protein JCGZ_02094 [Jatropha curcas]
Length=401

 Score =   123 bits (309),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LHK +K+VST T  LG+LTTVLSV+YSAVRAGSSTT LSPPSSP+A   K  L 
Sbjct  252  DYACNGLHKSTKAVSTSTLVLGVLTTVLSVLYSAVRAGSSTTFLSPPSSPKASDAKKPLL  311

Query  450  LDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             ++ +E +E ++ +A  V+YSY+FFH+IF+LASMYSAMLL+GW+ S  E+  L+DVGW S
Sbjct  312  EEQLEEGKEKKEKEAKPVSYSYTFFHLIFALASMYSAMLLSGWTNS-SENSDLIDVGWIS  370

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++W+LVAP++ PDR+F
Sbjct  371  VWVRICTEWVTAGLYVWTLVAPVILPDREF  400


 Score = 54.3 bits (129),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  217  IIALHPTVNGSLLPASVISVYCAYVCYTGLSSEP  250



>gb|AFK47365.1| unknown [Lotus japonicus]
Length=234

 Score =   120 bits (301),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN L+K SK+V+T T  LG++TTVLSV+YSA+RAGSSTT LSPPS PR+G    L  
Sbjct  88   NYECNGLNK-SKAVTTSTLVLGMVTTVLSVLYSALRAGSSTTFLSPPSLPRSGSKPLLEE  146

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +++    +E +++K V+YSYSFFH IF+LASMYSAMLL+GW TS  +S  L+DVGW SVW
Sbjct  147  VEEGKTKKEEKEAKPVSYSYSFFHQIFALASMYSAMLLSGW-TSTSDSSDLIDVGWTSVW  205

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T WVTA L+ W+L+AP+  PDR+F
Sbjct  206  VRIGTEWVTAGLYAWTLLAPVFLPDREF  233


 Score = 57.0 bits (136),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPRG  629
            I+ LHP V GS+ PA+VISLYC YLCY+ L+SEPR 
Sbjct  53   IIALHPRVNGSLLPAAVISLYCAYLCYTGLSSEPRN  88



>ref|XP_002312742.1| TMS membrane family protein [Populus trichocarpa]
 gb|EEE90109.1| TMS membrane family protein [Populus trichocarpa]
Length=417

 Score =   124 bits (310),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 114/152 (75%), Gaps = 5/152 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKP---  460
            DY CN LH  SK+VST T  LG+LTT+LSV+YSAVRAGSSTT LSPPSSP+A  GK    
Sbjct  266  DYACNGLHNKSKAVSTSTLVLGMLTTILSVLYSAVRAGSSTTFLSPPSSPKASAGKKPLL  325

Query  459  -LLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
                L++  E ++  + + V+YSY+FFH+IF+LASMYSAMLL+GW T   ES  L+DVGW
Sbjct  326  EAEELEEGKEKKKEAEGQPVSYSYTFFHLIFALASMYSAMLLSGW-TDTSESSSLIDVGW  384

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             SVWVR+ T W+T  L+ W+L+AP+ FPDR+F
Sbjct  385  TSVWVRICTEWITGLLYTWTLLAPLFFPDREF  416


 Score = 53.5 bits (127),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            ++ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  231  VIALHPAVNGSLLPASVISIYCAYVCYTGLSSEPH  265



>ref|XP_006407970.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49423.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=406

 Score =   122 bits (305),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 119/150 (79%), Gaps = 8/150 (5%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L++ SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+   + LL 
Sbjct  262  DYVCNGLNR-SKAVTASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRS---EALLE  317

Query  450  LDKADEHEEME--KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D  D  ++    +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  318  -DPEDGKKKSGGGEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  375

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  376  VWVKLCTGWVTAALYIWTLIAPLILPDREF  405


 Score = 54.3 bits (129),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            IV LHP+V GS+ PASVIS+YC Y+CY+ L+SEP
Sbjct  227  IVALHPAVNGSLLPASVISVYCAYVCYTGLSSEP  260



>gb|EPS68630.1| hypothetical protein M569_06136 [Genlisea aurea]
Length=410

 Score =   123 bits (309),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 110/150 (73%), Gaps = 4/150 (3%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L+K SK+V+  T  +G+LTTV SV+YSA RAGSSTT LSPPSSPRA G   LL 
Sbjct  262  DYVCNGLNK-SKAVTISTLVVGMLTTVFSVLYSAFRAGSSTTFLSPPSSPRAAGKLSLLL  320

Query  450  LDKADEHEEMEKSKA--VTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
                D      +S+   V YSYSFFH+IF+LA+MYSAMLL+GW TS  E+  L+DVGW S
Sbjct  321  GGDGDVESGKGESEGEPVRYSYSFFHLIFALATMYSAMLLSGW-TSNSENPDLIDVGWTS  379

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T W TA L++WSLVAP+L PDRDF
Sbjct  380  VWVRIGTEWATAGLYVWSLVAPVLLPDRDF  409


 Score = 52.4 bits (124),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  724  HPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            HP V GS+ PASV+S+YC Y+CY+ L+SEPR
Sbjct  231  HPQVNGSLLPASVVSIYCAYVCYTGLSSEPR  261



>ref|XP_006407969.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
 gb|ESQ49422.1| hypothetical protein EUTSA_v10020853mg [Eutrema salsugineum]
Length=313

 Score =   121 bits (303),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 117/150 (78%), Gaps = 8/150 (5%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN L++ SK+V+  T  LG+LTTVLSV+YSA+RAGSSTT LSPPSSPR+      L 
Sbjct  169  DYVCNGLNR-SKAVTASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSEA----LL  223

Query  450  LDKADEHEEME--KSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
             D  D  ++    +++ V+YSYSFFHIIF+LASMY+AMLL+GW+ S  ES  L+DVGW S
Sbjct  224  EDPEDGKKKSGGGEARPVSYSYSFFHIIFALASMYAAMLLSGWTDS-SESASLIDVGWTS  282

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV++ TGWVTAAL++W+L+AP++ PDR+F
Sbjct  283  VWVKLCTGWVTAALYIWTLIAPLILPDREF  312


 Score = 54.7 bits (130),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  134  IVALHPAVNGSLLPASVISVYCAYVCYTGLSSEPH  168



>ref|XP_002516786.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
 gb|EEF45400.1| Membrane protein PB1A10.07c, putative [Ricinus communis]
Length=414

 Score =   120 bits (301),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKP--L  457
            DY CN LH  +K+VST T  LG+LTT+LSV+YSAVRAGSSTT LSPPSSP+A   K   L
Sbjct  265  DYVCNGLHNKTKAVSTSTLILGMLTTILSVLYSAVRAGSSTTFLSPPSSPKASDAKKPLL  324

Query  456  LPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
                +  + ++  +++ V+YSY+FFH+IF+LASMYSAMLL+GW TS  ES  L+DVGW S
Sbjct  325  EEQLEEGKEKKETEARPVSYSYTFFHLIFALASMYSAMLLSGW-TSSSESSDLIDVGWTS  383

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWVR+ T WVTA L++W+L+AP+LFPDR+F
Sbjct  384  VWVRICTEWVTAGLYVWTLLAPLLFPDREF  413


 Score = 54.3 bits (129),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            I+ LHP+V GS+ PASVIS+YC Y+CY+ L+SEP 
Sbjct  230  IIALHPTVNGSLLPASVISIYCAYVCYTGLSSEPH  264



>ref|XP_010024424.1| PREDICTED: serine incorporator 3 [Eucalyptus grandis]
 gb|KCW60868.1| hypothetical protein EUGRSUZ_H03603 [Eucalyptus grandis]
Length=416

 Score =   120 bits (300),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 9/156 (6%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +Y CN LH  S +VST T  LG+LTTVLSV+YSA RAGSSTT LSPPSSP++G  KPLL 
Sbjct  261  NYVCNGLHNKSHAVSTSTLILGMLTTVLSVLYSACRAGSSTTFLSPPSSPKSGAKKPLLD  320

Query  450  LDKADEHEEM--------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLV  295
             D  +E ++          + + VTYSYSFFH+IF+LASMYSAMLL+   TS  +S  LV
Sbjct  321  GDDVEEGKDKKDKKDKKEAEPQPVTYSYSFFHLIFALASMYSAMLLSD-WTSSSDSSDLV  379

