BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043P17

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364689.1|  PREDICTED: probably inactive leucine-rich re...    277   1e-83   Solanum tuberosum [potatoes]
ref|XP_004247993.1|  PREDICTED: probably inactive leucine-rich re...    277   2e-83   Solanum lycopersicum
ref|XP_003552656.1|  PREDICTED: probably inactive leucine-rich re...    275   9e-83   Glycine max [soybeans]
gb|KHN13843.1|  Probably inactive leucine-rich repeat receptor-li...    275   9e-83   Glycine soja [wild soybean]
emb|CAN70282.1|  hypothetical protein VITISV_023081                     259   1e-82   Vitis vinifera
ref|XP_009589224.1|  PREDICTED: probably inactive leucine-rich re...    273   2e-82   
ref|XP_009589223.1|  PREDICTED: probably inactive leucine-rich re...    274   2e-82   Nicotiana tomentosiformis
ref|XP_009765958.1|  PREDICTED: probably inactive leucine-rich re...    273   4e-82   Nicotiana sylvestris
gb|KHN27185.1|  Probably inactive leucine-rich repeat receptor-li...    273   5e-82   Glycine soja [wild soybean]
ref|XP_003518672.1|  PREDICTED: probably inactive leucine-rich re...    273   5e-82   Glycine max [soybeans]
gb|KDP37890.1|  hypothetical protein JCGZ_05772                         271   1e-81   Jatropha curcas
ref|XP_011073820.1|  PREDICTED: probably inactive leucine-rich re...    271   2e-81   Sesamum indicum [beniseed]
ref|XP_007139297.1|  hypothetical protein PHAVU_008G017400g             271   2e-81   Phaseolus vulgaris [French bean]
ref|XP_007034091.1|  Leucine-rich receptor-like protein kinase fa...    271   3e-81   
ref|XP_010023583.1|  PREDICTED: probably inactive leucine-rich re...    270   4e-81   Eucalyptus grandis [rose gum]
ref|XP_002321093.1|  leucine-rich repeat transmembrane protein ki...    269   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_002518223.1|  receptor protein kinase, putative                  268   2e-80   Ricinus communis
gb|KJB37929.1|  hypothetical protein B456_006G227000                    268   2e-80   Gossypium raimondii
ref|XP_011000023.1|  PREDICTED: probably inactive leucine-rich re...    268   3e-80   Populus euphratica
emb|CDP14623.1|  unnamed protein product                                266   2e-79   Coffea canephora [robusta coffee]
ref|XP_002265846.1|  PREDICTED: probably inactive leucine-rich re...    265   3e-79   Vitis vinifera
gb|KHG00472.1|  hypothetical protein F383_20103                         265   4e-79   Gossypium arboreum [tree cotton]
ref|XP_010107246.1|  Probably inactive leucine-rich repeat recept...    265   4e-79   
ref|XP_003621730.1|  Probably inactive leucine-rich repeat recept...    265   4e-79   Medicago truncatula
ref|XP_004492049.1|  PREDICTED: probably inactive leucine-rich re...    265   4e-79   Cicer arietinum [garbanzo]
ref|XP_009371148.1|  PREDICTED: probably inactive leucine-rich re...    262   4e-78   Pyrus x bretschneideri [bai li]
gb|EYU32740.1|  hypothetical protein MIMGU_mgv1a000860mg                261   4e-78   Erythranthe guttata [common monkey flower]
ref|XP_002302895.2|  leucine-rich repeat transmembrane protein ki...    261   5e-78   
ref|XP_010268319.1|  PREDICTED: probably inactive leucine-rich re...    261   8e-78   Nelumbo nucifera [Indian lotus]
ref|XP_004296675.1|  PREDICTED: probably inactive leucine-rich re...    261   9e-78   Fragaria vesca subsp. vesca
ref|XP_006421080.1|  hypothetical protein CICLE_v10004238mg             260   2e-77   Citrus clementina [clementine]
gb|KDO44075.1|  hypothetical protein CISIN_1g0027171mg                  258   2e-77   Citrus sinensis [apfelsine]
ref|XP_006494521.1|  PREDICTED: probably inactive leucine-rich re...    259   3e-77   Citrus sinensis [apfelsine]
gb|KDO44074.1|  hypothetical protein CISIN_1g0027171mg                  258   3e-77   Citrus sinensis [apfelsine]
ref|XP_003621710.1|  Receptor-like protein kinase                       259   4e-77   
ref|XP_008337525.1|  PREDICTED: probably inactive leucine-rich re...    259   5e-77   Malus domestica [apple tree]
ref|XP_011042759.1|  PREDICTED: probably inactive leucine-rich re...    258   9e-77   Populus euphratica
ref|XP_003621722.1|  Receptor-like kinase                               255   2e-76   
gb|AES77940.2|  tyrosine kinase family protein                          252   2e-76   Medicago truncatula
ref|XP_010673272.1|  PREDICTED: probably inactive leucine-rich re...    256   4e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007225370.1|  hypothetical protein PRUPE_ppa000838mg             253   4e-75   
ref|XP_008244427.1|  PREDICTED: probably inactive leucine-rich re...    251   4e-74   Prunus mume [ume]
ref|XP_010929848.1|  PREDICTED: probably inactive leucine-rich re...    249   2e-73   Elaeis guineensis
ref|XP_004156987.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    247   8e-73   
ref|XP_004152295.1|  PREDICTED: probably inactive leucine-rich re...    247   8e-73   Cucumis sativus [cucumbers]
ref|XP_008453972.1|  PREDICTED: probably inactive leucine-rich re...    246   1e-72   Cucumis melo [Oriental melon]
ref|XP_008776998.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    246   1e-72   
ref|XP_010528265.1|  PREDICTED: probably inactive leucine-rich re...    245   3e-72   Tarenaya hassleriana [spider flower]
ref|XP_009403616.1|  PREDICTED: probably inactive leucine-rich re...    238   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406353.1|  PREDICTED: probably inactive leucine-rich re...    234   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415955.1|  PREDICTED: probably inactive leucine-rich re...    233   7e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010555906.1|  PREDICTED: probably inactive leucine-rich re...    233   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_010555905.1|  PREDICTED: probably inactive leucine-rich re...    232   1e-67   Tarenaya hassleriana [spider flower]
emb|CDX85183.1|  BnaC07g24940D                                          232   2e-67   
gb|EPS70115.1|  hypothetical protein M569_04636                         230   6e-67   Genlisea aurea
ref|XP_009151898.1|  PREDICTED: probably inactive leucine-rich re...    227   1e-65   Brassica rapa
gb|KFK33718.1|  hypothetical protein AALP_AA5G051000                    227   1e-65   Arabis alpina [alpine rockcress]
ref|XP_010514517.1|  PREDICTED: probably inactive leucine-rich re...    226   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010425587.1|  PREDICTED: probably inactive leucine-rich re...    225   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010502811.1|  PREDICTED: probably inactive leucine-rich re...    225   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006290541.1|  hypothetical protein CARUB_v10016623mg             225   5e-65   Capsella rubella
ref|NP_189443.2|  probably inactive leucine-rich repeat receptor-...    225   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045445.1|  Os01g0957100                                       224   1e-64   
dbj|BAB92869.1|  putative receptor-like protein kinase                  224   1e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EAY77289.1|  hypothetical protein OsI_05265                          224   2e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_006395381.1|  hypothetical protein EUTSA_v10003580mg             223   2e-64   Eutrema salsugineum [saltwater cress]
ref|XP_009111587.1|  PREDICTED: probably inactive leucine-rich re...    223   2e-64   Brassica rapa
ref|XP_002875419.1|  hypothetical protein ARALYDRAFT_484589             223   3e-64   
emb|CDY20032.1|  BnaA09g02190D                                          223   5e-64   Brassica napus [oilseed rape]
emb|CDY00141.1|  BnaC09g01600D                                          219   6e-63   
ref|XP_006646695.1|  PREDICTED: probably inactive leucine-rich re...    218   2e-62   Oryza brachyantha
ref|XP_004971314.1|  PREDICTED: probably inactive leucine-rich re...    209   5e-59   Setaria italica
emb|CAN76686.1|  hypothetical protein VITISV_005469                     185   7e-56   Vitis vinifera
ref|XP_001769840.1|  predicted protein                                  199   9e-56   
ref|XP_001771841.1|  predicted protein                                  196   2e-54   
dbj|BAF79960.1|  receptor-like kinase                                   194   5e-54   Marchantia polymorpha
ref|XP_002459131.1|  hypothetical protein SORBIDRAFT_03g046350          192   5e-53   
ref|XP_009349085.1|  PREDICTED: probably inactive leucine-rich re...    191   9e-53   Pyrus x bretschneideri [bai li]
ref|XP_009362809.1|  PREDICTED: probably inactive leucine-rich re...    191   9e-53   Pyrus x bretschneideri [bai li]
ref|XP_002275275.1|  PREDICTED: probably inactive leucine-rich re...    191   1e-52   Vitis vinifera
ref|XP_004502826.1|  PREDICTED: probably inactive leucine-rich re...    191   1e-52   Cicer arietinum [garbanzo]
emb|CDP13903.1|  unnamed protein product                                190   1e-52   Coffea canephora [robusta coffee]
ref|NP_001239730.1|  probably inactive leucine-rich repeat recept...    191   1e-52   Glycine max [soybeans]
ref|XP_003522510.2|  PREDICTED: probably inactive leucine-rich re...    191   1e-52   Glycine max [soybeans]
ref|NP_001136621.1|  uncharacterized protein LOC100216746               184   2e-52   
ref|XP_007220278.1|  hypothetical protein PRUPE_ppa000889mg             190   2e-52   
ref|XP_008233886.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    190   2e-52   Prunus mume [ume]
ref|XP_009789234.1|  PREDICTED: probably inactive leucine-rich re...    190   2e-52   Nicotiana sylvestris
ref|XP_011076585.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    190   3e-52   Sesamum indicum [beniseed]
ref|XP_010067617.1|  PREDICTED: probably inactive leucine-rich re...    189   3e-52   Eucalyptus grandis [rose gum]
gb|KJB73018.1|  hypothetical protein B456_011G209800                    189   3e-52   Gossypium raimondii
ref|XP_010670069.1|  PREDICTED: probably inactive leucine-rich re...    189   3e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004308984.1|  PREDICTED: probably inactive leucine-rich re...    189   3e-52   Fragaria vesca subsp. vesca
ref|XP_007136420.1|  hypothetical protein PHAVU_009G043600g             189   3e-52   Phaseolus vulgaris [French bean]
ref|XP_008369373.1|  PREDICTED: probably inactive leucine-rich re...    189   4e-52   
gb|KHG09451.1|  hypothetical protein F383_09289                         189   4e-52   Gossypium arboreum [tree cotton]
ref|XP_009363794.1|  PREDICTED: probably inactive leucine-rich re...    189   5e-52   Pyrus x bretschneideri [bai li]
ref|XP_011084816.1|  PREDICTED: probably inactive leucine-rich re...    189   7e-52   Sesamum indicum [beniseed]
ref|XP_010253073.1|  PREDICTED: probably inactive leucine-rich re...    189   7e-52   Nelumbo nucifera [Indian lotus]
ref|XP_007011288.1|  Leucine-rich repeat protein kinase family pr...    189   7e-52   
ref|XP_006357297.1|  PREDICTED: probably inactive leucine-rich re...    189   7e-52   Solanum tuberosum [potatoes]
ref|XP_002319878.2|  leucine-rich repeat transmembrane protein ki...    188   1e-51   Populus trichocarpa [western balsam poplar]
gb|ACO55044.1|  receptor-like kinase                                    175   1e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002325929.2|  leucine-rich repeat transmembrane protein ki...    188   1e-51   
ref|XP_006435929.1|  hypothetical protein CICLE_v10030625mg             188   1e-51   
ref|XP_009757206.1|  PREDICTED: probably inactive leucine-rich re...    187   1e-51   Nicotiana sylvestris
ref|XP_009623562.1|  PREDICTED: probably inactive leucine-rich re...    187   1e-51   Nicotiana tomentosiformis
gb|KEH35536.1|  leucine-rich receptor-like kinase family protein        188   1e-51   Medicago truncatula
ref|XP_011001391.1|  PREDICTED: probably inactive leucine-rich re...    187   1e-51   Populus euphratica
ref|XP_006486161.1|  PREDICTED: probably inactive leucine-rich re...    187   2e-51   Citrus sinensis [apfelsine]
ref|XP_004241084.1|  PREDICTED: probably inactive leucine-rich re...    187   2e-51   Solanum lycopersicum
emb|CAE54285.1|  receptor-like kinase with LRR repeats                  174   2e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011095143.1|  PREDICTED: probably inactive leucine-rich re...    187   3e-51   Sesamum indicum [beniseed]
ref|XP_002520879.1|  ATP binding protein, putative                      187   3e-51   Ricinus communis
emb|CBI25352.3|  unnamed protein product                                186   3e-51   Vitis vinifera
ref|XP_008655312.1|  PREDICTED: uncharacterized protein LOC100384...    187   3e-51   Zea mays [maize]
gb|KDP21644.1|  hypothetical protein JCGZ_03315                         186   5e-51   Jatropha curcas
ref|XP_010092789.1|  Probably inactive leucine-rich repeat recept...    186   6e-51   Morus notabilis
ref|XP_009614707.1|  PREDICTED: probably inactive leucine-rich re...    186   6e-51   Nicotiana tomentosiformis
ref|XP_011010876.1|  PREDICTED: probably inactive leucine-rich re...    186   7e-51   Populus euphratica
ref|XP_008244834.1|  PREDICTED: probably inactive leucine-rich re...    186   7e-51   Prunus mume [ume]
ref|XP_011010875.1|  PREDICTED: probably inactive leucine-rich re...    186   8e-51   Populus euphratica
ref|XP_008456960.1|  PREDICTED: probably inactive leucine-rich re...    185   9e-51   Cucumis melo [Oriental melon]
ref|XP_004173628.1|  PREDICTED: probably inactive leucine-rich re...    184   1e-50   
ref|XP_007207150.1|  hypothetical protein PRUPE_ppa000904mg             185   1e-50   Prunus persica
ref|XP_004246289.1|  PREDICTED: probably inactive leucine-rich re...    185   1e-50   Solanum lycopersicum
gb|KJB67929.1|  hypothetical protein B456_010G218400                    185   1e-50   Gossypium raimondii
ref|XP_006842493.1|  hypothetical protein AMTR_s00077p00091370          185   1e-50   Amborella trichopoda
gb|KHG03607.1|  hypothetical protein F383_26757                         185   2e-50   Gossypium arboreum [tree cotton]
ref|XP_004146470.1|  PREDICTED: probably inactive leucine-rich re...    184   2e-50   Cucumis sativus [cucumbers]
ref|XP_009406870.1|  PREDICTED: probably inactive leucine-rich re...    184   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN33819.1|  unknown                                                 185   2e-50   Zea mays [maize]
ref|XP_002267737.3|  PREDICTED: probably inactive leucine-rich re...    184   2e-50   Vitis vinifera
ref|XP_010103654.1|  Probably inactive leucine-rich repeat recept...    184   3e-50   Morus notabilis
ref|XP_009793754.1|  PREDICTED: probably inactive leucine-rich re...    184   3e-50   Nicotiana sylvestris
gb|EYU42026.1|  hypothetical protein MIMGU_mgv1a000905mg                184   3e-50   Erythranthe guttata [common monkey flower]
ref|XP_004240861.1|  PREDICTED: probably inactive leucine-rich re...    183   3e-50   Solanum lycopersicum
ref|XP_009372024.1|  PREDICTED: probably inactive leucine-rich re...    184   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_010253067.1|  PREDICTED: probably inactive leucine-rich re...    184   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008672259.1|  PREDICTED: uncharacterized protein LOC100216...    184   4e-50   
ref|XP_006341303.1|  PREDICTED: probably inactive leucine-rich re...    184   4e-50   Solanum tuberosum [potatoes]
ref|XP_010525412.1|  PREDICTED: probably inactive leucine-rich re...    184   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_009416321.1|  PREDICTED: probably inactive leucine-rich re...    183   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002528692.1|  Brassinosteroid LRR receptor kinase precurso...    183   5e-50   Ricinus communis
gb|KDO64103.1|  hypothetical protein CISIN_1g002094mg                   183   7e-50   Citrus sinensis [apfelsine]
gb|EYU35201.1|  hypothetical protein MIMGU_mgv1a000839mg                183   7e-50   Erythranthe guttata [common monkey flower]
ref|XP_006481196.1|  PREDICTED: probably inactive leucine-rich re...    183   7e-50   Citrus sinensis [apfelsine]