Query  294  DVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            DVGW SVWVR+ T WVT+AL++W+LVAP++ PDR+F
Sbjct  380  DVGWTSVWVRIATEWVTSALYIWTLVAPLILPDREF  415


 Score = 51.6 bits (122),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASV+S+Y  Y+CY+AL+ EPR
Sbjct  226  IVALHPAVNGSLLPASVVSVYGAYVCYTALSCEPR  260



>gb|KJB67012.1| hypothetical protein B456_010G170100 [Gossypium raimondii]
Length=374

 Score =   104 bits (260),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK++STGT T+GLLTT+LSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP
Sbjct  266  DYECNGLHKHSKAISTGTVTVGLLTTILSVVYSAVRAGSSTTLLSPPSSPRAGGGKPLLP  325

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  298
            LDKADE EE EK+KAVTYSY+FFHIIFSL S+    LL  +S+  G S  L
Sbjct  326  LDKADE-EEKEKNKAVTYSYAFFHIIFSLLSICGLSLLL-FSSQTGTSKSL  374


 Score = 59.3 bits (142),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V  SI PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVGSSILPASVISLYCMYLCYSGLASEPR  265



>ref|XP_002979274.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
 gb|EFJ19682.1| hypothetical protein SELMODRAFT_110336 [Selaginella moellendorffii]
Length=376

 Score = 94.4 bits (233),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 91/148 (61%), Gaps = 38/148 (26%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKH   VSTGT  LG+LTT+LSVVYSAVRAGSSTT LSPPSSPRAG       
Sbjct  266  NYECNGLHKHENVVSTGTLVLGMLTTLLSVVYSAVRAGSSTTFLSPPSSPRAG-------  318

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
                                           MYSAMLLTGW  S  E    +DVGW SVW
Sbjct  319  ------------------------------LMYSAMLLTGWGNS-AEGKDTIDVGWPSVW  347

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  348  VRICTQWLTAILYVWSLVAPLLFPDRDF  375


 Score = 59.7 bits (143),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +++LHP V GS+ PASVI++YCTY+CYSAL+SEPR
Sbjct  231  VISLHPQVNGSLLPASVIAVYCTYICYSALSSEPR  265



>gb|AEW08633.1| hypothetical protein CL976Contig1_02, partial [Pinus radiata]
 gb|AFG57497.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57498.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57499.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57500.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57501.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57502.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57503.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57504.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57505.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57506.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57507.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57508.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57509.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57510.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57511.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57512.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
 gb|AFG57513.1| hypothetical protein CL976Contig1_02, partial [Pinus taeda]
Length=84

 Score =   112 bits (281),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -1

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            +++  ++ + ++ + VTYSY+FFH+IF+LASMYSAMLLTGW++S  +  KL+ VGW +VW
Sbjct  1    IEEGQKNAQKDEERPVTYSYTFFHVIFALASMYSAMLLTGWTSSTPDGEKLIGVGWHTVW  60

Query  270  VRVVTGWVTAALFLWSLVAPILFP  199
            VR+ T W+TAAL++WSLVAP+LFP
Sbjct  61   VRICTEWITAALYIWSLVAPLLFP  84



>gb|ABF97020.1| TMS membrane family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=372

 Score = 95.1 bits (235),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 90/148 (61%), Gaps = 42/148 (28%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DY CN LH+HSK VS     LG+LTTVLSVVYSAVRAGSSTT LSPPSSPR         
Sbjct  266  DYACNGLHRHSKQVSMSALILGMLTTVLSVVYSAVRAGSSTTFLSPPSSPR---------  316

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
                                             SAMLLTGW+++  +S +L+DVGW +VW
Sbjct  317  ---------------------------------SAMLLTGWTSAASDSSELMDVGWTTVW  343

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T W TAAL++W+LVAP+LFPDRDF
Sbjct  344  VRICTEWATAALYIWTLVAPLLFPDRDF  371


 Score = 55.5 bits (132),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEP  635
            I+ LHP V GS+ PASVIS+YC YLCY++L+SEP
Sbjct  231  IIALHPQVNGSVMPASVISVYCAYLCYTSLSSEP  264



>ref|XP_002988580.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
 gb|EFJ10376.1| hypothetical protein SELMODRAFT_128126 [Selaginella moellendorffii]
Length=371

 Score = 85.1 bits (209),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 87/148 (59%), Gaps = 43/148 (29%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LHKH   VSTGT  LG+LTT+LSVVYSAVRAGSSTT LSPPSSPRA        
Sbjct  266  NYECNGLHKHENVVSTGTLVLGMLTTLLSVVYSAVRAGSSTTFLSPPSSPRA--------  317

Query  450  LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
                                              AMLLTGW  S  E    +DVGW SVW
Sbjct  318  ----------------------------------AMLLTGWGNS-AEGKDTIDVGWPSVW  342

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VR+ T W+TA L++WSLVAP+LFPDRDF
Sbjct  343  VRICTQWLTAILYVWSLVAPLLFPDRDF  370


 Score = 59.7 bits (143),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            +++LHP V GS+ PASVI++YCTY+CYSAL+SEPR
Sbjct  231  VISLHPQVNGSLLPASVIAVYCTYICYSALSSEPR  265



>dbj|BAD94992.1| hypothetical protein [Arabidopsis thaliana]
Length=57

 Score =   105 bits (262),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -1

Query  357  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVRVVT W TA LF+WSLVAPILFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRVVTSWATAGLFIWSLVAPILFPDREF  57



>gb|KIZ05916.1| putative serine incorporator [Monoraphidium neglectum]
Length=447

 Score = 99.8 bits (247),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 96/170 (56%), Gaps = 25/170 (15%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllspps----sPRAGGGK  463
            DY CN L     + S  T  +G+L T+LSVVYSA+RAGS++ L +             G+
Sbjct  277  DYACNGLAHRINAASGSTLVIGMLVTLLSVVYSALRAGSNSQLFTLADDNDDIAATSAGR  336

Query  462  PLLPLDK--------------------ADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAM  343
            PLL  +                     AD    ++    V+Y+YSFFH+IF+LASMY AM
Sbjct  337  PLLDAEAVGDSADGAAPAAVSASRAPGADATAALDDYTPVSYNYSFFHLIFALASMYIAM  396

Query  342  LLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  193
            L+TGW  +V +    VDVGW SVWV+    WVTA L+ W+LVAP+LFP+R
Sbjct  397  LMTGWG-AVEQEKDRVDVGWTSVWVKTGAEWVTALLYSWTLVAPVLFPER  445


 Score = 42.0 bits (97),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -3

Query  718  SVKGSIFPASVISLYCTYLCYSALASEPR  632
            S  GS+FP+++ SLY  YLCYSAL SEP+
Sbjct  248  SRGGSLFPSAITSLYVMYLCYSALQSEPK  276



>emb|CAN80334.1| hypothetical protein VITISV_009413 [Vitis vinifera]
Length=57

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -1

Query  357  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            MYSAMLLTGWSTSVGESG+LVDVGW SVWVR+VTGW TAAL++WSL APILFP+R+F
Sbjct  1    MYSAMLLTGWSTSVGESGRLVDVGWPSVWVRIVTGWATAALYIWSLAAPILFPEREF  57



>gb|ACG35592.1| hypothetical protein [Zea mays]
Length=57

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -1

Query  357  MYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            MYSAMLLTGWSTSVGESGKLVDVGW SVWVR+ T W TA LF+WSLVAP+LFPDR+F
Sbjct  1    MYSAMLLTGWSTSVGESGKLVDVGWPSVWVRIATQWATAGLFIWSLVAPVLFPDREF  57



>ref|XP_002956760.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
 gb|EFJ42217.1| hypothetical protein VOLCADRAFT_83749 [Volvox carteri f. nagariensis]
Length=415

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -1

Query  480  RAGGGKPLLPLDKADEHEEMEKSKA------VTYSYSFFHIIFSLASMYSAMLLTGWSTS  319
            RAG    L  L+ ++E E +  + A      VTY+YSFFH+IF+LASMY AML+TGW T 
Sbjct  311  RAGSNTALFTLEGSEEGEPLPSTAAATSLTPVTYNYSFFHLIFALASMYIAMLMTGWGTV  370

Query  318  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
                   +DVGWASVWV+    WVT  L++W+LVAP LFP+RDF
Sbjct  371  AQVRKDRIDVGWASVWVKPAAEWVTGLLYMWTLVAPALFPERDF  414



>ref|XP_005651318.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
 gb|EIE26774.1| TMS membrane protein/tumor differentially hypothetical protein 
[Coccomyxa subellipsoidea C-169]
Length=429

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 109/203 (54%), Gaps = 38/203 (19%)
 Frame = -1

Query  702  FSQLQLYLCTAHTFATVHLPVNLGDYECNALHKHSKsvstgtxtlgllttvlsvVYSAVR  523
            F+    YLC +   +  H      DY+CN L +   + S  T   G+L T++SVVYSA+R
Sbjct  233  FTFYCTYLCYSALVSEPH------DYQCNGLGQRLNAASATTLATGMLLTLVSVVYSALR  286

Query  522  AGssttllsppssPRAGG-GKPLLPLDK--------------------------ADEHEE  424
            AGS+T L    S   +    +PLL  DK                          ADE E 
Sbjct  287  AGSNTALFRLNSEEDSDPVEQPLLDDDKGRAYIAEEGTSAGLDGEVGMSRTARTADEAER  346

Query  423  MEKS----KAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
             +++      VTY+Y+FFH IF++ASMY AML+TGW T   E   L+DVGW SVWV+ VT
Sbjct  347  AKQTADEFTPVTYNYAFFHFIFAVASMYLAMLMTGWGTG-AEERDLIDVGWFSVWVKFVT  405

Query  255  GWVTAALFLWSLVAPILFPDRDF  187
             W TAA + W LVAP LFPDR+F
Sbjct  406  QWATAATYCWMLVAPTLFPDREF  428



>ref|XP_011397622.1| putative serine incorporator [Auxenochlorella protothecoides]
 gb|KFM24734.1| putative serine incorporator [Auxenochlorella protothecoides]
Length=435

 Score = 93.2 bits (230),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 90/158 (57%), Gaps = 10/158 (6%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttl-lsppssPRAGGGKPLL  454
            DY CN L     + S  T   G+L T+LSVVYSA RAGS+T       +     G +PLL
Sbjct  277  DYACNGLGARLGAASGATLAGGMLLTLLSVVYSAFRAGSNTQTFAGAWAGGNGAGAEPLL  336

Query  453  PLDKADEHEEMEKSKA-VTYSYSFFHIIFSLASMYSAMLLTGW--------STSVGESGK  301
              D       ++   A V Y Y+ F+ +F+LASMY AML+TGW        S +      
Sbjct  337  AGDAELTSAGLDGEDAPVPYCYAQFYAVFALASMYIAMLMTGWGATGQPKASDAAAGCSD  396

Query  300  LVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
             VDVGW SVWV++VT WV AAL+ W+L+AP LFPDR F
Sbjct  397  AVDVGWTSVWVKIVTQWVAAALYCWTLLAPSLFPDRVF  434


 Score = 44.7 bits (104),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = -3

Query  736  IVTLHPSVK-GSIFPASVISLYCTYLCYSALASEPR  632
            + + HP+V+ GS+FPA+ + LY +Y+ YSAL SEPR
Sbjct  241  LTSFHPAVEAGSLFPAAAVGLYVSYMGYSALQSEPR  276



>ref|XP_004302121.1| PREDICTED: serine incorporator 3-like [Fragaria vesca subsp. 
vesca]
Length=246

 Score = 70.9 bits (172),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            DYECN LHKHSK+VSTGT TLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAG GKPLLP
Sbjct  170  DYECNGLHKHSKAVSTGTLTLGLLTTVLSVVYSAVRAGSSTTLLSPPSSPRAGAGKPLLP  229

Query  450  LDKADEHEEMEKSKA  406
            LDK +E EE EK+K+
Sbjct  230  LDKPEEREENEKAKS  244


 Score = 63.5 bits (153),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GSI PASVIS+YCTYLCYSALASEPR
Sbjct  135  IVALHPTVGGSILPASVISVYCTYLCYSALASEPR  169



>ref|XP_002506090.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67348.1| predicted protein [Micromonas sp. RCC299]
Length=433

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = -1

Query  414  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  235
            S  V+YSYSFFH IF+LASM+ AML+TGW     +  + VDVGWASVWV++ + WVTA L
Sbjct  357  SGPVSYSYSFFHFIFALASMFLAMLMTGWGRDDYKGAERVDVGWASVWVKMCSVWVTAGL  416

Query  234  FLWSLVAPILFPDRDF  187
            + WSL+AP LFPDR+F
Sbjct  417  YTWSLIAPALFPDREF  432



>ref|XP_001416509.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=393

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = -1

Query  450  LDKADEHE--EMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWAS  277
            L+  DE E  E + S  V Y+YSFFH++F+LA+MY++MLLTGW T   +  + +  GWAS
Sbjct  304  LNDGDEEEASEGDASGPVKYNYSFFHLMFALAAMYTSMLLTGWGTRHEDDTEAIGSGWAS  363

Query  276  VWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            VWV+  + W T A++LW L+AP LFPDR+F
Sbjct  364  VWVKFFSVWATGAIYLWCLIAPALFPDREF  393



>gb|EFA77480.1| TMS membrane protein [Polysphondylium pallidum PN500]
Length=419

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 68/105 (65%), Gaps = 9/105 (9%)
 Frame = -1

Query  477  AGGGKPLLPL-----DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVG  313
            +GGG   LP      + AD+  E ++S  V Y+Y+FFHI F+L +MY  MLLT W+T  G
Sbjct  313  SGGGFDKLPTVASDDEAADDKMEDDESGGVAYNYTFFHITFALGAMYIGMLLTNWATISG  372

Query  312  ESGK----LVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRD  190
             SG      VD G  SVWV++V+GW+   L+LW+LVAP+L P+R+
Sbjct  373  TSGSNGDLNVDSGMVSVWVKIVSGWLVHLLYLWTLVAPVLMPNRE  417



>emb|CEG01070.1| TMS membrane protein/tumour differentially expressed protein 
[Ostreococcus tauri]
Length=422

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -1

Query  414  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  235
            S  V Y+YSFFH+IF+LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T  +
Sbjct  347  SGPVRYNYSFFHLIFALAAMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTI  406

Query  234  FLWSLVAPILFPDRDF  187
            + W LVAP LFP+R+F
Sbjct  407  YAWCLVAPALFPEREF  422



>ref|XP_003075128.1| OJ1249_F12.26 gene product (ISS), partial [Ostreococcus tauri]
Length=423

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -1

Query  414  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAAL  235
            S  V Y+YSFFH+IF+LA+MY++MLLTGW T   +  + +  GWASVWV+  + W T  +
Sbjct  348  SGPVRYNYSFFHLIFALAAMYTSMLLTGWGTRRPDDSEAIGSGWASVWVKYFSVWATGTI  407

Query  234  FLWSLVAPILFPDRDF  187
            + W LVAP LFP+R+F
Sbjct  408  YAWCLVAPALFPEREF  423



>gb|EXX70672.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=240

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -1

Query  465  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  298
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  138  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  197

Query  297  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  193
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  198  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  234



>ref|XP_002304839.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
 gb|EEE79818.2| hypothetical protein POPTR_0003s18530g [Populus trichocarpa]
Length=364

 Score = 62.0 bits (149),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  736  IVTLHPSVKGSIFPASVISLYCTYLCYSALASEPR  632
            IV LHP+V GS+ PASVISLYC YLCYS LASEPR
Sbjct  231  IVALHPAVNGSVLPASVISLYCMYLCYSGLASEPR  265


 Score = 51.2 bits (121),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -1

Query  630  DYECNALHKHSKsvstgtxtlgllttvlsvVYSAVRAGssttllsppssPRAGGGKPLLP  451
            +YECN LH+HSK+VSTGT ++GLLTTVLSVVYSAVRAGSST LLSPPSSPRAG  KPLLP
Sbjct  266  EYECNGLHRHSKAVSTGTLSIGLLTTVLSVVYSAVRAGSSTALLSPPSSPRAGADKPLLP  325