ref|XP_006429586.1|  hypothetical protein CICLE_v10010994mg             183   7e-50   
ref|XP_007033525.1|  Leucine-rich receptor-like protein kinase fa...    182   9e-50   
ref|XP_006358746.1|  PREDICTED: probably inactive leucine-rich re...    182   1e-49   Solanum tuberosum [potatoes]
ref|XP_010043193.1|  PREDICTED: probably inactive leucine-rich re...    182   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010683484.1|  PREDICTED: probably inactive leucine-rich re...    182   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008370260.1|  PREDICTED: probably inactive leucine-rich re...    182   2e-49   
ref|XP_009125388.1|  PREDICTED: probably inactive leucine-rich re...    181   2e-49   Brassica rapa
emb|CDY04822.1|  BnaAnng00040D                                          181   2e-49   
ref|XP_006279331.1|  hypothetical protein CARUB_v10012717mg             181   3e-49   Capsella rubella
ref|XP_004984462.1|  PREDICTED: probably inactive leucine-rich re...    181   3e-49   Setaria italica
ref|XP_006840189.1|  hypothetical protein AMTR_s00089p00108500          181   3e-49   
ref|XP_002309183.1|  hypothetical protein POPTR_0006s10910g             181   3e-49   
gb|KDP21865.1|  hypothetical protein JCGZ_00652                         179   4e-49   Jatropha curcas
ref|XP_006650049.1|  PREDICTED: probably inactive leucine-rich re...    181   5e-49   Oryza brachyantha
ref|XP_009416322.1|  PREDICTED: probably inactive leucine-rich re...    180   5e-49   
gb|KHN40633.1|  Probably inactive leucine-rich repeat receptor-li...    178   5e-49   Glycine soja [wild soybean]
ref|XP_002467905.1|  hypothetical protein SORBIDRAFT_01g036160          181   6e-49   Sorghum bicolor [broomcorn]
ref|XP_008456780.1|  PREDICTED: probably inactive leucine-rich re...    180   6e-49   Cucumis melo [Oriental melon]
dbj|BAK06250.1|  predicted protein                                      180   8e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010424006.1|  PREDICTED: probably inactive leucine-rich re...    180   8e-49   
ref|XP_004173348.1|  PREDICTED: probably inactive leucine-rich re...    180   8e-49   
ref|XP_004138394.1|  PREDICTED: probably inactive leucine-rich re...    180   8e-49   Cucumis sativus [cucumbers]
ref|XP_011002596.1|  PREDICTED: probably inactive leucine-rich re...    180   8e-49   Populus euphratica
ref|XP_010424007.1|  PREDICTED: probably inactive leucine-rich re...    180   9e-49   
ref|XP_010451924.1|  PREDICTED: probably inactive leucine-rich re...    180   9e-49   
ref|XP_002323672.2|  hypothetical protein POPTR_0016s14410g             180   1e-48   Populus trichocarpa [western balsam poplar]
gb|KFK24685.1|  hypothetical protein AALP_AA8G011600                    180   1e-48   Arabis alpina [alpine rockcress]
emb|CBI18033.3|  unnamed protein product                                178   1e-48   Vitis vinifera
ref|XP_010490496.1|  PREDICTED: probably inactive leucine-rich re...    179   1e-48   
ref|XP_004492560.1|  PREDICTED: probably inactive leucine-rich re...    179   1e-48   Cicer arietinum [garbanzo]
ref|XP_002870895.1|  hypothetical protein ARALYDRAFT_486880             179   1e-48   
ref|XP_006290555.1|  hypothetical protein CARUB_v10016642mg             179   2e-48   
gb|EPS70735.1|  hypothetical protein M569_04020                         179   2e-48   Genlisea aurea
ref|NP_195809.1|  leucine-rich receptor-like protein kinase             179   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AES79844.2|  LRR receptor-like kinase family protein                 179   2e-48   Medicago truncatula
ref|XP_006290556.1|  hypothetical protein CARUB_v10016642mg             179   2e-48   Capsella rubella
ref|XP_003623626.1|  Receptor-like protein kinase                       179   2e-48   
ref|XP_009116341.1|  PREDICTED: probably inactive leucine-rich re...    179   3e-48   Brassica rapa
ref|XP_007134722.1|  hypothetical protein PHAVU_010G070400g             177   3e-48   Phaseolus vulgaris [French bean]
ref|XP_010938277.1|  PREDICTED: probably inactive leucine-rich re...    176   3e-48   
gb|EEC75203.1|  hypothetical protein OsI_11455                          178   4e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_008359946.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    179   4e-48   
gb|EAZ26832.1|  hypothetical protein OsJ_10748                          178   4e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050035.1|  Os03g0335500                                       178   4e-48   
ref|XP_002878081.1|  hypothetical protein ARALYDRAFT_907079             178   4e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_006644919.1|  PREDICTED: probably inactive leucine-rich re...    177   5e-48   Oryza brachyantha
gb|KHM99411.1|  Probably inactive leucine-rich repeat receptor-li...    176   5e-48   Glycine soja [wild soybean]
ref|XP_010427454.1|  PREDICTED: probably inactive leucine-rich re...    178   5e-48   
ref|XP_011019007.1|  PREDICTED: probably inactive leucine-rich re...    178   5e-48   Populus euphratica
ref|XP_011019006.1|  PREDICTED: probably inactive leucine-rich re...    178   5e-48   Populus euphratica
ref|XP_010504542.1|  PREDICTED: probably inactive leucine-rich re...    178   5e-48   Camelina sativa [gold-of-pleasure]
gb|KHN11868.1|  Probably inactive leucine-rich repeat receptor-li...    177   7e-48   Glycine soja [wild soybean]
ref|XP_003516434.1|  PREDICTED: probably inactive leucine-rich re...    177   7e-48   Glycine max [soybeans]
ref|XP_007140080.1|  hypothetical protein PHAVU_008G082500g             177   7e-48   Phaseolus vulgaris [French bean]
ref|XP_006398567.1|  hypothetical protein EUTSA_v10012579mg             177   7e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002972654.1|  hypothetical protein SELMODRAFT_98598              177   8e-48   Selaginella moellendorffii
ref|NP_191196.1|  leucine-rich repeat protein kinase-like protein       177   8e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAL49790.1|  unknown protein                                         177   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305081.1|  PREDICTED: probably inactive leucine-rich re...    177   8e-48   Fragaria vesca subsp. vesca
ref|XP_007134721.1|  hypothetical protein PHAVU_010G070400g             177   8e-48   Phaseolus vulgaris [French bean]
ref|XP_003533657.2|  PREDICTED: probably inactive leucine-rich re...    177   9e-48   Glycine max [soybeans]
gb|EEE55595.1|  hypothetical protein OsJ_03900                          175   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76307.1|  hypothetical protein OsI_04242                          177   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_010412798.1|  PREDICTED: probably inactive leucine-rich re...    177   1e-47   
ref|NP_001044651.1|  Os01g0821900                                       175   1e-47   
gb|EMT18823.1|  Putative LRR receptor-like serine/threonine-prote...    176   2e-47   
ref|XP_002988156.1|  hypothetical protein SELMODRAFT_40688              176   2e-47   
ref|XP_003521989.1|  PREDICTED: probably inactive leucine-rich re...    176   2e-47   Glycine max [soybeans]
ref|XP_002458686.1|  hypothetical protein SORBIDRAFT_03g038240          176   2e-47   Sorghum bicolor [broomcorn]
gb|EMT15869.1|  Putative LRR receptor-like serine/threonine-prote...    175   2e-47   
ref|XP_003557968.1|  PREDICTED: probably inactive leucine-rich re...    176   2e-47   Brachypodium distachyon [annual false brome]
ref|NP_001142419.1|  uncharacterized protein LOC100274594               172   2e-47   
ref|XP_006402993.1|  hypothetical protein EUTSA_v10005773mg             176   3e-47   Eutrema salsugineum [saltwater cress]
gb|KJB71525.1|  hypothetical protein B456_011G127000                    176   3e-47   Gossypium raimondii
gb|KFK34877.1|  Leucine-rich repeat protein kinase family protein       176   3e-47   Arabis alpina [alpine rockcress]
dbj|BAB85306.1|  putative receptor-like protein kinase                  175   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010931370.1|  PREDICTED: probably inactive leucine-rich re...    175   4e-47   Elaeis guineensis
ref|XP_004970391.1|  PREDICTED: probably inactive leucine-rich re...    175   5e-47   Setaria italica
ref|XP_003567498.1|  PREDICTED: probably inactive leucine-rich re...    175   6e-47   Brachypodium distachyon [annual false brome]
ref|XP_008792235.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    175   6e-47   
emb|CDY27220.1|  BnaA09g35820D                                          174   9e-47   Brassica napus [oilseed rape]
ref|XP_008442319.1|  PREDICTED: probably inactive leucine-rich re...    174   1e-46   Cucumis melo [Oriental melon]
ref|XP_010921154.1|  PREDICTED: probably inactive leucine-rich re...    174   2e-46   
ref|XP_010922754.1|  PREDICTED: probably inactive leucine-rich re...    174   2e-46   Elaeis guineensis
ref|XP_010921155.1|  PREDICTED: probably inactive leucine-rich re...    173   2e-46   
ref|XP_004137674.1|  PREDICTED: probably inactive leucine-rich re...    173   2e-46   Cucumis sativus [cucumbers]
emb|CDX72142.1|  BnaC08g27320D                                          173   2e-46   
tpg|DAA57062.1|  TPA: putative leucine-rich repeat receptor-like ...    172   4e-46   
ref|NP_001159235.1|  uncharacterized protein LOC100304322               164   7e-46   
ref|XP_004514781.1|  PREDICTED: probably inactive leucine-rich re...    171   2e-45   
ref|XP_003605286.1|  Receptor-like protein kinase                       169   2e-45   Medicago truncatula
ref|XP_008788529.1|  PREDICTED: probably inactive leucine-rich re...    170   3e-45   Phoenix dactylifera
dbj|BAJ85468.1|  predicted protein                                      167   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008681357.1|  PREDICTED: uncharacterized protein LOC100304...    167   3e-44   
ref|XP_006655414.1|  PREDICTED: probably inactive leucine-rich re...    165   5e-44   Oryza brachyantha
emb|CDY70210.1|  BnaAnng32980D                                          155   1e-43   Brassica napus [oilseed rape]
gb|EMT15187.1|  Putative LRR receptor-like serine/threonine-prote...    159   1e-43   
ref|XP_002990711.1|  hypothetical protein SELMODRAFT_132189             165   1e-43   
ref|XP_009402208.1|  PREDICTED: probably inactive leucine-rich re...    164   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003621709.1|  Probably inactive leucine-rich repeat recept...    150   6e-43   
emb|CDY42780.1|  BnaC01g22860D                                          152   2e-42   Brassica napus [oilseed rape]
emb|CDX96323.1|  BnaA07g29340D                                          151   4e-42   
ref|XP_010553156.1|  PREDICTED: probably inactive leucine-rich re...    160   6e-42   Tarenaya hassleriana [spider flower]
ref|XP_010232495.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    160   9e-42   Brachypodium distachyon [annual false brome]
emb|CDY68115.1|  BnaC01g42200D                                          147   3e-41   Brassica napus [oilseed rape]
gb|KJB25688.1|  hypothetical protein B456_004G204100                    156   2e-40   Gossypium raimondii
gb|AAF88073.1|AC025417_1  T12C24.1                                      147   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KHF98277.1|  hypothetical protein F383_15451                         156   2e-40   Gossypium arboreum [tree cotton]
ref|XP_004961741.1|  PREDICTED: probably inactive leucine-rich re...    156   2e-40   
ref|XP_010546137.1|  PREDICTED: probable LRR receptor-like serine...    156   2e-40   
ref|XP_002509644.1|  leucine-rich repeat transmembrane protein ki...    155   3e-40   Ricinus communis
ref|XP_002439964.1|  hypothetical protein SORBIDRAFT_09g023480          155   6e-40   Sorghum bicolor [broomcorn]
ref|XP_007040033.1|  Leucine-rich repeat protein kinase family pr...    153   6e-40   
gb|KDO63698.1|  hypothetical protein CISIN_1g002759mg                   154   7e-40   Citrus sinensis [apfelsine]
ref|XP_006477322.1|  PREDICTED: probable LRR receptor-like serine...    154   8e-40   Citrus sinensis [apfelsine]
ref|XP_006440456.1|  hypothetical protein CICLE_v10018802mg             154   8e-40   Citrus clementina [clementine]
ref|XP_007040031.1|  Leucine-rich repeat protein kinase family pr...    154   1e-39   
ref|XP_004147984.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-39   Cucumis sativus [cucumbers]
ref|XP_004170853.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-39   
ref|XP_007040030.1|  Leucine-rich repeat protein kinase family pr...    154   1e-39   
ref|XP_008448931.1|  PREDICTED: probable LRR receptor-like serine...    153   2e-39   Cucumis melo [Oriental melon]
ref|XP_010276110.1|  PREDICTED: probable LRR receptor-like serine...    153   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_002991210.1|  hypothetical protein SELMODRAFT_236225             152   4e-39   
ref|XP_002991272.1|  hypothetical protein SELMODRAFT_236241             152   5e-39   
ref|XP_001759642.1|  predicted protein                                  150   2e-38   
ref|XP_002303543.1|  leucine-rich repeat transmembrane protein ki...    150   2e-38   
ref|XP_002299581.2|  leucine-rich repeat transmembrane protein ki...    150   2e-38   
ref|XP_010919178.1|  PREDICTED: probable LRR receptor-like serine...    150   3e-38   Elaeis guineensis
dbj|BAH20406.1|  AT1G12460                                              148   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400469.1|  PREDICTED: probable LRR receptor-like serine...    150   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010933925.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-38   Elaeis guineensis
ref|XP_010462668.1|  PREDICTED: probable LRR receptor-like serine...    149   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_011015430.1|  PREDICTED: probable LRR receptor-like serine...    149   5e-38   
ref|XP_011033860.1|  PREDICTED: probable LRR receptor-like serine...    149   5e-38   
gb|KDP25570.1|  hypothetical protein JCGZ_20726                         149   5e-38   
gb|AAO22764.1|  putative leucine-rich repeat transmembrane protei...    149   6e-38   
ref|NP_172708.1|  putative LRR receptor-like serine/threonine-pro...    149   6e-38   
gb|AAF79640.1|AC025416_14  F5O11.21                                     149   7e-38   
ref|XP_004298715.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-37   
ref|XP_010476218.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-37   
ref|XP_011029116.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-37   
gb|KFK43514.1|  hypothetical protein AALP_AA1G135400                    148   2e-37   
ref|XP_010108089.1|  putative LRR receptor-like serine/threonine-...    148   2e-37   
gb|EEE64100.1|  hypothetical protein OsJ_18931                          147   2e-37   
ref|XP_006391803.1|  hypothetical protein EUTSA_v10023252mg             147   2e-37   
ref|NP_001055847.2|  Os05g0478300                                       147   2e-37   
ref|XP_008803301.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-37   
ref|XP_002889936.1|  hypothetical protein ARALYDRAFT_888571             147   3e-37   
gb|KHG18414.1|  hypothetical protein F383_21876                         147   4e-37   
ref|XP_008649763.1|  PREDICTED: probably inactive leucine-rich re...    147   4e-37   
ref|XP_009373339.1|  PREDICTED: probable LRR receptor-like serine...    147   4e-37   
ref|XP_008373864.1|  PREDICTED: probable LRR receptor-like serine...    147   4e-37   
ref|XP_006303147.1|  hypothetical protein CARUB_v10008271mg             147   4e-37   
ref|XP_011015709.1|  PREDICTED: probable LRR receptor-like serine...    147   5e-37   
ref|XP_008238681.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-37   
ref|XP_007210377.1|  hypothetical protein PRUPE_ppa001194mg             146   7e-37   
ref|XP_009389657.1|  PREDICTED: probable LRR receptor-like serine...    146   8e-37   
gb|KJB51988.1|  hypothetical protein B456_008G241300                    145   1e-36   