Query  450  LDKADEHEEMEK  415
            L     +++  +
Sbjct  326  LTTRQTNKKKRR  337



>ref|XP_003062471.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53290.1| predicted protein [Micromonas pusilla CCMP1545]
Length=442

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 1/76 (1%)
 Frame = -1

Query  414  SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL-VDVGWASVWVRVVTGWVTAA  238
            S  V+Y+Y+FFH IF+LAS Y AML+TGW     E G   VDVGWASV+V+  + WVT  
Sbjct  365  SGPVSYNYAFFHFIFALASAYLAMLMTGWGDRAFEDGGAPVDVGWASVYVKYASLWVTGL  424

Query  237  LFLWSLVAPILFPDRD  190
            L+ WSLVAP + PDRD
Sbjct  425  LYTWSLVAPAVMPDRD  440



>ref|XP_001625531.1| predicted protein [Nematostella vectensis]
 gb|EDO33431.1| predicted protein [Nematostella vectensis]
Length=446

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -1

Query  435  EHEEM--EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRV  262
            +H+++  ++S +V+Y+YSFFH  F LAS+Y  M LT W +  G     +   WA+VWV++
Sbjct  359  KHQKVYDDESTSVSYNYSFFHFTFFLASLYIMMTLTNWYSPQGSDFSKLTSNWATVWVKI  418

Query  261  VTGWVTAALFLWSLVAPILFPDRDF  187
             T WV  AL+ W+L+AP+L PDRDF
Sbjct  419  STSWVCLALYAWTLLAPVLMPDRDF  443



>gb|KDD71727.1| hypothetical protein H632_c4498p0 [Helicosporidium sp. ATCC 50920]
Length=169

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = -1

Query  477  AGGGKPLLPLDKADEHEEMEKSKA-------VTYSYSFFHIIFSLASMYSAMLLTGWSTS  319
            +G  +PL  + +A+  E      A       + YSY+ F+ + +LAS Y +ML+TGW   
Sbjct  66   SGAPRPLRAMSRAEAAEPGSYGAASAAPRAPIPYSYAQFYAVLALASAYVSMLMTGWGAG  125

Query  318  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +   G LVDVGW SV+V+  T W    L+LW L AP LFPDRDF
Sbjct  126  MMAPG-LVDVGWTSVYVKCATQWGAGVLYLWMLFAPALFPDRDF  168



>ref|XP_004366977.1| TMS membrane protein [Dictyostelium fasciculatum]
 gb|EGG19994.1| TMS membrane protein [Dictyostelium fasciculatum]
Length=420

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = -1

Query  447  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDV--GWASV  274
            D   +  E ++   V YSY+FFHI F+  +MY  MLLT WST  G S   ++V  G  SV
Sbjct  331  DDVPQQMEDDEKHEVAYSYTFFHITFAFGAMYIGMLLTNWSTIGGLSSASINVDSGLVSV  390

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDR  193
            WV++V+GW+   L+LW+LV P LFP+R
Sbjct  391  WVKIVSGWLVHLLYLWTLVGPALFPNR  417



>ref|XP_009493459.1| hypothetical protein H696_01290 [Fonticula alba]
 gb|KCV71881.1| hypothetical protein H696_01290 [Fonticula alba]
Length=116

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -1

Query  447  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVG--WASV  274
            D AD     +++++  YSYS FH IF+LA++Y +MLL+ W  ++  SG  + +G  W  +
Sbjct  27   DDADAEHTGDEAESCQYSYSTFHFIFALAALYMSMLLSDWG-AINLSGAPIFIGHEWLGI  85

Query  273  WVRVVTGWVTAALFLWSLVAPILFPDR  193
            W+R+VT W+   LF W+LVAPI  PDR
Sbjct  86   WIRIVTSWIGYGLFSWTLVAPIFLPDR  112



>ref|XP_002157067.2| PREDICTED: probable serine incorporator-like, partial [Hydra 
vulgaris]
Length=423

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -1

Query  450  LDKADEHEEMEK---------SKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  298
            +   DE+EE EK            V Y+YS+FH  F LAS+Y  M+LT W +      K 
Sbjct  326  IASGDENEESEKIGQNVYDNEKVQVAYNYSYFHFTFMLASLYIMMMLTNWYSPENSDSKT  385

Query  297  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +   W++VW++VV+ W   A+F+W+L+AP+L+PDR+F
Sbjct  386  LISSWSTVWIKVVSCWACFAIFMWTLLAPVLWPDRNF  422



>ref|XP_009336936.1| PREDICTED: LOW QUALITY PROTEIN: probable serine incorporator 
[Pyrus x bretschneideri]
Length=272

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              +E E    V Y Y FFH +F++ +MY AMLL GW+T        +DVGWA+ WVR+V 
Sbjct  186  RKDETESKDDVPYGYGFFHFVFAMGAMYFAMLLIGWNTHQSMRRFTIDVGWANTWVRIVN  245

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++  R 
Sbjct  246  EWIAVCVYLWMLVAPIVWESRQ  267



>gb|ESA19644.1| hypothetical protein GLOINDRAFT_19362 [Rhizophagus irregularis 
DAOM 181602]
Length=485

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 6/97 (6%)
 Frame = -1

Query  465  KPLLP---LDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWST-SVGESGKL  298
            K +LP   LD+  ++   ++   V Y+Y+FFH IF++A+MY AMLLT W+T ++  + KL
Sbjct  383  KEILPPSALDEEADYPMDDEDYDVNYNYTFFHFIFAIAAMYVAMLLTDWNTFTMTGNEKL  442

Query  297  VDVGWAS--VWVRVVTGWVTAALFLWSLVAPILFPDR  193
            V +G +   VWV+V++GWV   L+ WSLVAP LFP+R
Sbjct  443  VVIGRSHTIVWVKVISGWVCFLLYYWSLVAPALFPER  479



>ref|XP_008242601.1| PREDICTED: probable serine incorporator [Prunus mume]
Length=389

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              +E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  303  RKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVN  362

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++  R 
Sbjct  363  EWIAVCVYLWMLVAPIIWKSRQ  384



>ref|XP_007202140.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
 gb|EMJ03339.1| hypothetical protein PRUPE_ppa006940mg [Prunus persica]
Length=389

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              +E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  303  RKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTIDVGWASTWVRIVN  362

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++  R 
Sbjct  363  EWIAVCVYLWMLVAPIIWKSRQ  384



>emb|CEG74958.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=320

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  237  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  296

Query  240  ALFLWSLVAPILFPDR  193
             L++WSLVAP+L PDR
Sbjct  297  GLYVWSLVAPVLMPDR  312



>emb|CEG74957.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=317

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  237  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  296

Query  240  ALFLWSLVAPILFPDR  193
             L++WSLVAP+L PDR
Sbjct  297  GLYVWSLVAPVLMPDR  312



>ref|NP_741561.1| Protein Y57E12AL.1, isoform a [Caenorhabditis elegans]
 emb|CCD69746.1| Y57E12AL.1, isoform a [Caenorhabditis elegans]
Length=459

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = -1

Query  450  LDKADEHEEMEKSK-------AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVD  292
            L+ AD+ E     +        V YSYSFFH +F+LAS+Y  M LT W     +   L +
Sbjct  366  LNGADDAESQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPSNDLSHL-N  424

Query  291  VGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
               ASVWV++V+ WV  AL+ W+LVAPI++PDR+F
Sbjct  425  SNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF  459



>ref|NP_741562.1| Protein Y57E12AL.1, isoform b [Caenorhabditis elegans]
 emb|CCD69747.1| Y57E12AL.1, isoform b [Caenorhabditis elegans]
Length=389

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 9/104 (9%)
 Frame = -1

Query  474  GGGKPLLPLDKADEHEEMEKSK--------AVTYSYSFFHIIFSLASMYSAMLLTGWSTS  319
            GGG       +  +  E + SK         V YSYSFFH +F+LAS+Y  M LT W   
Sbjct  287  GGGNTSDEAIQLTDDAESQNSKRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKP  346

Query  318  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
              +   L +   ASVWV++V+ WV  AL+ W+LVAPI++PDR+F
Sbjct  347  SNDLSHL-NSNMASVWVKIVSSWVCVALYCWTLVAPIIYPDREF  389



>ref|XP_009352478.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
             ++E E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RNDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVN  371

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++  R 
Sbjct  372  EWIAVCVYLWMLVAPIIWKSRQ  393



>gb|KIH42470.1| TMS membrane protein/tumor differentially expressed protein, 
partial [Ancylostoma duodenale]
Length=91

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +++ V YSYSFFH +F LAS+Y  M LT W     +   L +   ASVWV++V+ W+  
Sbjct  15   NETEGVAYSYSFFHFMFGLASLYVMMTLTSWYNPDNDLTHL-NSNMASVWVKIVSSWLCV  73

Query  240  ALFLWSLVAPILFPDRDF  187
            AL+ W+LVAP LFPDR+F
Sbjct  74   ALYGWTLVAPALFPDREF  91



>emb|CEJ00743.1| hypothetical protein RMCBS344292_14792 [Rhizopus microsporus]
Length=453

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 8/83 (10%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRV  262
            E+  AV Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+V
Sbjct  364  ERYGAV-YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKV  422

Query  261  VTGWVTAALFLWSLVAPILFPDR  193
            V+GW+   L++WSL+AP+L PDR
Sbjct  423  VSGWICYGLYIWSLIAPVLMPDR  445



>emb|CEG67769.1| hypothetical protein RMATCC62417_04149 [Rhizopus microsporus]
Length=393

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  313  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  372

Query  240  ALFLWSLVAPILFPDR  193
             L++WSL+AP+L PDR
Sbjct  373  GLYIWSLIAPVLMPDR  388



>gb|EGT39434.1| hypothetical protein CAEBREN_08033 [Caenorhabditis brenneri]
Length=460

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 57/92 (62%), Gaps = 8/92 (9%)
 Frame = -1

Query  441  ADEHEEM-------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGW  283
            AD+ E          + + V YSYSFFH +F+LAS+Y  M LT W     +   L +   
Sbjct  370  ADDEESQSSRRVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPDNDLSHL-NSNM  428

Query  282  ASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            ASVWV++V+ WV  AL+ W+L+AP++FPDRDF
Sbjct  429  ASVWVKIVSSWVCVALYCWTLLAPVVFPDRDF  460



>emb|CEG74956.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=396

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  313  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  372

Query  240  ALFLWSLVAPILFPDR  193
             L++WSLVAP+L PDR
Sbjct  373  GLYVWSLVAPVLMPDR  388



>ref|XP_010440599.1| PREDICTED: probable serine incorporator [Camelina sativa]
Length=101

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 4/95 (4%)
 Frame = -1

Query  477  AGGGKPLLPLDKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  298
             G         K + HEE     A+ Y Y FFH +F+  +MY AMLL GW+         
Sbjct  8    TGVDSQCFQFRKEENHEE----DAIPYGYGFFHFVFATGAMYFAMLLVGWNIHHSMKKWT  63

Query  297  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDR  193
            +DVGW S WVR+V  W+   +++W LVAP++   R
Sbjct  64   IDVGWTSTWVRIVNEWLAVGVYIWMLVAPMVLKSR  98



>dbj|GAM29010.1| hypothetical protein SAMD00019534_121860, partial [Acytostelium 
subglobosum LB1]
Length=339

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVG--ESGKL-VDVGWASVWVR  265
            E ++ EK   V Y+YSFFHI F+L +MY  MLLT WST  G   +G L VD G  SVWV+
Sbjct  254  EMDDDEK-DGVAYNYSFFHITFALGAMYIGMLLTNWSTISGLDNNGNLNVDSGMVSVWVK  312

Query  264  VVTGWVTAALFLWSLVAPILFPDR  193
            +V+ W    L+ W+LV P LFP+R
Sbjct  313  IVSCWCVHILYFWTLVGPTLFPNR  336



>emb|CEG74955.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=393

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  313  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  372

Query  240  ALFLWSLVAPILFPDR  193
             L++WSLVAP+L PDR
Sbjct  373  GLYVWSLVAPVLMPDR  388



>ref|XP_011458210.1| PREDICTED: probable serine incorporator isoform X2 [Fragaria 
vesca subsp. vesca]
Length=403

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
            + +E E    V Y Y FFH +F+  +MY AMLL GW+T+       +DVGW S WVR+V 
Sbjct  316  KKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTNHSMKKWTIDVGWTSTWVRIVN  375

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++  R 
Sbjct  376  EWIAVCVYLWMLVAPIIWKSRQ  397



>ref|XP_004287083.1| PREDICTED: probable serine incorporator isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011458173.1| PREDICTED: probable serine incorporator isoform X1 [Fragaria 
vesca subsp. vesca]
Length=406

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
            + +E E    V Y Y FFH +F+  +MY AMLL GW+T+       +DVGW S WVR+V 
Sbjct  319  KKDETESEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTNHSMKKWTIDVGWTSTWVRIVN  378

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++  R 
Sbjct  379  EWIAVCVYLWMLVAPIIWKSRQ  400



>emb|CEG74954.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=457

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  374  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  433

Query  240  ALFLWSLVAPILFPDR  193
             L++WSLVAP+L PDR
Sbjct  434  GLYVWSLVAPVLMPDR  449



>emb|CEJ03265.1| hypothetical protein RMCBS344292_17253 [Rhizopus microsporus]
Length=316

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 53/76 (70%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+ V+GW+  
Sbjct  233  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKAVSGWICY  292

Query  240  ALFLWSLVAPILFPDR  193
             L++WSL+AP+L PDR
Sbjct  293  GLYIWSLIAPVLMPDR  308



>ref|XP_004665239.1| PREDICTED: serine incorporator 2 [Jaculus jaculus]
Length=452

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +   VTYSYSFFH    LAS++  M LT W  S GESGKL+   W SVWV++   W   
Sbjct  376  NEQDGVTYSYSFFHFCLVLASLHIMMTLTNW-YSPGESGKLIS-KWTSVWVKICASWAGL  433

Query  240  ALFLWSLVAPILFPDRDF  187
             L+LW+LVAP+L P+RDF
Sbjct  434  LLYLWTLVAPLLLPNRDF  451



>ref|XP_009336915.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
 ref|XP_009336916.1| PREDICTED: probable serine incorporator [Pyrus x bretschneideri]
Length=398

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              +E E    V Y Y FFH +F+  +MY  MLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RKDETESEDDVPYGYGFFHFVFATGAMYFGMLLIGWNTHQSMRRFTIDVGWASTWVRIVN  371

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI+   R 
Sbjct  372  EWIAVCVYLWMLVAPIILESRQ  393



>emb|CEG74953.1| hypothetical protein RMATCC62417_10078 [Rhizopus microsporus]
Length=454

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWSTSVGES-----GKLVDVG--WASVWVRVVTGWVTA  241
            Y+YSFFH  F++A+MY AMLLT W+T + E        L+ +G  + +VWV+VV+GW+  
Sbjct  374  YNYSFFHFTFAIAAMYVAMLLTNWNTIISEQPNSQDDSLIRIGQSYTAVWVKVVSGWICY  433

Query  240  ALFLWSLVAPILFPDR  193
             L++WSLVAP+L PDR
Sbjct  434  GLYVWSLVAPVLMPDR  449



>ref|NP_189089.3| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AAL36053.1| AT3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AAQ89613.1| At3g24470/MXP5_4 [Arabidopsis thaliana]
 gb|AEE76900.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=409

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -1

Query  447  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWV  268
            D+ D+ EE E    V Y Y FFH +F+  +MY AMLL GW+T        +DVGW S WV
Sbjct  320  DENDQEEEAEDD--VPYGYGFFHFVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWV  377

Query  267  RVVTGWVTAALFLWSLVAPILFPDR  193
            RVV  W+   +++W LVAP++   R
Sbjct  378  RVVNEWLAVCVYIWMLVAPLILKSR  402



>gb|EGT35951.1| hypothetical protein CAEBREN_13181 [Caenorhabditis brenneri]
Length=445

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            KA ++EE    +AV YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  365  KAFDNEE----EAVAYSYSFFHFMFGLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  419

Query  264  VVTGWVTAALFLWSLVAPILFPDRDF  187
            +++ W+ A L+ W+LVAPI+FPDR+F
Sbjct  420  ILSSWICAGLYSWTLVAPIVFPDREF  445