ref|XP_006651000.1|  PREDICTED: probable LRR receptor-like serine...    145   2e-36   
emb|CBI23559.3|  unnamed protein product                                142   2e-36   
ref|XP_008780314.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-36   
ref|XP_010494199.1|  PREDICTED: probable LRR receptor-like serine...    145   2e-36   
ref|XP_002887991.1|  hypothetical protein ARALYDRAFT_475059             145   2e-36   
gb|EAY88364.1|  hypothetical protein OsI_09819                          145   2e-36   
ref|XP_004245688.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-36   
ref|NP_001048834.1|  Os03g0127700                                       144   2e-36   
ref|XP_008361939.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-36   
emb|CDP09856.1|  unnamed protein product                                144   3e-36   
dbj|BAE98888.1|  protein kinase like protein                            144   4e-36   
ref|XP_002275029.3|  PREDICTED: probable LRR receptor-like serine...    144   4e-36   
ref|NP_176483.1|  putative leucine-rich repeat transmembrane prot...    144   4e-36   
ref|XP_009804678.1|  PREDICTED: probable LRR receptor-like serine...    144   4e-36   
ref|XP_009626686.1|  PREDICTED: probable LRR receptor-like serine...    144   6e-36   
ref|XP_006363743.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    144   6e-36   
ref|XP_010676626.1|  PREDICTED: probable LRR receptor-like serine...    143   8e-36   
ref|XP_004511633.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-35   
ref|XP_006300607.1|  hypothetical protein CARUB_v10019771mg             141   3e-35   
gb|KHN42733.1|  Putative LRR receptor-like serine/threonine-prote...    140   5e-35   
ref|XP_006573744.1|  PREDICTED: probable LRR receptor-like serine...    140   6e-35   
ref|XP_003516680.1|  PREDICTED: probable LRR receptor-like serine...    140   6e-35   
ref|XP_003538720.1|  PREDICTED: probable LRR receptor-like serine...    140   6e-35   
ref|XP_009148589.1|  PREDICTED: probable LRR receptor-like serine...    140   8e-35   
ref|XP_003611204.1|  Protein kinase like protein                        140   9e-35   
gb|AES94162.2|  LRR receptor-like kinase family protein                 140   9e-35   
ref|XP_011071078.1|  PREDICTED: probable LRR receptor-like serine...    139   1e-34   
ref|XP_010053385.1|  PREDICTED: probable LRR receptor-like serine...    139   2e-34   
emb|CDY30082.1|  BnaC05g09380D                                          138   3e-34   
ref|XP_003562151.1|  PREDICTED: probable LRR receptor-like serine...    138   4e-34   
ref|XP_004985881.1|  PREDICTED: probable LRR receptor-like serine...    138   4e-34   
ref|XP_002468593.1|  hypothetical protein SORBIDRAFT_01g048690          138   5e-34   
ref|XP_007158425.1|  hypothetical protein PHAVU_002G152100g             137   9e-34   
gb|EMT17457.1|  Putative LRR receptor-like serine/threonine-prote...    135   3e-33   
emb|CDX98061.1|  BnaA06g08120D                                          135   4e-33   
dbj|BAJ89617.1|  predicted protein                                      135   5e-33   
dbj|BAK03696.1|  predicted protein                                      134   1e-32   
ref|XP_008660543.1|  PREDICTED: probable LRR receptor-like serine...    132   4e-32   
ref|XP_008650433.1|  PREDICTED: probable LRR receptor-like serine...    132   6e-32   
ref|XP_001763904.1|  predicted protein                                  130   2e-31   
ref|XP_008782666.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    124   6e-29   
gb|EYU40542.1|  hypothetical protein MIMGU_mgv1a0012872mg               117   9e-29   
ref|XP_009146115.1|  PREDICTED: probably inactive leucine-rich re...    114   6e-28   
ref|XP_009144964.1|  PREDICTED: probably inactive leucine-rich re...    114   9e-28   
ref|XP_001775671.1|  predicted protein                                  118   5e-27   
gb|AAL73330.1|  putative receptor-like protein kinase RLPK1             111   1e-26   
gb|EEE51301.1|  hypothetical protein OsJ_32252                          116   2e-26   
gb|EAY79312.1|  hypothetical protein OsI_34439                          116   2e-26   
ref|NP_001176249.1|  Os10g0531700                                       116   2e-26   
ref|XP_006662538.1|  PREDICTED: probable LRR receptor-like serine...    115   4e-26   
ref|NP_001290509.1|  probably inactive leucine-rich repeat recept...    115   4e-26   
ref|XP_006858029.1|  hypothetical protein AMTR_s00069p00201070          114   8e-26   
ref|XP_002894441.1|  hypothetical protein ARALYDRAFT_474471             112   6e-25   
emb|CAE54078.1|  receptor-like protein kinase                           107   6e-25   
gb|KCW67582.1|  hypothetical protein EUGRSUZ_F01341                     108   9e-25   
gb|KCW67550.1|  hypothetical protein EUGRSUZ_F013052                    108   9e-25   
gb|ACN59252.1|  leucine-rich repeat receptor-like protein kinase        110   1e-24   
ref|XP_010644093.1|  PREDICTED: probable LRR receptor-like serine...    111   1e-24   
ref|XP_010644092.1|  PREDICTED: probable LRR receptor-like serine...    111   1e-24   
gb|AAF69542.1|AC008007_17  F12M16.30                                    110   1e-24   
ref|XP_002283464.2|  PREDICTED: probable LRR receptor-like serine...    111   2e-24   
gb|KHN38783.1|  Putative LRR receptor-like serine/threonine-prote...    107   2e-24   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...    110   2e-24   
ref|XP_008808300.1|  PREDICTED: LOW QUALITY PROTEIN: probably ina...    110   2e-24   
ref|NP_175747.2|  leucine-rich repeat transmembrane protein kinase      110   3e-24   
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...    110   3e-24   
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    110   4e-24   
ref|NP_001238159.1|  receptor-like serine/threonine kinase              110   4e-24   
gb|KHN01094.1|  Receptor-like protein kinase HSL1                       109   4e-24   
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...    108   4e-24   
ref|XP_010675292.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    110   4e-24   
emb|CAN70496.1|  hypothetical protein VITISV_042040                     109   4e-24   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    110   4e-24   
emb|CBI20149.3|  unnamed protein product                                109   4e-24   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...    110   4e-24   
ref|XP_010644094.1|  PREDICTED: probable LRR receptor-like serine...    109   5e-24   
ref|XP_002283477.2|  PREDICTED: probable LRR receptor-like serine...    109   5e-24   
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...    109   6e-24   
emb|CBI20145.3|  unnamed protein product                                109   6e-24   
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...    109   6e-24   
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...    109   6e-24   
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...    109   6e-24   
ref|XP_002283497.2|  PREDICTED: probable LRR receptor-like serine...    109   6e-24   
ref|XP_003526261.1|  PREDICTED: receptor-like protein kinase HSL1...    109   6e-24   
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                     108   1e-23   
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                     108   1e-23   
gb|KHN42594.1|  Putative LRR receptor-like serine/threonine-prote...    108   1e-23   
ref|XP_006592614.1|  PREDICTED: probable LRR receptor-like serine...    108   1e-23   
ref|XP_006582117.1|  PREDICTED: probable LRR receptor-like serine...    108   1e-23   
gb|EAZ23941.1|  hypothetical protein OsJ_07669                          105   1e-23   
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...    108   1e-23   
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...    108   1e-23   
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                     107   2e-23   
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...    107   2e-23   
ref|XP_010675291.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-23   
ref|XP_010094305.1|  putative LRR receptor-like serine/threonine-...    105   2e-23   
ref|XP_011101923.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    107   2e-23   
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-23   
ref|XP_010063817.1|  PREDICTED: probable LRR receptor-like serine...    107   2e-23   
dbj|BAD25347.1|  receptor ser/thr protein kinase-like                   105   2e-23   
emb|CBI20153.3|  unnamed protein product                                107   2e-23   
emb|CDP06496.1|  unnamed protein product                                104   3e-23   
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g             107   3e-23   
ref|XP_006647582.1|  PREDICTED: probable LRR receptor-like serine...    104   3e-23   
ref|XP_010093474.1|  putative LRR receptor-like serine/threonine-...    107   3e-23   
gb|EEC73672.1|  hypothetical protein OsI_08219                          104   3e-23   
ref|XP_003634705.1|  PREDICTED: probable LRR receptor-like serine...    107   3e-23   
gb|EMS48804.1|  G-type lectin S-receptor-like serine/threonine-pr...    104   3e-23   
ref|NP_001047537.1|  Os02g0639100                                       105   3e-23   
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             107   3e-23   
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...    107   3e-23   
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g             107   4e-23   
ref|XP_006370087.1|  hypothetical protein POPTR_0001s39420g             107   4e-23   
ref|XP_010277468.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    105   4e-23   
ref|XP_010041838.1|  PREDICTED: probable LRR receptor-like serine...    106   4e-23   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg             106   4e-23   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg             106   4e-23   
gb|KCW67556.1|  hypothetical protein EUGRSUZ_F01306                     107   4e-23   
dbj|BAK04486.1|  predicted protein                                      103   5e-23   
gb|AGH68281.1|  receptor-like protein kinase                            104   5e-23   
ref|XP_008386284.1|  PREDICTED: probable LRR receptor-like serine...    107   5e-23   
ref|XP_010060732.1|  PREDICTED: probable LRR receptor-like serine...    107   5e-23   
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...    107   5e-23   
ref|XP_010552132.1|  PREDICTED: probable leucine-rich repeat rece...    107   5e-23   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    106   5e-23   
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg             106   6e-23   
gb|KHG20508.1|  hypothetical protein F383_03730                         106   7e-23   
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_006370097.1|  hypothetical protein POPTR_0001s394901g            106   7e-23   
ref|XP_009359369.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_010552133.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_011044591.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_002316847.1|  receptor-like protein kinase                       106   7e-23   
gb|KJB61521.1|  hypothetical protein B456_009G363600                    106   7e-23   
ref|XP_009359368.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_009359367.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g            105   7e-23   
ref|XP_010916533.1|  PREDICTED: probable LRR receptor-like serine...    106   7e-23   
gb|KCW67547.1|  hypothetical protein EUGRSUZ_F01301                     106   8e-23   
ref|XP_010916525.1|  PREDICTED: probable LRR receptor-like serine...    106   8e-23   
ref|XP_010675353.1|  PREDICTED: probable LRR receptor-like serine...    103   8e-23   
ref|XP_006366364.1|  PREDICTED: probable leucine-rich repeat rece...    102   8e-23   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...    105   8e-23   
gb|EYU29542.1|  hypothetical protein MIMGU_mgv1a0269212mg               103   8e-23   
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...    106   8e-23   
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...    106   8e-23   
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...    106   8e-23   
ref|XP_010064483.1|  PREDICTED: probable LRR receptor-like serine...    106   8e-23   
ref|XP_010112410.1|  putative LRR receptor-like serine/threonine-...    105   8e-23   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...    106   9e-23   
gb|AGH68280.1|  receptor-like protein kinase                            103   9e-23   
emb|CBI20142.3|  unnamed protein product                                105   1e-22   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...    105   1e-22   
gb|AGH68279.1|  receptor-like protein kinase                            103   1e-22   
ref|XP_010062414.1|  PREDICTED: receptor-like protein kinase HAIKU2     105   1e-22   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...    105   1e-22   
ref|XP_007149544.1|  hypothetical protein PHAVU_005G0791000g            105   1e-22   
ref|XP_008660516.1|  PREDICTED: leucine-rich repeat receptor-like...    105   1e-22   
ref|NP_001136520.1|  uncharacterized LOC100216635                       102   1e-22   
ref|XP_008390667.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    103   1e-22   
gb|KEH38591.1|  LRR receptor-like kinase                                105   1e-22   
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                     104   1e-22   
ref|XP_006370083.1|  hypothetical protein POPTR_0001s393801g            104   1e-22   
ref|XP_002323571.1|  kinase family protein                              102   1e-22   
ref|XP_010918428.1|  PREDICTED: putative serine/threonine-protein...    102   1e-22   
ref|XP_006392790.1|  hypothetical protein EUTSA_v10012029mg             105   1e-22   
ref|XP_008442328.1|  PREDICTED: putative serine/threonine-protein...    102   1e-22   
gb|ABF70100.1|  protein kinase, putative                                105   2e-22   
gb|AAM13439.1|AF474072_1  similar to putative receptor protein ki...    102   2e-22   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase              105   2e-22   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-22   
gb|ACG41490.1|  hypothetical protein                                    102   2e-22   
ref|XP_003634589.1|  PREDICTED: receptor-like protein kinase HAIKU2     105   2e-22   
gb|AEW07769.1|  hypothetical protein 0_11270_01                       96.7    2e-22   
ref|XP_008226374.1|  PREDICTED: probable leucine-rich repeat rece...    103   2e-22   
ref|XP_010045694.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    105   2e-22   
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g            102   2e-22   
ref|XP_007213689.1|  hypothetical protein PRUPE_ppa000854mg             105   2e-22   
ref|XP_008226378.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-22   
ref|XP_008226377.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-22   
ref|XP_006290552.1|  hypothetical protein CARUB_v10016637mg             105   2e-22   
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-22   
gb|KCW63493.1|  hypothetical protein EUGRSUZ_G01123                     105   2e-22   
gb|ABR16548.1|  unknown                                                 100   2e-22   
gb|KCW67607.1|  hypothetical protein EUGRSUZ_F013621                    105   2e-22   
gb|KGN43819.1|  hypothetical protein Csa_7G069690                       105   2e-22   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...    104   2e-22   
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...    105   2e-22   
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...    100   2e-22   
ref|XP_010065822.1|  PREDICTED: receptor-like protein kinase HAIKU2     104   2e-22   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...    104   2e-22   
ref|NP_001235287.1|  receptor-like protein kinase                       100   3e-22   
emb|CDP05995.1|  unnamed protein product                                102   3e-22   