>ref|XP_011174068.1| PREDICTED: probable serine incorporator, partial [Solenopsis 
invicta]
Length=113

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             + + V Y++SFFH++F+LA++Y  M LT W      + + ++   AS+WV++++ W+  
Sbjct  35   NEEEKVAYNWSFFHLMFALATLYVMMTLTNWYKPNVSNLETLNANTASMWVKIISSWMCL  94

Query  240  ALFLWSLVAPILFPDRDF  187
             L++WSLVAP +FP+RDF
Sbjct  95   GLYVWSLVAPAIFPNRDF  112



>gb|ETN74193.1| TMS membrane protein/tumor differentially expressed protein [Necator 
americanus]
Length=459

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = -1

Query  477  AGGGKPLLPLDKADEHEEM-------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTS  319
            +G   P++P++  +E            +++ V YSYSFFH +F LAS+Y  M LT W   
Sbjct  357  SGSRDPIVPVNDDEESGSSSSRRVWDNETEGVAYSYSFFHFMFGLASLYVMMTLTSWYNP  416

Query  318  VGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
              +   L +   ASVWV++V+ W+  AL+ W+LVAP LFPDR+F
Sbjct  417  DNDLTHL-NSNMASVWVKIVSSWLCLALYGWTLVAPALFPDREF  459



>emb|CDX93013.1| BnaA03g37350D [Brassica napus]
Length=411

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -1

Query  447  DKADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWV  268
            D   + E  EK   V Y Y FFH +F+  +MY AMLL GW+T        +DVGW S WV
Sbjct  320  DANSQGEVEEKEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWV  379

Query  267  RVVTGWVTAALFLWSLVAPILFPDR  193
            R+V  W+   +++W LVAPI+   R
Sbjct  380  RIVNEWLAVCVYIWMLVAPIILKSR  404



>ref|XP_005665214.1| PREDICTED: serine incorporator 2-like, partial [Sus scrofa]
Length=135

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +   VTYSYSFFH    LAS++  M LT W    GE+ K++   W +VWV++   W   
Sbjct  59   NEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYRP-GETRKMIST-WTAVWVKICASWAGL  116

Query  240  ALFLWSLVAPILFPDRDF  187
             L+LW+LVAP+L P+RDF
Sbjct  117  LLYLWTLVAPLLLPNRDF  134



>gb|ESA09597.1| hypothetical protein GLOINDRAFT_80906 [Rhizophagus irregularis 
DAOM 181602]
Length=415

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = -1

Query  417  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWS--TSVGESGKLVDVG--WASVWVRVVTGW  250
            +   V Y+Y+FFH+IF++ASMY AMLLT W+  T++    KLV +G  + +VWV+V++ W
Sbjct  332  EKNGVAYNYAFFHLIFAIASMYVAMLLTNWNNVTTINSDEKLVVIGQTYIAVWVKVISSW  391

Query  249  VTAALFLWSLVAPILFPDR  193
            +   L+ W+L+ P+L PDR
Sbjct  392  ICILLYSWTLIGPVLLPDR  410



>gb|EGT34050.1| hypothetical protein CAEBREN_24071 [Caenorhabditis brenneri]
Length=445

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 5/86 (6%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            KA ++EE    +AV YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  365  KAFDNEE----EAVAYSYSFFHFMFGLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  419

Query  264  VVTGWVTAALFLWSLVAPILFPDRDF  187
            +++ W+ A L+ W+LVAP++FPDR+F
Sbjct  420  ILSSWICAGLYSWTLVAPVVFPDREF  445



>emb|CEP13524.1| hypothetical protein [Parasitella parasitica]
Length=487

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 8/77 (10%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG--WASVWVRVVTGWVT  244
            YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G  + +VWV++V+GW+ 
Sbjct  407  YSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGNDGGDLVRIGQSYTAVWVKIVSGWIC  466

Query  243  AALFLWSLVAPILFPDR  193
              +++WSLVAP+L PDR
Sbjct  467  HIIYIWSLVAPVLMPDR  483



>gb|KHN74385.1| Serine incorporator 3 [Toxocara canis]
Length=570

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 5/100 (5%)
 Frame = -1

Query  474  GGGKPLLPLDKADEHEEM----EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGES  307
            G  +P++     ++ E +    ++  AV+YSYSFFH +F LAS+Y  M LT W     + 
Sbjct  471  GSQQPIVDASSGEDRESVRVWDDEKDAVSYSYSFFHFVFGLASLYVMMTLTSWYKPDNDL  530

Query  306  GKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
              L +   A+VWV+VV+ W+   ++ W+L AP +FPDRDF
Sbjct  531  SHL-NSNMAAVWVKVVSSWLCLIIYCWTLAAPAIFPDRDF  569



>ref|XP_002602420.1| hypothetical protein BRAFLDRAFT_117027 [Branchiostoma floridae]
 gb|EEN58432.1| hypothetical protein BRAFLDRAFT_117027 [Branchiostoma floridae]
Length=483

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = -1

Query  447  DKADEHEEMEKSK-AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVW  271
            D  D+   ++  K  V Y+YSFFH +F LASMY  M LT W +  G +   +     +VW
Sbjct  395  DLDDDAPTIDNEKDGVKYNYSFFHFMFMLASMYIMMTLTNWYSPDGSNFNNLQPNQPAVW  454

Query  270  VRVVTGWVTAALFLWSLVAPILFPDRDF  187
            V++V+ W+   L++W+LVAPI+ PDRDF
Sbjct  455  VKIVSSWLCILLYVWTLVAPIVLPDRDF  482



>dbj|GAN07994.1| TMS membrane protein/tumor differentially expressed protein [Mucor 
ambiguus]
Length=495

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 8/77 (10%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG--WASVWVRVVTGWVT  244
            YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G  + +VWV++V+GW+ 
Sbjct  415  YSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGHDGGDLVRIGQSYTAVWVKIVSGWIC  474

Query  243  AALFLWSLVAPILFPDR  193
              +++WSLVAP+L PDR
Sbjct  475  HLIYMWSLVAPVLMPDR  491



>gb|EPB88143.1| hypothetical protein HMPREF1544_05087 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=495

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%), Gaps = 8/77 (10%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG--WASVWVRVVTGWVT  244
            YSYSFFH +F++A+MY +M+LT W+T      VG + G LV +G  + +VWV++V+GW+ 
Sbjct  415  YSYSFFHFVFAIAAMYVSMVLTNWNTIQFKDGVGHDGGDLVRIGQSYTAVWVKIVSGWIC  474

Query  243  AALFLWSLVAPILFPDR  193
              +++WSLVAP+L PDR
Sbjct  475  HLIYIWSLVAPVLMPDR  491



>gb|EXX55775.1| Tms1p [Rhizophagus irregularis DAOM 197198w]
Length=476

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = -1

Query  417  KSKAVTYSYSFFHIIFSLASMYSAMLLTGWS--TSVGESGKLVDVG--WASVWVRVVTGW  250
            +   V Y+Y+FFH+IF++ASMY AMLLT W+  T++    KLV +G  + +VWV+V++ W
Sbjct  393  EKNGVAYNYAFFHLIFAIASMYVAMLLTNWNNVTTINSDEKLVVIGQTYIAVWVKVISSW  452

Query  249  VTAALFLWSLVAPILFPDR  193
            +   L+ W+L+ P+L PDR
Sbjct  453  ICILLYSWTLIGPVLLPDR  471



>ref|XP_010049722.1| PREDICTED: probable serine incorporator [Eucalyptus grandis]
 gb|KCW82479.1| hypothetical protein EUGRSUZ_C03867 [Eucalyptus grandis]
Length=402

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
               +++    V Y Y FFH++F+  +MY AMLL GW+T        +DVGW S WVRVV 
Sbjct  316  RKNDLKSEDDVPYGYGFFHLVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVN  375

Query  255  GWVTAALFLWSLVAPILFPDRDF  187
             W+   ++LW LVAP+L+  R+F
Sbjct  376  EWLAVCVYLWMLVAPMLWKCREF  398



>ref|XP_003114570.1| hypothetical protein CRE_26972 [Caenorhabditis remanei]
 gb|EFP05908.1| hypothetical protein CRE_26972 [Caenorhabditis remanei]
Length=485