>ref|XP_006364689.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=1011

 Score =   277 bits (709),  Expect = 1e-83, Method: Composition-based stats.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P+ISDFGLARLV KLD+H++SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVT
Sbjct  866   PRISDFGLARLVTKLDKHMISNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  925

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPS
Sbjct  926   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDPTMKTYPEEEVLPVLKLALVCTSQIPS  985

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RM  Y
Sbjct  986   SRPSMAEVVQILQVIKTPVPQRMSAY  1011



>ref|XP_004247993.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=1012

 Score =   277 bits (708),  Expect = 2e-83, Method: Composition-based stats.
 Identities = 131/146 (90%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P+ISDFGLARLV KLD+H++S+RFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVT
Sbjct  867   PRISDFGLARLVTKLDKHMISSRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPS
Sbjct  927   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDPTMNTYPEEEVLPVLKLALVCTSQIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RME Y
Sbjct  987   SRPSMAEVVQILQVIKTPVPQRMEVY  1012



>ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   275 bits (703),  Expect = 9e-83, Method: Composition-based stats.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDFGLARL+ KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTG
Sbjct  863   KISDFGLARLLTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTG  922

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
             RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSS
Sbjct  923   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSS  982

Query  172   RPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQILQVIKTPVP RME +
Sbjct  983   RPTMAEVVQILQVIKTPVPQRMEVF  1007



>gb|KHN13843.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   275 bits (703),  Expect = 9e-83, Method: Composition-based stats.
 Identities = 128/145 (88%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDFGLARL+ KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTG
Sbjct  863   KISDFGLARLLTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTG  922

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
             RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSS
Sbjct  923   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSS  982

Query  172   RPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQILQVIKTPVP RME +
Sbjct  983   RPTMAEVVQILQVIKTPVPQRMEVF  1007



>emb|CAN70282.1| hypothetical protein VITISV_023081 [Vitis vinifera]
Length=323

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  538  TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             P ISD+GLARL+ KLD+HV+S+RFQ+A+GYVAPELACQSLRVNEKCD+YGFG++ILEIV
Sbjct  177  NPMISDYGLARLLTKLDKHVISSRFQSALGYVAPELACQSLRVNEKCDIYGFGVMILEIV  236

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIP  179
            TGRRPVEYGEDNV+ILNDHVRVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIP
Sbjct  237  TGRRPVEYGEDNVVILNDHVRVLLEQGNVLECVDPSMXEYPEEEVLPVLKLALVCTSQIP  296

Query  178  SSRPSMAEVVQILQVIKTPVPNRMEPY  98
            SSRP+MAEVVQILQVIKTP+P RME +
Sbjct  297  SSRPTMAEVVQILQVIKTPIPQRMEAF  323



>ref|XP_009589224.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Nicotiana tomentosiformis]
Length=938

 Score =   273 bits (698),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKISDFGLARLV KLD+H++SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVT
Sbjct  793  PKISDFGLARLVTKLDKHMISNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  852

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRP+EY EDNVLILNDHVRVLLEQGNVLECVD  +  YP+EEVLPVLKLALVCTSQIPS
Sbjct  853  GRRPIEYCEDNVLILNDHVRVLLEQGNVLECVDPTLDTYPEEEVLPVLKLALVCTSQIPS  912

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY  98
            SRPSMAEVVQILQVIKTPVP RME Y
Sbjct  913  SRPSMAEVVQILQVIKTPVPQRMEAY  938



>ref|XP_009589223.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Nicotiana tomentosiformis]
Length=1012

 Score =   274 bits (700),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARLV KLD+H++SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVT
Sbjct  867   PKISDFGLARLVTKLDKHMISNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRP+EY EDNVLILNDHVRVLLEQGNVLECVD  +  YP+EEVLPVLKLALVCTSQIPS
Sbjct  927   GRRPIEYCEDNVLILNDHVRVLLEQGNVLECVDPTLDTYPEEEVLPVLKLALVCTSQIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RME Y
Sbjct  987   SRPSMAEVVQILQVIKTPVPQRMEAY  1012



>ref|XP_009765958.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=1012

 Score =   273 bits (698),  Expect = 4e-82, Method: Composition-based stats.
 Identities = 129/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARLV KLD+H++SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFGMLILEIVT
Sbjct  867   PKISDFGLARLVTKLDKHMISNRFQSALGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRP+EY EDNVLILNDHVRVLLEQGNVL+CVD  +  YP+EEVLPVLKLALVCTSQIPS
Sbjct  927   GRRPIEYCEDNVLILNDHVRVLLEQGNVLDCVDPTLDTYPEEEVLPVLKLALVCTSQIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RME Y
Sbjct  987   SRPSMAEVVQILQVIKTPVPQRMEAY  1012



>gb|KHN27185.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=1007

 Score =   273 bits (697),  Expect = 5e-82, Method: Composition-based stats.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDFGLARL+ KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTG
Sbjct  863   KISDFGLARLLTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTG  922

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
             RRPVEYGEDNVLILNDHVRVLLE GNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSS
Sbjct  923   RRPVEYGEDNVLILNDHVRVLLEHGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSS  982

Query  172   RPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQILQVIKTPVP RME +
Sbjct  983   RPTMAEVVQILQVIKTPVPQRMEVF  1007



>ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=1007

 Score =   273 bits (697),  Expect = 5e-82, Method: Composition-based stats.
 Identities = 127/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDFGLARL+ KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VTG
Sbjct  863   KISDFGLARLLTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVTG  922

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
             RRPVEYGEDNVLILNDHVRVLLE GNVLECVDQ M  YP++EVLPVLKLA+VCTSQIPSS
Sbjct  923   RRPVEYGEDNVLILNDHVRVLLEHGNVLECVDQSMSEYPEDEVLPVLKLAMVCTSQIPSS  982

Query  172   RPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQILQVIKTPVP RME +
Sbjct  983   RPTMAEVVQILQVIKTPVPQRMEVF  1007



>gb|KDP37890.1| hypothetical protein JCGZ_05772 [Jatropha curcas]
Length=1001

 Score =   271 bits (694),  Expect = 1e-81, Method: Composition-based stats.
 Identities = 126/146 (86%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLD+HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VT
Sbjct  856   PKISDFGLARLLTKLDKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGIMILEVVT  915

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRP+EYGEDNV+ILNDHVRVLLEQGN L+CVD  MG YP++EVLPVLKLALVCTSQIPS
Sbjct  916   GRRPIEYGEDNVVILNDHVRVLLEQGNSLDCVDPNMGDYPEDEVLPVLKLALVCTSQIPS  975

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RME +
Sbjct  976   SRPSMAEVVQILQVIKTPVPQRMEMF  1001



>ref|XP_011073820.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=1009

 Score =   271 bits (693),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLD+HV+SNRFQ+A GYVAPELACQSLRVNEKCDVYGFG+LILE+V+
Sbjct  864   PKISDFGLARLLTKLDKHVVSNRFQSAPGYVAPELACQSLRVNEKCDVYGFGVLILELVS  923

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL+DHVRVLLEQGNVL+CVD  MG YP+EEVLPVLKLALVCTSQIPS
Sbjct  924   GRRPVEYGEDNVVILSDHVRVLLEQGNVLDCVDLSMGKYPEEEVLPVLKLALVCTSQIPS  983

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVPNRME +
Sbjct  984   SRPSMAEVVQILQVIKTPVPNRMEAF  1009



>ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
 gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris]
Length=1018

 Score =   271 bits (693),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLDRHVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VT
Sbjct  873   PKISDFGLARLLTKLDRHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVT  932

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD  M  YP++EVLPVLKLA+VCTSQIPS
Sbjct  933   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDHSMIEYPEDEVLPVLKLAMVCTSQIPS  992

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRP+M+EVVQILQVIKTPVP RME +
Sbjct  993   SRPTMSEVVQILQVIKTPVPQRMEVF  1018



>ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1011

 Score =   271 bits (692),  Expect = 3e-81, Method: Composition-based stats.
 Identities = 128/146 (88%), Positives = 140/146 (96%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KL+RHV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VT
Sbjct  866   PKISDFGLARLLMKLERHVISNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILELVT  925

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL+DHVRVLLEQGNVLECVD  MG YP++EVLPVLKLALVCTSQIPS
Sbjct  926   GRRPVEYGEDNVVILSDHVRVLLEQGNVLECVDVSMGDYPEDEVLPVLKLALVCTSQIPS  985

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RME +
Sbjct  986   SRPSMAEVVQILQVIKTPVPQRMEIF  1011



>ref|XP_010023583.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW59891.1| hypothetical protein EUGRSUZ_H02618 [Eucalyptus grandis]
Length=1012

 Score =   270 bits (691),  Expect = 4e-81, Method: Composition-based stats.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLDRHVMSNRFQ+A GYVAPELACQSLRVNEKCDVYGFG+LILE+VT
Sbjct  867   PKISDFGLARLLTKLDRHVMSNRFQSAPGYVAPELACQSLRVNEKCDVYGFGILILELVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL+DHVRVLLEQGN L+CVD  +  YP++EVLPVLKLALVCTSQ+PS
Sbjct  927   GRRPVEYGEDNVVILSDHVRVLLEQGNALDCVDPSITEYPEDEVLPVLKLALVCTSQVPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP+RMEPY
Sbjct  987   SRPSMAEVVQILQVIKTPVPHRMEPY  1012



>ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1006

 Score =   269 bits (687),  Expect = 2e-80, Method: Composition-based stats.
 Identities = 123/146 (84%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLDRHVMS+RFQ+A+GYVAPELACQSLR+NEKCD+YGFG+LILE+VT
Sbjct  861   PKISDFGLARLLTKLDRHVMSSRFQSALGYVAPELACQSLRINEKCDIYGFGVLILELVT  920

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+I NDHVRVLLEQGN L+CVD  MG YP++EV+PVLKLALVCTSQIPS
Sbjct  921   GRRPVEYGEDNVVIQNDHVRVLLEQGNALDCVDPSMGDYPEDEVMPVLKLALVCTSQIPS  980

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVI+TPVP RME +
Sbjct  981   SRPSMAEVVQILQVIRTPVPQRMEIF  1006



>ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis]
Length=1007

 Score =   268 bits (686),  Expect = 2e-80, Method: Composition-based stats.
 Identities = 123/146 (84%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGL+RL+ KLD+HV++NRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VT
Sbjct  862   PKISDFGLSRLLTKLDKHVINNRFQSALGYVAPELACQSLRVNEKCDVYGFGILILELVT  921

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRP+EYGEDNV+ILNDHVRVLLEQGN L+CVD  MG YP++EVLPVLKLALVCTSQIPS
Sbjct  922   GRRPIEYGEDNVVILNDHVRVLLEQGNALDCVDPSMGDYPEDEVLPVLKLALVCTSQIPS  981

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSM EVVQILQVIKTPVP RME +
Sbjct  982   SRPSMGEVVQILQVIKTPVPQRMEIF  1007



>gb|KJB37929.1| hypothetical protein B456_006G227000 [Gossypium raimondii]
Length=988

 Score =   268 bits (685),  Expect = 2e-80, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKISDFGLARL+ KL++HV+SNRFQ+A+GYVAPELACQ+LRVNEKCDV+GFGMLILE+VT
Sbjct  843  PKISDFGLARLLTKLEKHVISNRFQSALGYVAPELACQNLRVNEKCDVFGFGMLILELVT  902

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEYGEDNV+IL+DHVRV +EQGNVL+CVD GMG YP++EV PVLKLALVCTSQIPS
Sbjct  903  GRRPVEYGEDNVVILSDHVRVSVEQGNVLDCVDLGMGDYPEDEVFPVLKLALVCTSQIPS  962

Query  175  SRPSMAEVVQILQVIKTPVPNRMEP  101
            SRPSMAEVVQILQVIKTPVP RMEP
Sbjct  963  SRPSMAEVVQILQVIKTPVPQRMEP  987



>ref|XP_011000023.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1006

 Score =   268 bits (684),  Expect = 3e-80, Method: Composition-based stats.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLDRHVMS+RFQ+A+GYVAPELACQSLR+NEKCD+YGFG+LILE+VT
Sbjct  861   PKISDFGLARLLTKLDRHVMSSRFQSALGYVAPELACQSLRINEKCDIYGFGVLILELVT  920

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+I NDHVRVLLEQGN L+CVD  MG YP++EV+PVLKLALVCTSQIPS
Sbjct  921   GRRPVEYGEDNVVIQNDHVRVLLEQGNALDCVDPSMGDYPEDEVMPVLKLALVCTSQIPS  980

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTP P RME +
Sbjct  981   SRPSMAEVVQILQVIKTPAPQRMEIF  1006



>emb|CDP14623.1| unnamed protein product [Coffea canephora]
Length=1020

 Score =   266 bits (679),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 124/146 (85%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLD+HV+S+RFQ+A+GYVAPELACQSLRVNEKCDV+GFG+LILEIVT
Sbjct  875   PKISDFGLARLLTKLDKHVISSRFQSALGYVAPELACQSLRVNEKCDVFGFGVLILEIVT  934

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL+DHVRVLLEQGN L+CVD  MG YP++EV PVLKLALVCTSQIPS
Sbjct  935   GRRPVEYGEDNVMILSDHVRVLLEQGNALDCVDPSMGNYPEDEVSPVLKLALVCTSQIPS  994

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTP+P RME Y
Sbjct  995   SRPSMAEVVQILQVIKTPLPQRMEAY  1020



>ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=1012

 Score =   265 bits (678),  Expect = 3e-79, Method: Composition-based stats.
 Identities = 123/146 (84%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P ISD+GLARL+ KLD+HV+S+RFQ+A+GYVAPELACQSLRVNEKCD+YGFG++ILEIVT
Sbjct  867   PMISDYGLARLLTKLDKHVISSRFQSALGYVAPELACQSLRVNEKCDIYGFGVMILEIVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+ILNDHVRVLLEQGNVLECVD  M  YP+EEVLPVLKLALVCTSQIPS
Sbjct  927   GRRPVEYGEDNVVILNDHVRVLLEQGNVLECVDPSMNEYPEEEVLPVLKLALVCTSQIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRP+MAEVVQILQVIKTP+P RME +
Sbjct  987   SRPTMAEVVQILQVIKTPIPQRMEAF  1012



>gb|KHG00472.1| hypothetical protein F383_20103 [Gossypium arboreum]
Length=989

 Score =   265 bits (676),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 123/145 (85%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKISDFGLARL+ KL+ HV+SNRFQ+A+GYVAPELACQ+LRVNEKCDV+GFGMLILE+VT
Sbjct  844  PKISDFGLARLLTKLENHVISNRFQSALGYVAPELACQNLRVNEKCDVFGFGMLILELVT  903

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEYGEDNV+IL+DHVRV +EQGNVL+CVD  MG YP++EV PVLKLALVCTSQIPS
Sbjct  904  GRRPVEYGEDNVVILSDHVRVSVEQGNVLDCVDLSMGDYPEDEVFPVLKLALVCTSQIPS  963

Query  175  SRPSMAEVVQILQVIKTPVPNRMEP  101
            SRPSMAEVVQILQVIKTPVP RMEP
Sbjct  964  SRPSMAEVVQILQVIKTPVPQRMEP  988



>ref|XP_010107246.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=1023

 Score =   265 bits (677),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 120/146 (82%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P+ISDFGL+RL+ KLD+HV+SNRFQ+A+GYVAPE+ACQSLRVNEKCDVYGFG+LILE+VT
Sbjct  878   PRISDFGLSRLLTKLDKHVISNRFQSALGYVAPEMACQSLRVNEKCDVYGFGVLILELVT  937

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL+DH RVLLE+GNVLECVDQ +G YP++EVLPVLKLALVCTSQ+PS
Sbjct  938   GRRPVEYGEDNVVILSDHARVLLEEGNVLECVDQSIGDYPEDEVLPVLKLALVCTSQVPS  997

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQIL VIKTPVP R+E +
Sbjct  998   SRPSMAEVVQILHVIKTPVPQRLEVF  1023



>ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77948.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1016

 Score =   265 bits (677),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 1/146 (1%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDFGLARL+ KLD+HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILEIVTG
Sbjct  871   KISDFGLARLLTKLDKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILEIVTG  930

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPS  176
             RRPVEYGEDNVLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPS
Sbjct  931   RRPVEYGEDNVLILNDHVRVLLEHGNALECVDPSLMNEYPEDEVLPVLKLAMVCTSQIPS  990

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRP+MAEVVQILQVIKTPVP RME +
Sbjct  991   SRPTMAEVVQILQVIKTPVPQRMEVF  1016



>ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=1011

 Score =   265 bits (677),  Expect = 4e-79, Method: Composition-based stats.
 Identities = 124/147 (84%), Positives = 138/147 (94%), Gaps = 1/147 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PK+SDFGLARL+ K+++HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG++ILE+VT
Sbjct  865   PKLSDFGLARLLTKVEKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVMILELVT  924

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
             GRRPVEYGEDNVLILNDHVRVLLE GNVL+CVD   M  YP++EVLPVLKLA+VCTSQIP
Sbjct  925   GRRPVEYGEDNVLILNDHVRVLLEHGNVLDCVDPNLMNEYPEDEVLPVLKLAMVCTSQIP  984

Query  178   SSRPSMAEVVQILQVIKTPVPNRMEPY  98
             SSRPSMAEVVQILQVIKTPVP RME Y
Sbjct  985   SSRPSMAEVVQILQVIKTPVPQRMEVY  1011



>ref|XP_009371148.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=1009

 Score =   262 bits (670),  Expect = 4e-78, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDF LARL+ K+DRHV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILEIVTG
Sbjct  865   KISDFALARLLTKIDRHVVSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILEIVTG  924

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
             RRPVEYGEDNV+ILNDHVRVLLEQGN L C+D  MG YP++EVLPVLKLALVCTSQIPS 
Sbjct  925   RRPVEYGEDNVVILNDHVRVLLEQGNALGCIDVSMGDYPEDEVLPVLKLALVCTSQIPSC  984

Query  172   RPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQI+Q+IKTP+P  ME Y
Sbjct  985   RPTMAEVVQIMQIIKTPIPQTMEAY  1009



>gb|EYU32740.1| hypothetical protein MIMGU_mgv1a000860mg [Erythranthe guttata]
Length=957

 Score =   261 bits (668),  Expect = 4e-78, Method: Composition-based stats.
 Identities = 121/143 (85%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKISDFGLAR++ KLD+HVMS+RFQ+A GYVAPELACQSLRVNEKCDVYGFG+L+LE+VT
Sbjct  815  PKISDFGLARILTKLDKHVMSSRFQSAPGYVAPELACQSLRVNEKCDVYGFGVLVLELVT  874

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEYGEDNV+IL+DHVRV+LE+GNVL+CVD  MG YP+EEVLPV+KLALVCTSQIPS
Sbjct  875  GRRPVEYGEDNVVILSDHVRVMLERGNVLDCVDLEMGEYPEEEVLPVVKLALVCTSQIPS  934

Query  175  SRPSMAEVVQILQVIKTPVPNRM  107
            SRPSMAEVVQIL+VIKTP+PNRM
Sbjct  935  SRPSMAEVVQILEVIKTPLPNRM  957



>ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1012

 Score =   261 bits (668),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLAR +AKLDRHV+S RFQ+A+GYVAPEL+CQSLR+NEKCD+YGFG+LILE+VT
Sbjct  867   PKISDFGLARFLAKLDRHVISTRFQSALGYVAPELSCQSLRINEKCDIYGFGILILELVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNVLIL DHVR LLEQGNV +CVD  MG YP++EVLPVLKLALVCTS IPS
Sbjct  927   GRRPVEYGEDNVLILKDHVRFLLEQGNVFDCVDPSMGDYPEDEVLPVLKLALVCTSHIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRME  104
             SRPSMAEVVQILQVIKTPVP R E
Sbjct  987   SRPSMAEVVQILQVIKTPVPQRTE  1010



>ref|XP_010268319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=1009

 Score =   261 bits (667),  Expect = 8e-78, Method: Composition-based stats.
 Identities = 119/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLD+HV+S+RFQ+A+GYVAPELACQSLR+NEKCD+YGFG++ILE+VT
Sbjct  864   PKISDFGLARLLTKLDKHVISSRFQSALGYVAPELACQSLRINEKCDIYGFGVMILELVT  923

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GR+PVEYGED+V+IL+DHVRV+LEQG VL CVD  MG YP+EEVLPVLKL LVCTSQIPS
Sbjct  924   GRKPVEYGEDDVVILSDHVRVMLEQGKVLSCVDPTMGEYPEEEVLPVLKLGLVCTSQIPS  983

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPVP RME +
Sbjct  984   SRPSMAEVVQILQVIKTPVPQRMEAF  1009



>ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=1006

 Score =   261 bits (667),  Expect = 9e-78, Method: Composition-based stats.
 Identities = 120/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDF LARL+ K+DRHV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VT
Sbjct  861   PKISDFALARLLTKIDRHVVSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILELVT  920

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+ILNDHV+VLLEQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS
Sbjct  921   GRRPVEYGEDNVVILNDHVKVLLEQGNVLGCIDVSMGEYPEDEVLPVLKLALVCTSQIPS  980

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
              RP+MAEVVQILQ+IKTP+P R+E +
Sbjct  981   CRPTMAEVVQILQIIKTPLPQRIERF  1006



>ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
 gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina]
Length=1003

 Score =   260 bits (664),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 119/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P+ISDFGLARL+ +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VT
Sbjct  858   PRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVT  917

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPS
Sbjct  918   GRRPVEYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPS  977

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTP+P RME +
Sbjct  978   SRPSMAEVVQILQVIKTPLPQRMEVF  1003



>gb|KDO44075.1| hypothetical protein CISIN_1g0027171mg [Citrus sinensis]
Length=843

 Score =   258 bits (659),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 119/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P+ISDFGLARL+ +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VT
Sbjct  698  PRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVT  757

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEYGEDNV+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPS
Sbjct  758  GRRPVEYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPS  817

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY  98
            SRPSMAEVVQILQVIKTP+P RME +
Sbjct  818  SRPSMAEVVQILQVIKTPLPQRMEVF  843



>ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=1003

 Score =   259 bits (663),  Expect = 3e-77, Method: Composition-based stats.
 Identities = 119/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P+ISDFGLARL+ +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VT
Sbjct  858   PRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVT  917

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPS
Sbjct  918   GRRPVEYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPS  977

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTP+P RME +
Sbjct  978   SRPSMAEVVQILQVIKTPLPQRMEVF  1003



>gb|KDO44074.1| hypothetical protein CISIN_1g0027171mg, partial [Citrus sinensis]
Length=866

 Score =   258 bits (659),  Expect = 3e-77, Method: Composition-based stats.
 Identities = 119/146 (82%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P+ISDFGLARL+ +LD+HVMSNRFQ+A+GYVAPEL CQSLRVNEKCD+YGFG+LILE+VT
Sbjct  721  PRISDFGLARLLTRLDKHVMSNRFQSALGYVAPELTCQSLRVNEKCDIYGFGVLILELVT  780

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEYGEDNV+IL++HVRVLLE+GNVL+CVD  MG YP++EVLPVLKLALVCT  IPS
Sbjct  781  GRRPVEYGEDNVVILSEHVRVLLEEGNVLDCVDPSMGDYPEDEVLPVLKLALVCTCHIPS  840

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY  98
            SRPSMAEVVQILQVIKTP+P RME +
Sbjct  841  SRPSMAEVVQILQVIKTPLPQRMEVF  866



>ref|XP_003621710.1| Receptor-like protein kinase [Medicago truncatula]
Length=1085

 Score =   259 bits (663),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 9/161 (6%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KISDFGLARL+ KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG
Sbjct  753  KISDFGLARLLTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTG  812

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEYGEDNVLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPS
Sbjct  813  KRPVEYGEDNVLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPS  872

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY*ASASGLESGNILEF  53
            SRP+MAEVVQILQVIKT VP RME        L + NIL+F
Sbjct  873  SRPTMAEVVQILQVIKTSVPQRME--------LITSNILQF  905



>ref|XP_008337525.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=1009

 Score =   259 bits (661),  Expect = 5e-77, Method: Composition-based stats.
 Identities = 119/145 (82%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDF LARL+ K+D+HV+SNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+LILEIVTG
Sbjct  865   KISDFALARLLTKIDQHVVSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVLILEIVTG  924

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
             RRPVEYGEDNV+ILNDHVRVLLEQGN L C+D  MG YP++EVLPVLKLALVCTSQIPS 
Sbjct  925   RRPVEYGEDNVVILNDHVRVLLEQGNALGCIDVSMGYYPEDEVLPVLKLALVCTSQIPSC  984

Query  172   RPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQI+Q+IKTP+P  ME Y
Sbjct  985   RPTMAEVVQIMQIIKTPIPQTMEAY  1009



>ref|XP_011042759.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
 ref|XP_011042760.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=1012

 Score =   258 bits (659),  Expect = 9e-77, Method: Composition-based stats.
 Identities = 121/144 (84%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLAR  AKLDRHV+S RFQ+A+GYVAPEL CQSL +NEKCDVYGFG+LILE+VT
Sbjct  867   PKISDFGLARFFAKLDRHVISTRFQSALGYVAPELLCQSLIINEKCDVYGFGILILELVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNVLIL DHVR LLEQGNV +CVD  MG YP++EVLPVLKLALVCTS IPS
Sbjct  927   GRRPVEYGEDNVLILKDHVRFLLEQGNVFDCVDPSMGDYPEDEVLPVLKLALVCTSHIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRME  104
             SRPSMAEVVQILQVIKTPVP R E
Sbjct  987   SRPSMAEVVQILQVIKTPVPQRTE  1010



>ref|XP_003621722.1| Receptor-like kinase [Medicago truncatula]
Length=804

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 140/161 (87%), Gaps = 9/161 (6%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KISDFGLARL+ KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG
Sbjct  472  KISDFGLARLLTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTG  531

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEYGEDNVLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPS
Sbjct  532  KRPVEYGEDNVLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPS  591

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY*ASASGLESGNILEF  53
            SRP+MAEVVQILQVIKT VP RME        L + NIL+F
Sbjct  592  SRPTMAEVVQILQVIKTSVPQRME--------LITSNILQF  624


 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KISDFGLARL++KLD+HVMSNRFQ+A+GYVAPELACQSLRVNEKCDVYGFG+  LE+V  
Sbjct  165  KISDFGLARLLSKLDKHVMSNRFQSALGYVAPELACQSLRVNEKCDVYGFGVF-LEMVQY  223

Query  352  RRP  344
              P
Sbjct  224  GNP  226



>gb|AES77940.2| tyrosine kinase family protein [Medicago truncatula]
Length=641

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KISDFGLARL+ KLD+HVMSNRFQ+A+GYVAPELACQ LRVNEKCDVYGFG++ILEIVTG
Sbjct  496  KISDFGLARLLTKLDKHVMSNRFQSALGYVAPELACQILRVNEKCDVYGFGVMILEIVTG  555

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEYGEDNVLILNDHVRVLLE GN LECVD   M  YP++EVLPVLKLA+VCTSQIPS
Sbjct  556  KRPVEYGEDNVLILNDHVRVLLEHGNALECVDPSLMSEYPEDEVLPVLKLAMVCTSQIPS  615

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            SRP+MAEVVQILQVIKT VP RME
Sbjct  616  SRPTMAEVVQILQVIKTSVPQRME  639


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 41/41 (100%), Gaps = 0/41 (0%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRV  410
            KISDFGLARL++KLD+HVMSNRFQ+A+GYVAPELACQSLR+
Sbjct  165  KISDFGLARLLSKLDKHVMSNRFQSALGYVAPELACQSLRM  205



>ref|XP_010673272.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   256 bits (655),  Expect = 4e-76, Method: Composition-based stats.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMS-NRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             K++DFGLA+L+ K+D H MS NRFQ A GY APELACQSLRVNEKCDVY FG++ LEIVT
Sbjct  864   KVADFGLAKLLTKIDNHSMSGNRFQGAPGYAAPELACQSLRVNEKCDVYSFGVMALEIVT  923

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRP+EYGEDNVLILNDHVRVLLE+GNVLECVDQ +G YPDEEVLPVLKLALVCTSQIPS
Sbjct  924   GRRPIEYGEDNVLILNDHVRVLLEEGNVLECVDQSIGEYPDEEVLPVLKLALVCTSQIPS  983

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSM+EVVQILQVIKTPVP R E Y
Sbjct  984   SRPSMSEVVQILQVIKTPVPQRQEAY  1009



>ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
 gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica]
Length=986

 Score =   253 bits (647),  Expect = 4e-75, Method: Composition-based stats.
 Identities = 116/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKISDF L RL+ K+D+HV+SNRFQ A+GYVAPELACQSLRVNEKCDVYGFG+LILE+VT
Sbjct  841  PKISDFALVRLLTKIDQHVVSNRFQTALGYVAPELACQSLRVNEKCDVYGFGVLILELVT  900

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEYGEDNV+IL DHVRVLLEQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS
Sbjct  901  GRRPVEYGEDNVVILTDHVRVLLEQGNVLGCIDLSMGEYPEDEVLPVLKLALVCTSQIPS  960

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY  98
             RP+MAEVVQI+Q+IKTP+P+ +E +
Sbjct  961  CRPTMAEVVQIMQIIKTPIPHTLEAF  986



>ref|XP_008244427.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=1009

 Score =   251 bits (641),  Expect = 4e-74, Method: Composition-based stats.
 Identities = 115/146 (79%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDF L RL+ K D+HV+SNRFQ+A+GYVAPELAC SLRVNEKCDVYGFG+LILE+VT
Sbjct  864   PKISDFALVRLLTKTDQHVVSNRFQSALGYVAPELACHSLRVNEKCDVYGFGVLILELVT  923

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL DHVRVLLEQGNVL C+D  MG YP++EVLPVLKLALVCTSQIPS
Sbjct  924   GRRPVEYGEDNVVILTDHVRVLLEQGNVLGCIDLSMGEYPEDEVLPVLKLALVCTSQIPS  983

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
              RP+MAEVVQI+Q+IKTP+P+ +E +
Sbjct  984   CRPTMAEVVQIMQIIKTPIPHTLEAF  1009



>ref|XP_010929848.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=1011

 Score =   249 bits (635),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 116/146 (79%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLD+H++S+RFQ+A+GY+APELACQSLR+NEKCDVYGFG+LILE+VT
Sbjct  865   PKISDFGLARLLPKLDKHIISSRFQSAMGYMAPELACQSLRINEKCDVYGFGVLILELVT  924

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GR+PVEYG+D+V+IL D VRVLLEQGNVL+C+D  MG +P+EEVLPVLKL LVCTSQIPS
Sbjct  925   GRKPVEYGDDDVVILIDQVRVLLEQGNVLDCMDSSMGEFPEEEVLPVLKLGLVCTSQIPS  984

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIKTPV  RME +
Sbjct  985   SRPSMAEVVQILQVIKTPVIERMEAF  1010



>ref|XP_004156987.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040-like [Cucumis 
sativus]
Length=1007

 Score =   247 bits (631),  Expect = 8e-73, Method: Composition-based stats.
 Identities = 114/143 (80%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISD+GLARL+ KLD+HVM+NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVT
Sbjct  865   PKISDYGLARLLTKLDKHVMNNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVT  924

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL DHVR LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPS
Sbjct  925   GRRPVEYGEDNVVILTDHVRYLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPS  984

Query  175   SRPSMAEVVQILQVIKTPVPNRM  107
             SRPSMAEVVQILQVIK P+P R+
Sbjct  985   SRPSMAEVVQILQVIKAPLPQRI  1007



>ref|XP_004152295.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN53091.1| Receptor protein kinase [Cucumis sativus]
Length=1007

 Score =   247 bits (631),  Expect = 8e-73, Method: Composition-based stats.
 Identities = 114/143 (80%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISD+GLARL+ KLD+HVM+NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVT
Sbjct  865   PKISDYGLARLLTKLDKHVMNNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVT  924