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = -1

Query  450  LDKADEHEEMEKSK--------AVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLV  295
            +  AD+  E + S+         V YSYSFFH +F+LAS+Y  M LT W     +   L 
Sbjct  391  MKGADDDTESQSSRKVYDNEEEGVAYSYSFFHFMFALASLYVMMTLTSWYKPDNDLSHL-  449

Query  294  DVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +   ASVWV++V+ WV   L+ W+LVAP+ FPDR+F
Sbjct  450  NSNMASVWVKIVSSWVCVGLYCWTLVAPLAFPDREF  485



>ref|XP_006295917.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
 gb|EOA28815.1| hypothetical protein CARUB_v10025054mg [Capsella rubella]
Length=423

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            + DE +E E    + YSY FFH++FSL +MY AML   W+ S       +DVGW S WV+
Sbjct  329  RRDEGKEEED---IPYSYGFFHLVFSLGAMYFAMLFISWNLSDSARKWSIDVGWTSTWVK  385

Query  264  VVTGWVTAALFLWSLVAPILFPDR  193
            +V  W  AA++LW L+API+   R
Sbjct  386  IVNEWFAAAIYLWKLIAPIVRQPR  409



>gb|EGW01137.1| Serine incorporator 2 [Cricetulus griseus]
Length=395

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +   VTYSYSFFH    LAS++  M LT W  S GE+ K++   W SVWV++   W   
Sbjct  319  NEQDGVTYSYSFFHFCLVLASLHVMMTLTNWY-SPGETRKMIST-WTSVWVKICASWAGL  376

Query  240  ALFLWSLVAPILFPDRDF  187
             L+LW+LVAP+L PDRDF
Sbjct  377  LLYLWTLVAPLLLPDRDF  394



>emb|CEG70157.1| hypothetical protein RMATCC62417_06104 [Rhizopus microsporus]
Length=494

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 58/77 (75%), Gaps = 8/77 (10%)
 Frame = -1

Query  399  YSYSFFHIIFSLASMYSAMLLTGWST-----SVG-ESGKLVDVG--WASVWVRVVTGWVT  244
            Y+YSFFH IF++A+MY +M+LT W+T     ++G + G LV +G  + +VWV+VV+GW+ 
Sbjct  414  YNYSFFHFIFAIAAMYISMVLTNWNTIRFEDTLGSDGGDLVRIGQSYTAVWVKVVSGWIC  473

Query  243  AALFLWSLVAPILFPDR  193
              +++WSLVAP+L PDR
Sbjct  474  HLIYIWSLVAPVLMPDR  490



>ref|XP_008337449.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=398

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              +E      V Y Y FFH +F+  +MY AMLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RKDEPVSEDDVPYGYGFFHFVFATGAMYFAMLLIGWNTHQSMKKFTLDVGWASTWVRIVN  371

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   ++LW LVAPI++ +R 
Sbjct  372  EWIAVCVYLWILVAPIIWKNRQ  393



>ref|XP_010469509.1| PREDICTED: probable serine incorporator isoform X4 [Camelina 
sativa]
Length=311

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            + DE +E E    + YSY FFH++FSL +MY AML   W+ S       +DVGW S WV+
Sbjct  217  RKDEAKEEED---IPYSYGFFHLVFSLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVK  273

Query  264  VVTGWVTAALFLWSLVAPILFPDR  193
            +V  W  AA++LW L++PI+   R
Sbjct  274  IVNEWFAAAIYLWKLISPIVRQPR  297



>gb|ERE85397.1| serine incorporator 2-like protein [Cricetulus griseus]
Length=461

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +   VTYSYSFFH    LAS++  M LT W  S GE+ K++   W SVWV++   W   
Sbjct  385  NEQDGVTYSYSFFHFCLVLASLHVMMTLTNWY-SPGETRKMIST-WTSVWVKICASWAGL  442

Query  240  ALFLWSLVAPILFPDRDF  187
             L+LW+LVAP+L PDRDF
Sbjct  443  LLYLWTLVAPLLLPDRDF  460



>ref|XP_002637793.1| Hypothetical protein CBG04578 [Caenorhabditis briggsae]
 emb|CAP25252.1| Protein CBG04578 [Caenorhabditis briggsae]
Length=442

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            KA ++EE    + V YSYSFFH +F LAS+Y  M LT W     +   L +   ASVWV+
Sbjct  362  KAWDNEE----EGVAYSYSFFHFMFCLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWVK  416

Query  264  VVTGWVTAALFLWSLVAPILFPDRDF  187
            +V+ W+ A L+ W+LVAP++FPDR+F
Sbjct  417  IVSSWICAGLYSWTLVAPLVFPDREF  442



>ref|XP_007637556.1| PREDICTED: serine incorporator 2 isoform X2 [Cricetulus griseus]
Length=450

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +   VTYSYSFFH    LAS++  M LT W  S GE+ K++   W SVWV++   W   
Sbjct  374  NEQDGVTYSYSFFHFCLVLASLHVMMTLTNW-YSPGETRKMIST-WTSVWVKICASWAGL  431

Query  240  ALFLWSLVAPILFPDRDF  187
             L+LW+LVAP+L PDRDF
Sbjct  432  LLYLWTLVAPLLLPDRDF  449



>ref|XP_008362934.1| PREDICTED: probable serine incorporator [Malus domestica]
Length=392

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              +E E    V Y Y FFH +F+  +MY  MLL GW+T        +DVGWAS WVR+V 
Sbjct  312  RKDETESEDDVPYGYGFFHFVFATGAMYFGMLLIGWNTHQSMRRFTIDVGWASTWVRIVN  371

Query  255  GWVTAALFLWSLVAPIL  205
             W+   ++LW LVAPI+
Sbjct  372  EWIAVCVYLWMLVAPII  388



>ref|XP_007624716.1| PREDICTED: serine incorporator 2 isoform X1 [Cricetulus griseus]
Length=450

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
             +   VTYSYSFFH    LAS++  M LT W  S GE+ K++   W SVWV++   W   
Sbjct  374  NEQDGVTYSYSFFHFCLVLASLHVMMTLTNW-YSPGETRKMIST-WTSVWVKICASWAGL  431

Query  240  ALFLWSLVAPILFPDRDF  187
             L+LW+LVAP+L PDRDF
Sbjct  432  LLYLWTLVAPLLLPDRDF  449



>ref|NP_850202.4| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
 gb|AEC08798.1| Serinc-domain containing serine and sphingolipid biosynthesis 
protein [Arabidopsis thaliana]
Length=422

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -1

Query  429  EEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGW  250
            +E ++   + YSY FFH++FSL +MY AML   W+ S       +DVGW S WV++V  W
Sbjct  330  DEAKEEDDIPYSYGFFHLVFSLGAMYFAMLFISWNLSHSTEKWSIDVGWTSTWVKIVNEW  389

Query  249  VTAALFLWSLVAPILFPDR  193
              AA++LW L+API+   R
Sbjct  390  FAAAIYLWKLIAPIVRQHR  408



>gb|KFH68151.1| hypothetical protein MVEG_06880 [Mortierella verticillata NRRL 
6337]
Length=474

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 55/78 (71%), Gaps = 5/78 (6%)
 Frame = -1

Query  411  KAVTYSYSFFHIIFSLASMYSAMLLTGWST-----SVGESGKLVDVGWASVWVRVVTGWV  247
              V Y+Y+FFH++F+LA+MY AM+LT W+T     S   +  L+   W +VWV+VV+ W+
Sbjct  393  NGVQYNYTFFHLVFALAAMYIAMVLTNWNTFKQIDSNNSNMILIGQSWPAVWVKVVSSWI  452

Query  246  TAALFLWSLVAPILFPDR  193
              AL+ +SL+AP+LFPDR
Sbjct  453  CYALYGFSLLAPVLFPDR  470



>emb|CEF63556.1| TMS1 [Strongyloides ratti]
Length=447

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 74/124 (60%), Gaps = 9/124 (7%)
 Frame = -1

Query  537  YSAVRAGssttllsppssPRAGGGKPLLPLDKADEHE-------EMEKSKAVTYSYSFFH  379
            YSA+R  S+T + +       G    L+PL+ ++ ++       + EK  +V+YSYS+ H
Sbjct  325  YSAIRTTSNTAMGAITGGGNQGTEGDLIPLNSSNTNDVEGGQVYDNEK-DSVSYSYSYCH  383