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL DHVR LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPS
Sbjct  925   GRRPVEYGEDNVVILTDHVRYLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPS  984

Query  175   SRPSMAEVVQILQVIKTPVPNRM  107
             SRPSMAEVVQILQVIK P+P R+
Sbjct  985   SRPSMAEVVQILQVIKAPLPQRI  1007



>ref|XP_008453972.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=1010

 Score =   246 bits (629),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 113/146 (77%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISD+GLARL+ KLD+HV++NRFQ+A+GYVAPELACQS+RVNEKCDV+GFG++ILEIVT
Sbjct  865   PKISDYGLARLLTKLDKHVVNNRFQSALGYVAPELACQSIRVNEKCDVHGFGVMILEIVT  924

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGEDNV+IL DHVR LLE+GNVL+CVD  M  Y ++EV+P+LKLALVCTSQIPS
Sbjct  925   GRRPVEYGEDNVVILTDHVRYLLERGNVLDCVDPSMTQYSEDEVVPILKLALVCTSQIPS  984

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             SRPSMAEVVQILQVIK P+P R++ +
Sbjct  985   SRPSMAEVVQILQVIKAPLPQRIQGF  1010



>ref|XP_008776998.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=1008

 Score =   246 bits (629),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 115/147 (78%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             +P+ISDFGLARL+ KLD H++S+RFQ+A+GY+APELACQSLR+NEKCDVYGFG+LILE+V
Sbjct  862   SPRISDFGLARLLPKLDNHIISSRFQSAMGYMAPELACQSLRINEKCDVYGFGVLILELV  921

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIP  179
             TGR+PV+YG+D+V+IL D VRVLLEQGNVL+CVD  MG +P+EEVLPVLKL LVCTSQIP
Sbjct  922   TGRKPVQYGDDDVVILIDQVRVLLEQGNVLDCVDSRMGEFPEEEVLPVLKLGLVCTSQIP  981

Query  178   SSRPSMAEVVQILQVIKTPVPNRMEPY  98
             SSRPSMAEVVQILQVIKTPV  RME +
Sbjct  982   SSRPSMAEVVQILQVIKTPVIERMEAF  1008



>ref|XP_010528265.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=1011

 Score =   245 bits (626),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 114/146 (78%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGL RL+ K DR++M++RFQ A+GY+APEL CQSLRVNEKCDVYGFG+LILE+VT
Sbjct  866   PKISDFGLTRLLTKHDRNMMNSRFQNALGYIAPELECQSLRVNEKCDVYGFGVLILELVT  925

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             GRRPVEYGED+ +IL+DHVRVLLEQGNVLECVD  M  Y ++EVLPVLKLALVCTSQIPS
Sbjct  926   GRRPVEYGEDSFVILSDHVRVLLEQGNVLECVDPTMDEYSEDEVLPVLKLALVCTSQIPS  985

Query  175   SRPSMAEVVQILQVIKTPVPNRMEPY  98
             +RP+MAE+VQILQVIKTPVP R+E +
Sbjct  986   NRPTMAEIVQILQVIKTPVPQRLETF  1011



>ref|XP_009403616.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   238 bits (607),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 109/139 (78%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGL RL+ KLD+H++S+RFQ+A+GY+APELACQSLRVNEKCD+YGFG+LILE+VT
Sbjct  865   PKISDFGLVRLLQKLDKHMISSRFQSAMGYMAPELACQSLRVNEKCDIYGFGVLILELVT  924

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             G++PVEYGED+V+IL DHVR L+EQGN +ECVD  MG +P+EEVLPVLKL LVCTSQIPS
Sbjct  925   GKKPVEYGEDDVVILIDHVRALVEQGNAVECVDSSMGEFPEEEVLPVLKLGLVCTSQIPS  984

Query  175   SRPSMAEVVQILQVIKTPV  119
             SRPSMAEVVQILQVIK P+
Sbjct  985   SRPSMAEVVQILQVIKAPL  1003



>ref|XP_009406353.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1025

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
              P ISDFG ARL+ KLD+H++S+RFQ+A+GY+APELACQSLRVNEKCDVYGFG+LILE+V
Sbjct  879   NPIISDFGHARLLPKLDKHIISSRFQSAMGYMAPELACQSLRVNEKCDVYGFGVLILELV  938

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIP  179
             TGR+PVEY +D+V+IL D VR+LLEQG  LEC+D  MG YP+EEVLPVLKL LVC SQIP
Sbjct  939   TGRKPVEYRDDDVVILIDQVRLLLEQGKALECIDASMGEYPEEEVLPVLKLGLVCASQIP  998

Query  178   SSRPSMAEVVQILQVIKTPVPNRMEPY  98
             SSRPSMAEVVQILQVIKTPV  RME +
Sbjct  999   SSRPSMAEVVQILQVIKTPVLERMEAF  1025



>ref|XP_009415955.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=1020

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGLARL+ KLD+H++S+RFQ+A+GY+APELACQSLRVNEKCDVYG+G+LI E+VT
Sbjct  882   PKISDFGLARLLQKLDKHIISSRFQSAMGYMAPELACQSLRVNEKCDVYGYGVLIAELVT  941

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
             G++PVEYG+D+V+IL DHVR LLEQG VL+CVD  MG +P+EEVLPVLKL LVCTSQIPS
Sbjct  942   GKKPVEYGDDDVVILIDHVRALLEQGRVLDCVDSSMGEFPEEEVLPVLKLGLVCTSQIPS  1001

Query  175   SRPSMAEVVQILQVIKTPV  119
             +RPSMAEVVQILQVIK P+
Sbjct  1002  TRPSMAEVVQILQVIKAPL  1020



>ref|XP_010555906.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Tarenaya hassleriana]
Length=993

 Score =   233 bits (593),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
            PKISDFGL RL+ K DR+ M+N RFQ A+GYVAPEL C+SLRVNEKCDVYGFG+LILE+V
Sbjct  847  PKISDFGLTRLLTKHDRNTMNNNRFQNALGYVAPELECESLRVNEKCDVYGFGVLILELV  906

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIP  179
            TGRRPVEYGE + ++L+DHVRVLLEQGN LECVD  M  + ++EVLPVLKLALVCTSQ+P
Sbjct  907  TGRRPVEYGEHSFVVLSDHVRVLLEQGNALECVDPTMDEFSEDEVLPVLKLALVCTSQVP  966

Query  178  SSRPSMAEVVQILQVIKTPVPNRMEPY  98
            S+RP+MAE+VQIL VIKTPVP+R+E +
Sbjct  967  SNRPTMAEIVQILHVIKTPVPHRLETF  993



>ref|XP_010555905.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Tarenaya hassleriana]
Length=1017

 Score =   232 bits (592),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 109/147 (74%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL RL+ K DR+ M+N RFQ A+GYVAPEL C+SLRVNEKCDVYGFG+LILE+V
Sbjct  871   PKISDFGLTRLLTKHDRNTMNNNRFQNALGYVAPELECESLRVNEKCDVYGFGVLILELV  930

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIP  179
             TGRRPVEYGE + ++L+DHVRVLLEQGN LECVD  M  + ++EVLPVLKLALVCTSQ+P
Sbjct  931   TGRRPVEYGEHSFVVLSDHVRVLLEQGNALECVDPTMDEFSEDEVLPVLKLALVCTSQVP  990

Query  178   SSRPSMAEVVQILQVIKTPVPNRMEPY  98
             S+RP+MAE+VQIL VIKTPVP+R+E +
Sbjct  991   SNRPTMAEIVQILHVIKTPVPHRLETF  1017



>emb|CDX85183.1| BnaC07g24940D, partial [Brassica napus]
Length=933

 Score =   232 bits (591),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 112/145 (77%), Positives = 130/145 (90%), Gaps = 2/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
            PKISDFGLARL+   D + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  785  PKISDFGLARLLTTQDGNTMNTNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  844

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
            TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M G Y ++EVLPVLKLALVCTSQI
Sbjct  845  TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPTMEGEYSEDEVLPVLKLALVCTSQI  904

Query  181  PSSRPSMAEVVQILQVIKTPVPNRM  107
            PS+RP+MAE+VQILQVI +PVP+RM
Sbjct  905  PSNRPTMAEIVQILQVISSPVPHRM  929



>gb|EPS70115.1| hypothetical protein M569_04636, partial [Genlisea aurea]
Length=976

 Score =   230 bits (587),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVM--SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEI  362
            PKISDFGLARL+ K D  ++  SNR QA  GY APEL C+SLRVNEKCDVYGFG+LILE+
Sbjct  829  PKISDFGLARLLGKFDSKLLDRSNRSQAESGYAAPELTCRSLRVNEKCDVYGFGVLILEL  888

Query  361  VTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQI  182
            VTG++PVE+GE NV+IL+D VR LLEQGN+  CVD+ MG YP+EEVLPV+KLALVCTSQI
Sbjct  889  VTGKKPVEHGEGNVVILSDRVRELLEQGNISRCVDKRMGPYPEEEVLPVIKLALVCTSQI  948

Query  181  PSSRPSMAEVVQILQVIKTPVPNRMEPY  98
            PSSRPSMAEVVQILQVIK P+PNRM  +
Sbjct  949  PSSRPSMAEVVQILQVIKAPLPNRMTAF  976



>ref|XP_009151898.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
 emb|CDX86452.1| BnaA06g31690D [Brassica napus]
Length=1011

 Score =   227 bits (579),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 110/145 (76%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVM-SNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGLARL+   D + M +NRFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  863   PKISDFGLARLLTTQDGNTMNTNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  922

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  923   TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPTMEEEYSEDEVLPVLKLALVCTSQI  982

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+R+
Sbjct  983   PSNRPTMAEIVQILQVISSPVPHRI  1007



>gb|KFK33718.1| hypothetical protein AALP_AA5G051000 [Arabis alpina]
Length=1018

 Score =   227 bits (578),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  870   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  929

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  930   TGRRPVEYGEDSFVILSDHVRVMLEQGNVLECIDPVMEQEYSEDEVLPVLKLALVCTSQI  989

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+RM
Sbjct  990   PSNRPTMAEIVQILQVINSPVPHRM  1014



>ref|XP_010514517.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   226 bits (576),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  869   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  928

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  929   TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQI  988

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+R+
Sbjct  989   PSNRPTMAEIVQILQVINSPVPHRI  1013



>ref|XP_010425587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   225 bits (574),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  869   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  928

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  929   TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQI  988

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+R+
Sbjct  989   PSNRPTMAEIVQILQVINSPVPHRI  1013



>ref|XP_010502811.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1017

 Score =   225 bits (574),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  869   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  928

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  929   TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQI  988

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+R+
Sbjct  989   PSNRPTMAEIVQILQVINSPVPHRI  1013



>ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
 gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella]
Length=1017

 Score =   225 bits (574),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  869   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  928

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  929   TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQI  988

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+R+
Sbjct  989   PSNRPTMAEIVQILQVINSPVPHRI  1013



>ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
 sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase 
[Arabidopsis thaliana]
Length=1016

 Score =   225 bits (574),  Expect = 5e-65, Method: Composition-based stats.
 Identities = 108/145 (74%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  868   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  927

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  928   TGRRPVEYGEDSFVILSDHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQI  987

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+R+
Sbjct  988   PSNRPTMAEIVQILQVINSPVPHRI  1012



>ref|NP_001045445.1| Os01g0957100 [Oryza sativa Japonica Group]
 dbj|BAF07359.1| Os01g0957100, partial [Oryza sativa Japonica Group]
Length=923

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = -3

Query  538  TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             P + DFGLARL+ KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+V
Sbjct  771  NPMVGDFGLARLLPKLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELV  830

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTS  188
            TGRR VEYG+D+V+IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTS
Sbjct  831  TGRRAVEYGDDDVVILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLGMVCTS  890

Query  187  QIPSSRPSMAEVVQILQVIKTPV  119
            QIPS+RPSMAEVVQILQVIK PV
Sbjct  891  QIPSNRPSMAEVVQILQVIKAPV  913



>dbj|BAB92869.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAZ14887.1| hypothetical protein OsJ_04818 [Oryza sativa Japonica Group]
Length=1013

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
              P + DFGLARL+ KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+V
Sbjct  861   NPMVGDFGLARLLPKLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELV  920

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTS  188
             TGRR VEYG+D+V+IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTS
Sbjct  921   TGRRAVEYGDDDVVILIDQVRVLLDHGGGSNVLECVDPSIGEFPEEEVLPVLKLGMVCTS  980

Query  187   QIPSSRPSMAEVVQILQVIKTPV  119
             QIPS+RPSMAEVVQILQVIK PV
Sbjct  981   QIPSNRPSMAEVVQILQVIKAPV  1003



>gb|EAY77289.1| hypothetical protein OsI_05265 [Oryza sativa Indica Group]
Length=1013

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
              P + DFGLARL+ KLD+HVMS+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+LILE+V
Sbjct  861   NPMVGDFGLARLLPKLDKHVMSSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLILELV  920

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQG---NVLECVDQGMGGYPDEEVLPVLKLALVCTS  188
             TGRR VEYG+D+V+IL D VRVLL+ G   NVLECVD  +G +P+EEVLPVLKL +VCTS
Sbjct  921   TGRRAVEYGDDDVVILIDQVRVLLDHGGGSNVLECVDPTIGEFPEEEVLPVLKLGMVCTS  980

Query  187   QIPSSRPSMAEVVQILQVIKTPV  119
             QIPS+RPSMAEVVQILQVIK PV
Sbjct  981   QIPSNRPSMAEVVQILQVIKAPV  1003



>ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
 gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum]
Length=1018

 Score =   223 bits (569),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LR NEKCDVYGFG+LILE+V
Sbjct  870   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRANEKCDVYGFGVLILELV  929

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRVLLEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  930   TGRRPVEYGEDSFVILSDHVRVLLEQGNVLECIDPVMEEEYSEDEVLPVLKLALVCTSQI  989

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+V+ILQ+I +PVP+RM
Sbjct  990   PSNRPTMAEIVKILQIINSPVPHRM  1014



>ref|XP_009111587.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=1014

 Score =   223 bits (569),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGL+RLV +    + +NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VT
Sbjct  867   PKISDFGLSRLVTQDGNTMNNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
             GRRPVEYGED  +IL+DHVR++LEQGNVLEC+D  M   Y ++EVLPV+KLALVCTSQIP
Sbjct  927   GRRPVEYGEDIFVILSDHVRIMLEQGNVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIP  986

Query  178   SSRPSMAEVVQILQVIKTPVPNRM  107
             S+RP+MAE+VQILQVI +PVP+RM
Sbjct  987   SNRPTMAEIVQILQVITSPVPHRM  1010



>ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. 
lyrata]
Length=1014

 Score =   223 bits (568),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 107/145 (74%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSN-RFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             PKISDFGL+RL+   D + M+N RFQ A+GYVAPEL CQ+LRVNEKCDVYGFG+LILE+V
Sbjct  866   PKISDFGLSRLLTTQDGNTMNNNRFQNALGYVAPELECQNLRVNEKCDVYGFGVLILELV  925

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
             TGRRPVEYGED+ +IL+DHVRV+LEQGNVLEC+D  M   Y ++EVLPVLKLALVCTSQI
Sbjct  926   TGRRPVEYGEDSFVILSDHVRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALVCTSQI  985

Query  181   PSSRPSMAEVVQILQVIKTPVPNRM  107
             PS+RP+MAE+VQILQVI +PVP+++
Sbjct  986   PSNRPTMAEIVQILQVINSPVPHQI  1010



>emb|CDY20032.1| BnaA09g02190D [Brassica napus]
Length=1014

 Score =   223 bits (567),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 105/144 (73%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PKISDFGL+RLV +    + +NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VT
Sbjct  867   PKISDFGLSRLVTQDGNTMNNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVT  926

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
             GRRPVEYGED  +IL+DHVR++LEQGNVLEC+D  M   Y ++EVLPV+KLALVCTSQIP
Sbjct  927   GRRPVEYGEDIFVILSDHVRIMLEQGNVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIP  986

Query  178   SSRPSMAEVVQILQVIKTPVPNRM  107
             S+RP+MAE+VQILQVI +PVP+RM
Sbjct  987   SNRPTMAEIVQILQVITSPVPHRM  1010



>emb|CDY00141.1| BnaC09g01600D [Brassica napus]
Length=1013

 Score =   219 bits (559),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 105/143 (73%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -3

Query  532   KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
             KISDFGL+ LV + D + M+NRFQ A+GY+APEL CQ+LRVNEKCDVYGFG+LILE+VTG
Sbjct  868   KISDFGLSCLVTQ-DGNTMNNRFQNALGYMAPELECQNLRVNEKCDVYGFGVLILELVTG  926

Query  352   RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
             RRPVEYGED+ +IL+DHVRV+LEQG VLEC+D  M   Y ++EVLPV+KLALVCTSQIPS
Sbjct  927   RRPVEYGEDSFVILSDHVRVMLEQGTVLECIDPTMEDEYSEDEVLPVVKLALVCTSQIPS  986

Query  175   SRPSMAEVVQILQVIKTPVPNRM  107
             +RP+MAE+VQILQVI +PVP+RM
Sbjct  987   NRPTMAEIVQILQVITSPVPHRM  1009



>ref|XP_006646695.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=975

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%), Gaps = 7/154 (5%)
 Frame = -3

Query  538  TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
             P ++DFGLARL+ KLD+H++S+RFQ  +GYVAPELACQSLR+NEKCD+YGFG+L+LE+V
Sbjct  821  NPMVADFGLARLLPKLDKHMISSRFQGGMGYVAPELACQSLRINEKCDIYGFGVLVLELV  880

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQG--NVLECVDQGMGGYPDEEVLPVLKLALVCTSQ  185
            TGRR VEY +D+V+IL D VRVLL+ G  NVLECVD  +G +P+EEVLPVLKL +VCTSQ
Sbjct  881  TGRRAVEYSDDDVVILIDQVRVLLDHGGNNVLECVDPALGEFPEEEVLPVLKLGMVCTSQ  940

Query  184  IPSSRPSMAEVVQILQVIKTPV-----PNRMEPY  98
            IPS+RPSM EVVQILQVIK PV       RME +
Sbjct  941  IPSNRPSMVEVVQILQVIKAPVAASPSATRMEAF  974



>ref|XP_004971314.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=1029

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
              P + DFGLARL   L R     R+    GYVAPELACQSLRVNEKCD+YG G++ILE+V
Sbjct  882   NPAVGDFGLARL---LPRPEQQRRYALGSGYVAPELACQSLRVNEKCDIYGLGVVILEVV  938

Query  358   TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQI  182
             TGRR VEYG+D+V++L D VRVLLE GN LECVD GMGG +P+EEVLPVLKL +VCTSQI
Sbjct  939   TGRRAVEYGDDDVVVLQDQVRVLLEHGNALECVDPGMGGAFPEEEVLPVLKLGMVCTSQI  998

Query  181   PSSRPSMAEVVQILQVIKTPVPNRME  104
             PS+RPSMAEVVQILQVIK PV  RME
Sbjct  999   PSNRPSMAEVVQILQVIKAPVGGRME  1024



>emb|CAN76686.1| hypothetical protein VITISV_005469 [Vitis vinifera]
Length=167

 Score =   185 bits (470),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  21   PKVADFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  80

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  81   GKRPVEYMEDDVVVLCDMVRGALEEGKVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  140

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  141  SNRPDMAEVVNILELIRCPSEGQEE  165



>ref|XP_001769840.1| predicted protein [Physcomitrella patens]
 gb|EDQ65402.1| predicted protein [Physcomitrella patens]
Length=947

 Score =   199 bits (506),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            +ISD+GLA+L+  LD +VMS++FQ+A+GY+APE AC SLR+ EKCDVYGFG+L+LE+VTG
Sbjct  805  RISDYGLAKLLPALDSYVMSSKFQSALGYMAPEFACPSLRITEKCDVYGFGVLLLELVTG  864

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
            RRPVEY ED+V+IL DHVR LLE+G  L CVD  M  YP++EVLPV+KL L+CTS +PS+
Sbjct  865  RRPVEYMEDDVVILCDHVRALLEEGRPLSCVDSHMNSYPEDEVLPVIKLGLICTSHVPSN  924

Query  172  RPSMAEVVQILQVIK  128
            RPSM EVVQIL++I+
Sbjct  925  RPSMEEVVQILELIR  939



>ref|XP_001771841.1| predicted protein [Physcomitrella patens]
 gb|EDQ63270.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = -3

Query  529  ISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGR  350
            ISD+GLARL+  LDR+++ ++FQ+A+GY+APE +C SLR+ EKCDVYGFG+L+LE+VTGR
Sbjct  821  ISDYGLARLLPTLDRYILGSKFQSALGYMAPEFSCPSLRITEKCDVYGFGVLLLELVTGR  880

Query  349  RPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSSR  170
            RPVEY ED+V+IL DHVR LLE G  L CVD  M  YP++EVLPV+KLAL+CTS +PS+R
Sbjct  881  RPVEYMEDDVVILCDHVRALLEGGRPLTCVDSTMLPYPEDEVLPVIKLALICTSHVPSNR  940

Query  169  PSMAEVVQILQVIKTPVP  116
            P+M EVVQIL++I+ P+P
Sbjct  941  PAMEEVVQILELIR-PIP  957



>dbj|BAF79960.1| receptor-like kinase [Marchantia polymorpha]
Length=979

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            +ISD+ LA+L+ KLD +VMS++ Q+A+GY+APE ACQSL++ EKCDVYGFG+L+LE+VTG
Sbjct  837  RISDYSLAKLLPKLDTYVMSSKMQSALGYMAPEFACQSLKITEKCDVYGFGVLLLELVTG  896

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
            RRPVEY ED+V+IL D VR LL++G  L CVD  +  +P++EVLP++KL L+CTSQ+PS+
Sbjct  897  RRPVEYMEDDVVILCDFVRALLDEGRALSCVDSKLLSFPEDEVLPIIKLGLICTSQVPSN  956

Query  172  RPSMAEVVQILQVIKTPVPNR  110
            RPSMAEVVQIL++I+  V +R
Sbjct  957  RPSMAEVVQILELIRPLVESR  977



>ref|XP_002459131.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
 gb|EES04251.1| hypothetical protein SORBIDRAFT_03g046350 [Sorghum bicolor]
Length=1059

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 118/151 (78%), Gaps = 11/151 (7%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVMSN--RFQAAIG-----YVAPELACQSLRVNEKCDVYGFG  380
              P + DFGLARL+    +       RF AA G     YVAPELACQSLRVNEKCD+YG G
Sbjct  896   NPAVGDFGLARLLPVPGKLADGGCGRFHAAGGGGGMGYVAPELACQSLRVNEKCDIYGLG  955

Query  379   MLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM---GGY-PDEEVLPVL  212
             +LILE+VTGRR VEYG+D+V++L D VRVLLE GN LECVD GM   GG+ P+EEVLPVL
Sbjct  956   VLILELVTGRRAVEYGDDDVVVLMDQVRVLLEHGNALECVDPGMGMGGGHVPEEEVLPVL  1015

Query  211   KLALVCTSQIPSSRPSMAEVVQILQVIKTPV  119
             KLA+VCTSQIPS+RPSMAEVVQILQVIK PV
Sbjct  1016  KLAMVCTSQIPSNRPSMAEVVQILQVIKAPV  1046



>ref|XP_009349085.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   191 bits (485),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  807  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVT  866

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  867  GKRPVEYMEDDVVVLCDMVREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVP  926

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  927  SNRPDMGEVVNILELIRCPSEGQEE  951



>ref|XP_009362809.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=952

 Score =   191 bits (485),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  807  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVT  866

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  867  GKRPVEYMEDDVVVLCDMVREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVP  926

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  927  SNRPDMGEVVNILELIRCPSEGQEE  951



>ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=969

 Score =   191 bits (485),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  823  PKVADFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  883  GKRPVEYMEDDVVVLCDMVRGALEEGKVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  943  SNRPDMAEVVNILELIRCPSEGQEE  967



>ref|XP_004502826.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=970

 Score =   191 bits (484),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  823  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L++G V EC+D+ + G +P EEV+PV+KL LVCTSQ+P
Sbjct  883  GKRPVEYMEDDVVVLCDMVRGALDEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  943  SNRPDMGEVVTILELIRCPSEGQEE  967



>emb|CDP13903.1| unnamed protein product [Coffea canephora]
Length=898

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 86/145 (59%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVT
Sbjct  752  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLILEIVT  811

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  812  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  871

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P  ++ E
Sbjct  872  SNRPDMAEVVNILELIRCPSESQDE  896



>ref|NP_001239730.1| probably inactive leucine-rich repeat receptor-like protein kinase 
At3g28040-like precursor [Glycine max]
 gb|ACM89592.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN25807.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=971

 Score =   191 bits (484),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  825  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVT  884

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  885  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVP  944

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  945  SNRPDMGEVVNILELIRCPSEGQEE  969



>ref|XP_003522510.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=978

 Score =   191 bits (484),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  832  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVT  891

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  892  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDERLQGKFPAEEAIPVMKLGLICTSQVP  951

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  952  SNRPDMGEVVNILELIRCPSEGQEE  976



>ref|NP_001136621.1| uncharacterized protein LOC100216746 [Zea mays]
 gb|ACF82284.1| unknown [Zea mays]
Length=437

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 119/151 (79%), Gaps = 7/151 (5%)
 Frame = -3

Query  538  TPKISDFGLARLVA----KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGML  374
             P + +FGLARL+A    +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+L
Sbjct  285  NPAVGEFGLARLLADGGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVL  344

Query  373  ILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGY-PDEEVLPVLKLALV  197
            ILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +V
Sbjct  345  ILELVTGRRAVEYGDDDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMV  404

Query  196  CTSQIPSSRPSMAEVVQILQVIKTPVPNRME  104
            CTSQIPS+RPSMAEVVQILQVIK PV  RME
Sbjct  405  CTSQIPSNRPSMAEVVQILQVIKAPV-GRME  434



>ref|XP_007220278.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
 gb|EMJ21477.1| hypothetical protein PRUPE_ppa000889mg [Prunus persica]
Length=969

 Score =   190 bits (483),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  824  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  883

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+P
Sbjct  884  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVP  943

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  944  SNRPDMAEVVNILELIRCPSEGQEE  968



>ref|XP_008233886.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Prunus mume]
Length=975

 Score =   190 bits (483),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  830  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  889

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+P
Sbjct  890  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDGRLQGNFPAEEAIPVMKLGLICTSQVP  949

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  950  SNRPDMAEVVNILELIRCPSEGQEE  974



>ref|XP_009789234.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=972

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 84/147 (57%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  823  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  883  GKKPVEYMEDDVMVLCDIVRGALEDGKVEECVDGRLHGKFPVEEAIPVMKLGLICTSQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRMEPY  98
            S+RP MAEVV IL++I+ P   + EP+
Sbjct  943  SNRPDMAEVVNILEMIRCPSEGQDEPH  969



>ref|XP_011076585.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Sesamum indicum]
Length=987

 Score =   190 bits (482),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  838  PKVADCGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVT  897

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  898  GKRPVEYMEDDVVVLCDMVRGSLEEGKVEECVDDRLQGKFPAEEAIPVMKLGLICTSQVP  957

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P  ++ E
Sbjct  958  SNRPDMAEVVNILELIRCPSESQDE  982



>ref|XP_010067617.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW65785.1| hypothetical protein EUGRSUZ_G03140 [Eucalyptus grandis]
Length=972

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/139 (60%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEIVT
Sbjct  826  PKVADFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLALEIVT  885

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+P
Sbjct  886  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDGRLQGNFPSEEAIPVMKLGLICTSQVP  945

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  946  SNRPDMAEVVNILELIRCP  964



>gb|KJB73018.1| hypothetical protein B456_011G209800 [Gossypium raimondii]
Length=975

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++NEKCDVYGFG+L+LE+VT
Sbjct  829  PKLGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEVVT  888

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  889  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  948

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  949  SNRPDMGEVVNILELIRCP  967



>ref|XP_010670069.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  830  PKVGDFGLARLLPMLDRYILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  889

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  890  GRRPVEYMEDDVVVLCDMVRGALEEGKVEECVDERLQGRFPAEEAIPVMKLGLICTSQVP  949

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  950  SNRPDMREVVNILELIRCPSEGQEE  974



>ref|XP_004308984.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=969

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 83/145 (57%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  823  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+P
Sbjct  883  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDSRLQGSFPAEEAIPVMKLGLICTSQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  943  SNRPDMGEVVNILELIRCPSEGQEE  967



>ref|XP_007136420.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
 gb|ESW08414.1| hypothetical protein PHAVU_009G043600g [Phaseolus vulgaris]
Length=954

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/144 (58%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KI DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG
Sbjct  809  KIGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTG  868

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+PS
Sbjct  869  KRPVEYMEDDVVVLCDMVRGALEEGRVEECIDERLEGKFPAEEAIPVMKLGLICTSQVPS  928

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP M EVV IL++I+ P   + E
Sbjct  929  NRPDMGEVVNILELIRCPSEGQEE  952



>ref|XP_008369373.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=973

 Score =   189 bits (481),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  828  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVT  887

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +P++KL L+CTSQ+P
Sbjct  888  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDARLQGIFPAEEAIPMMKLGLICTSQVP  947

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  948  SNRPDMGEVVNILELIRCP  966



>gb|KHG09451.1| hypothetical protein F383_09289 [Gossypium arboreum]
Length=975

 Score =   189 bits (480),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++NEKCDVYGFG+L+LE+VT
Sbjct  829  PKLGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEVVT  888

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  889  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  948

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  949  SNRPDMGEVVNILELIRCP  967



>ref|XP_009363794.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
 ref|XP_009363882.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=973

 Score =   189 bits (480),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  828  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVT  887

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  888  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVP  947

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL +I+ P   + E
Sbjct  948  SNRPDMGEVVNILDLIRCPSEGQEE  972



>ref|XP_011084816.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=972

 Score =   189 bits (479),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  823  PKVADYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L+D VR  +E+G V +CVD + +G +P +E +PV+KL L+CTSQ+P
Sbjct  883  GKRPVEYMEDDVVVLSDMVRGAMEEGKVEDCVDARFLGKFPVDEAIPVIKLGLICTSQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I++P  ++ E
Sbjct  943  SNRPDMAEVVNILELIRSPSESQDE  967



>ref|XP_010253073.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   189 bits (479),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  824  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  883

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +CVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  884  GKRPVEYMEDDVVVLCDMVRGALEEGRVEQCVDGRLSGNFPAEEAIPVMKLGLICTSQVP  943

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP+MAEVV IL++I+ P   + E
Sbjct  944  SNRPNMAEVVNILELIRCPSEGQEE  968



>ref|XP_007011288.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY20098.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   189 bits (479),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 84/139 (60%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VT
Sbjct  836  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEVVT  895

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  896  GKRPVEYMEDDVVVLCDMVRGALEEGRVDECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  955

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  956  SNRPDMGEVVNILELIRCP  974



>ref|XP_006357297.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=971

 Score =   189 bits (479),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 83/145 (57%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVT
Sbjct  825  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVT  884