Query  378  IIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFP  199
             IF+LAS+Y  M +T W +   +   L +   AS+WV++V+ WV   L+ W++VAP +FP
Sbjct  384  FIFALASLYIMMTMTSWYSPDNDITHL-NSNTASLWVKIVSSWVAVLLYFWTMVAPTIFP  442

Query  198  DRDF  187
            DR+F
Sbjct  443  DREF  446



>ref|XP_005079567.1| PREDICTED: serine incorporator 2 isoform X1 [Mesocricetus auratus]
Length=450

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 10/97 (10%)
 Frame = -1

Query  453  PLDKADEHEEM--------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  298
            PLD   + +           +   VTYSYSFFH    LAS++  M LT W  S GE+ K+
Sbjct  355  PLDTVQQQQVAVSEGRAYDNEQDGVTYSYSFFHFCLLLASLHVMMTLTNW-YSPGETRKM  413

Query  297  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +   W SVWV++   W    L+LW+LVAP+L P+RDF
Sbjct  414  IST-WTSVWVKICASWAGLLLYLWTLVAPLLLPNRDF  449



>ref|XP_003136987.1| hypothetical protein LOAG_01400 [Loa loa]
 gb|EFO27079.1| hypothetical protein LOAG_01400 [Loa loa]
Length=456

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (54%), Gaps = 18/115 (16%)
 Frame = -1

Query  480  RAGGGKPLLPLDKADEHEEM-----------------EKSKAVTYSYSFFHIIFSLASMY  352
            +  GG P   +D AD   +                  ++S AV+YSYSFFH +F LAS+Y
Sbjct  342  KIAGGSPHGVVDDADNGSQQHIITPIEDNLERGRIWDDESDAVSYSYSFFHFVFGLASLY  401

Query  351  SAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
              M LT W     +   L +   A+VWV++V+ W+  A++ W+L AP +FPDRDF
Sbjct  402  VMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCLAIYAWTLAAPAIFPDRDF  455



>ref|XP_003102359.1| hypothetical protein CRE_05000 [Caenorhabditis remanei]
 gb|EFP05978.1| hypothetical protein CRE_05000 [Caenorhabditis remanei]
Length=441

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 5/86 (6%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            KA ++EE    + V YSYSFFH +F LAS+Y  M LT W     +   L +   ASVW++
Sbjct  361  KAWDNEE----EGVAYSYSFFHFMFCLASLYVMMTLTSWYHPDSDLAHL-NSNMASVWIK  415

Query  264  VVTGWVTAALFLWSLVAPILFPDRDF  187
            + + W+ A L+ W+LVAPI+FPDR+F
Sbjct  416  IFSSWICAGLYSWTLVAPIIFPDREF  441



>gb|EJW79555.1| serine incorporator 2 [Wuchereria bancrofti]
Length=414

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
            ++S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  
Sbjct  337  DESDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCL  395

Query  240  ALFLWSLVAPILFPDRDF  187
            A++ W+L AP LFPDRDF
Sbjct  396  AIYAWTLAAPALFPDRDF  413



>ref|XP_010469508.1| PREDICTED: probable serine incorporator isoform X3 [Camelina 
sativa]
Length=423

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            + DE +E E    + YSY FFH++FSL +MY AML   W+ S       +DVGW S WV+
Sbjct  329  RKDEAKEEED---IPYSYGFFHLVFSLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVK  385

Query  264  VVTGWVTAALFLWSLVAPILFPDR  193
            +V  W  AA++LW L++PI+   R
Sbjct  386  IVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_010469504.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469505.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
 ref|XP_010469506.1| PREDICTED: probable serine incorporator isoform X1 [Camelina 
sativa]
Length=425

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            + DE +E E    + YSY FFH++FSL +MY AML   W+ S       +DVGW S WV+
Sbjct  331  RKDEAKEEED---IPYSYGFFHLVFSLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVK  387

Query  264  VVTGWVTAALFLWSLVAPILFPDR  193
            +V  W  AA++LW L++PI+   R
Sbjct  388  IVNEWFAAAIYLWKLISPIVRQPR  411



>ref|XP_010532841.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532842.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532843.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
 ref|XP_010532844.1| PREDICTED: probable serine incorporator [Tarenaya hassleriana]
Length=402

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -1

Query  435  EHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVT  256
              E+ +  +A+ Y Y FFH++F+  +MY AMLL GW+T        +DVGW S WVRVV 
Sbjct  316  RKEDNQDEEALPYGYGFFHLVFATGAMYFAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVN  375

Query  255  GWVTAALFLWSLVAPILFPDRD  190
             W+   +++W LVAP++   R 
Sbjct  376  EWLAVCIYIWMLVAPLVLKSRQ  397



>ref|XP_005079568.1| PREDICTED: serine incorporator 2 isoform X2 [Mesocricetus auratus]
 ref|XP_005079569.1| PREDICTED: serine incorporator 2 isoform X3 [Mesocricetus auratus]
Length=395

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 10/97 (10%)
 Frame = -1

Query  453  PLDKADEHEEM--------EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKL  298
            PLD   + +           +   VTYSYSFFH    LAS++  M LT W  S GE+ K+
Sbjct  300  PLDTVQQQQVAVSEGRAYDNEQDGVTYSYSFFHFCLLLASLHVMMTLTNW-YSPGETRKM  358

Query  297  VDVGWASVWVRVVTGWVTAALFLWSLVAPILFPDRDF  187
            +   W SVWV++   W    L+LW+LVAP+L P+RDF
Sbjct  359  IST-WTSVWVKICASWAGLLLYLWTLVAPLLLPNRDF  394



>ref|XP_001901605.1| TDE2 protein [Brugia malayi]
 emb|CDP98608.1| Protein Bm6897, isoform d [Brugia malayi]
Length=455

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 53/78 (68%), Gaps = 1/78 (1%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVRVVTGWVTA  241
            ++S AV+YSYSFFH +F LAS+Y  M LT W     +   L +   A+VWV++V+ W+  
Sbjct  378  DESDAVSYSYSFFHFVFGLASLYVMMTLTCWYKPDSDLRHL-NSNMAAVWVKIVSSWLCL  436

Query  240  ALFLWSLVAPILFPDRDF  187
            A++ W+L AP LFPDRDF
Sbjct  437  AIYAWTLAAPALFPDRDF  454



>ref|XP_010469507.1| PREDICTED: probable serine incorporator isoform X2 [Camelina 
sativa]
Length=423

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 3/84 (4%)
 Frame = -1

Query  444  KADEHEEMEKSKAVTYSYSFFHIIFSLASMYSAMLLTGWSTSVGESGKLVDVGWASVWVR  265
            + DE +E E    + YSY FFH++FSL +MY AML   W+ S       +DVGW S WV+
Sbjct  329  RKDEAKEEED---IPYSYGFFHLVFSLGAMYFAMLFISWNLSHSSREWSIDVGWTSTWVK  385

Query  264  VVTGWVTAALFLWSLVAPILFPDR  193
            +V  W  AA++LW L++PI+   R
Sbjct  386  IVNEWFAAAIYLWKLISPIVRQPR  409



>ref|XP_007318557.1| hypothetical protein SERLADRAFT_356127 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN98949.1| hypothetical protein SERLA73DRAFT_108164 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24538.1| hypothetical protein SERLADRAFT_356127 [Serpula lacrymans var. 
lacrymans S7.9]
Length=494

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 5/81 (6%)
 Frame = -1

Query  420  EKSKAVTYSYSFFHIIFSLASMYSAMLLTGW---STSVGESGKLVDVGWA--SVWVRVVT  256
            ++     Y+YS+FHIIF++ +MY AMLLT W   ST  GES ++V +G +  ++W+RVV+
Sbjct  410  DERTGTRYNYSWFHIIFAIGAMYVAMLLTDWNVVSTEQGESEEIVYIGRSETAMWMRVVS  469

Query  255  GWVTAALFLWSLVAPILFPDR  193
             WV   L++WSL+AP+L PDR
Sbjct  470  SWVCMILYMWSLLAPVLMPDR  490



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515