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  885  GKKPVEYMEDDVIVLCDMVRGALEEGKVEECVDKRLHGKFPAEEAIPVMKLGLICTSQVP  944

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  945  SNRPDMAEVVNILEMIRCPSEGQEE  969



>ref|XP_002319878.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE95801.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=965

 Score =   188 bits (478),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 85/145 (59%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVT
Sbjct  819  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD + +G +P +E +PV+KL L+CTSQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDGRLLGNFPADEAVPVMKLGLICTSQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL +I+ P   + E
Sbjct  939  SNRPDMGEVVNILDLIRCPSEGQEE  963



>gb|ACO55044.1| receptor-like kinase [Triticum aestivum]
Length=167

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TG
Sbjct  21   KVGDYGLAKLLPVLDRYVLSSKVQSALGYIAPEFTCRTVKITEKCDVYGFGVLVLEVMTG  80

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  81   RAPVEYMEDDVIVLCDVVRAALDEGKVEECVDEKLCGKFPLEEAVPIMKLGLVCTSQVPS  140

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  141  NRPDMSEVVNILELIRCP  158



>ref|XP_002325929.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF00311.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=963

 Score =   188 bits (477),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  817  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVT  876

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD + MG +P +EV+PV+KL L+CT Q+P
Sbjct  877  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDGRLMGNFPADEVVPVMKLGLICTLQVP  936

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EV+ IL +I+ P
Sbjct  937  SNRPDMGEVINILDLIRCP  955



>ref|XP_006435929.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
 gb|ESR49169.1| hypothetical protein CICLE_v10030625mg [Citrus clementina]
Length=997

 Score =   188 bits (478),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 81/145 (56%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  851  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITDKCDVYGFGVLVLEVVT  910

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  911  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDEKLQGKFPSEEAIPVMKLGLICTSQVP  970

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  971  SNRPDMEEVVNILELIRCPSEGQEE  995



>ref|XP_009757206.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=894

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VT
Sbjct  748  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLILEVVT  807

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G + +C+D+ + G +P +E +PV+KL L+CTSQ+P
Sbjct  808  GKRPVEYMEDDVVVLCDMVRGALEEGRIEDCIDKRLQGKFPADEAIPVMKLGLICTSQVP  867

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  868  SNRPDMAEVVNILELIRCP  886



>ref|XP_009623562.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=893

 Score =   187 bits (475),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VT
Sbjct  747  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLILEVVT  806

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G + +C+D  + G +P +E +PV+KL L+CTSQ+P
Sbjct  807  GKRPVEYMEDDVVVLCDMVRGALEEGRIEDCIDTRLQGKFPADEAIPVMKLGLICTSQVP  866

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  867  SNRPDMAEVVNILELIRCP  885



>gb|KEH35536.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=989

 Score =   188 bits (477),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE VT
Sbjct  840  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLETVT  899

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L++G V EC+D+ + G +P EEV+PV+KL LVCTSQ+P
Sbjct  900  GKRPVEYMEDDVVVLCDMVRGALDEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVP  959

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  960  SNRPEMGEVVTILELIRCP  978



>ref|XP_011001391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=963

 Score =   187 bits (476),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  817  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVT  876

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD + MG +P +EV+PV+KL L+CT Q+P
Sbjct  877  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDGRLMGNFPADEVVPVMKLGLICTLQVP  936

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EV+ IL +I+ P
Sbjct  937  SNRPDMGEVINILDLIRCP  955



>ref|XP_006486161.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=975

 Score =   187 bits (476),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 81/145 (56%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  829  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITDKCDVYGFGVLVLEVVT  888

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  889  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECIDEKLQGKFPSEEAIPVMKLGLICTSQVP  948

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  949  SNRPDMEEVVNILELIRCPSEGQEE  973



>ref|XP_004241084.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=971

 Score =   187 bits (475),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 121/145 (83%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVT
Sbjct  825  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVT  884

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  885  GKKPVEYMEDDVIVLCDMVRGALEEGKVEECVDKRLHGKFPAEEAIPVMKLGLICTSQVP  944

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP+MAEVV +L++I+ P   + E
Sbjct  945  SNRPNMAEVVNLLEMIRWPSEGQEE  969



>emb|CAE54285.1| receptor-like kinase with LRR repeats [Triticum aestivum]
Length=168

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TG
Sbjct  22   KVGDWGLAKLLPLLDRYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTG  81

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  82   RTPVEYMEDDVIVLCDVVRAALDEGKVEECVDEKLCGKFPLEEAVPIMKLGLVCTSQVPS  141

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  142  NRPDMSEVVNILELIRCP  159



>ref|XP_011095143.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Sesamum indicum]
Length=979

 Score =   187 bits (475),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L LE++T
Sbjct  833  PKVGDFGLARLLPALDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLTLEVLT  892

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  L++G + EC+D+ + G YP EE +PV+KL L+C SQ+P
Sbjct  893  GRRPVEYMEDDVVVLCDMVREALDEGRIEECIDKKLEGKYPMEEAIPVVKLGLICASQVP  952

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EV++IL++I+ P  ++ E
Sbjct  953  SNRPDMEEVIRILELIQCPTESQEE  977



>ref|XP_002520879.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF41588.1| ATP binding protein, putative [Ricinus communis]
Length=963

 Score =   187 bits (474),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  817  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIVT  876

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V +L D VR  LE+G V EC+D  + G +P +EV+PV+KL L+CTSQ+P
Sbjct  877  GKRPVEYMEDDVAVLCDMVRGALEEGRVEECIDDRLQGNFPADEVVPVMKLGLICTSQVP  936

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  937  SNRPDMGEVVNILELIRCP  955



>emb|CBI25352.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  630  PKVADFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  689

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  690  GKRPVEYMEDDVVVLCDMVRGALEEGKVEECVDGRLQGKFPAEEAIPVMKLGLICTSQVP  749

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  750  SNRPDMAEVVNILELIRCP  768



>ref|XP_008655312.1| PREDICTED: uncharacterized protein LOC100384143 isoform X1 [Zea 
mays]
 gb|AFW83919.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=1053

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 11/151 (7%)
 Frame = -3

Query  538   TPKISDFGLARLV--AKLDRHVM--SNRFQ----AAIGYVAPELACQSLRVNEKCDVYGF  383
              P + DFGLARL+  +   R V    +RF+      +GYVAPELACQSLR N+KCDVYG 
Sbjct  893   NPAVGDFGLARLLHGSGSGRQVAMAGSRFRQGGGGGMGYVAPELACQSLRANDKCDVYGV  952

Query  382   GMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGY---PDEEVLPVL  212
             G+LILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG    P+EEV+PVL
Sbjct  953   GVLILELVTGRRAVEYGDDDVVVLTDQVRALLEHGNALECVDPGMGGRGHVPEEEVVPVL  1012

Query  211   KLALVCTSQIPSSRPSMAEVVQILQVIKTPV  119
             KL +VC SQIPS+RPSMAEVVQILQVIK PV
Sbjct  1013  KLGMVCASQIPSNRPSMAEVVQILQVIKAPV  1043



>gb|KDP21644.1| hypothetical protein JCGZ_03315 [Jatropha curcas]
Length=960

 Score =   186 bits (472),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 81/144 (56%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG
Sbjct  815  KVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVITG  874

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE+G V ECVD+ + G +P +E +PV+KL L+CTSQ+PS
Sbjct  875  KRPVEYMEDDVVVLCDMVRGALEEGRVEECVDERLQGNFPADEAVPVMKLGLICTSQVPS  934

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP M EVV IL++I+ P   + E
Sbjct  935  NRPDMGEVVNILELIRCPSEGQEE  958



>ref|XP_010092789.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB52375.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=957

 Score =   186 bits (472),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 83/145 (57%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  811  PKLGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLLLEVVT  870

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD+ + G +P EE +PV+KL L+C SQ+P
Sbjct  871  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDERLQGIFPAEEAIPVIKLGLICASQVP  930

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  931  SNRPDMTEVVNILELIQCPSEGQEE  955



>ref|XP_009614707.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana tomentosiformis]
Length=980

 Score =   186 bits (472),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 80/138 (58%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLARL+  LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE+VTG
Sbjct  835  KVGDFGLARLLPVLDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILILEVVTG  894

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE+G + EC+DQ + G +P EE +PV+KL L+C SQ+PS
Sbjct  895  KRPVEYMEDDVVVLCDMVRGALEEGRIEECIDQRLQGNFPVEEAIPVVKLGLICASQVPS  954

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EV++IL++I+ P
Sbjct  955  NRPDMEEVIKILELIRCP  972



>ref|XP_011010876.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Populus euphratica]
Length=941

 Score =   186 bits (471),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVT
Sbjct  795  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVT  854

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+  V ECVD + +G +P +E +PV+KL L+CTSQ+P
Sbjct  855  GKRPVEYMEDDVVVLCDMVRGALEESRVEECVDGRLLGHFPADEAVPVMKLGLICTSQVP  914

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL +I+ P   + E
Sbjct  915  SNRPDMGEVVNILDLIRCPSEGQEE  939



>ref|XP_008244834.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Prunus mume]
Length=965

 Score =   186 bits (471),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLARLLPTLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+DQ  +G +P +E +PV+KL L+C SQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVP  938

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EV+ IL++I+ P
Sbjct  939  SNRPDMNEVINILELIQCP  957



>ref|XP_011010875.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Populus euphratica]
Length=965

 Score =   186 bits (471),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 84/145 (58%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC++ ++ EKCDVYGFG+LILEIVT
Sbjct  819  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTAKITEKCDVYGFGVLILEIVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+  V ECVD + +G +P +E +PV+KL L+CTSQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEESRVEECVDGRLLGHFPADEAVPVMKLGLICTSQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL +I+ P   + E
Sbjct  939  SNRPDMGEVVNILDLIRCPSEGQEE  963



>ref|XP_008456960.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=925

 Score =   185 bits (470),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 81/139 (58%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILE+VT
Sbjct  779  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEVVT  838

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V +L+D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS +P
Sbjct  839  GKRPVEYMEDDVAVLSDVVREAVEEGRAEECVDRNLRGSFPIEEAVPVLKLGLICTSHVP  898

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M E+V+IL++IK P
Sbjct  899  SNRPDMREMVKILEMIKCP  917



>ref|XP_004173628.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Cucumis sativus]
Length=774

 Score =   184 bits (466),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+LILE+VT
Sbjct  628  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFTCRTVKITEKCDVYGFGILILEVVT  687

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V +L+D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS +P
Sbjct  688  GKRPVEYMEDDVAVLSDMVREAVEEGRAEECVDRNLRGSFPMEEAVPVLKLGLICTSHVP  747

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M E+V+IL++IK P
Sbjct  748  SNRPDMREMVKILEMIKCP  766



>ref|XP_007207150.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
 gb|EMJ08349.1| hypothetical protein PRUPE_ppa000904mg [Prunus persica]
Length=965

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLARLLPTLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+DQ  +G +P +E +PV+KL L+C SQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECLDQKLLGNFPADEAIPVVKLGLICASQVP  938

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EV+ IL++I+ P
Sbjct  939  SNRPDMNEVINILELIQCP  957



>ref|XP_004246289.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=965

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 80/146 (55%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -3

Query  538  TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
            + KI DFGLARL+  LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG++ILE+V
Sbjct  818  STKIGDFGLARLLPILDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGIMILEVV  877

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
            TG+RPVEY ED+V++L D VR  LE+G + EC+D  + G +P EE +PV+KL L+C SQ+
Sbjct  878  TGKRPVEYMEDDVIVLCDMVRGALEEGRIEECIDGRLQGNFPVEEAIPVVKLGLICASQV  937

Query  181  PSSRPSMAEVVQILQVIKTPVPNRME  104
            PS+RP M EV++IL++I+ P  ++ E
Sbjct  938  PSNRPDMEEVIKILELIRCPSESQEE  963



>gb|KJB67929.1| hypothetical protein B456_010G218400 [Gossypium raimondii]
Length=983

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++DFGLARL+  LDR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L++E+VT
Sbjct  838  PKVADFGLARLLPMLDRYILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVMEVVT  897

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V+IL D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  898  GKRPVEYMEDDVVILCDMVRGALEEGRVEECVDERLQGKFPVEEAIPVMKLGLICTSQVP  957

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M+EVV IL++I+ P
Sbjct  958  SNRPDMSEVVNILELIRCP  976



>ref|XP_006842493.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
 gb|ERN04168.1| hypothetical protein AMTR_s00077p00091370 [Amborella trichopoda]
Length=981

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 86/138 (62%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC S RV+EKCDVYGFG+L LEI+TG
Sbjct  837  KVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACGSARVSEKCDVYGFGVLTLEIITG  896

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V+IL+D VR  LE G V  CVD  MG  +P+E ++P++KLAL+C SQ+PS
Sbjct  897  RRPVEYTEDDVVILSDSVRGALEGGRVGSCVDPRMGPAWPEEVLVPLVKLALICASQVPS  956

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP+M EVV IL+VI +P
Sbjct  957  NRPAMGEVVHILEVIGSP  974



>gb|KHG03607.1| hypothetical protein F383_26757 [Gossypium arboreum]
Length=987

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 118/139 (85%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++DFGLARL+  LDR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L++E+VT
Sbjct  842  PKVADFGLARLLPMLDRYILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVMEVVT  901

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  902  GKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDERLQGKFPVEEAIPVMKLGLICTSQVP  961

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M+EVV IL++I+ P
Sbjct  962  SNRPDMSEVVNILELIRCP  980



>ref|XP_004146470.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN50740.1| hypothetical protein Csa_5G222990 [Cucumis sativus]
Length=925

 Score =   184 bits (467),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+LILE+VT
Sbjct  779  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFTCRTVKITEKCDVYGFGILILEVVT  838

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V +L+D VR  +E+G   ECVD+ + G +P EE +PVLKL L+CTS +P
Sbjct  839  GKRPVEYMEDDVAVLSDMVREAVEEGRAEECVDRNLRGSFPMEEAVPVLKLGLICTSHVP  898

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M E+V+IL++IK P
Sbjct  899  SNRPDMREMVKILEMIKCP  917



>ref|XP_009406870.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
 ref|XP_009406871.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=969

 Score =   184 bits (468),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/146 (56%), Positives = 118/146 (81%), Gaps = 1/146 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG
Sbjct  823  KVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTG  882

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE+G V EC+D  + G +P EE +PV+KL L+CTSQ+PS
Sbjct  883  KRPVEYMEDDVVLLCDMVREALEEGRVEECMDGRLCGKFPLEETIPVIKLGLICTSQVPS  942

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY  98
            +RP MAEVV IL++I+ P   R E +
Sbjct  943  NRPDMAEVVNILELIRCPQDGRQEEF  968



>gb|ACN33819.1| unknown [Zea mays]
 tpg|DAA55768.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1043

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 119/151 (79%), Gaps = 7/151 (5%)
 Frame = -3

Query  538   TPKISDFGLARLVA----KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGML  374
              P + +FGLARL+A    +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+L
Sbjct  891   NPAVGEFGLARLLADGGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVL  950

Query  373   ILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALV  197
             ILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +V
Sbjct  951   ILELVTGRRAVEYGDDDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMV  1010

Query  196   CTSQIPSSRPSMAEVVQILQVIKTPVPNRME  104
             CTSQIPS+RPSMAEVVQILQVIK PV  RME
Sbjct  1011  CTSQIPSNRPSMAEVVQILQVIKAPV-GRME  1040



>ref|XP_002267737.3| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Vitis vinifera]
Length=993

 Score =   184 bits (468),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DF LARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  848  PKVGDFALARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  907

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  L++G V ECVD+ + G +P +E +PV+KL L+C SQ+P
Sbjct  908  GRRPVEYMEDDVVVLCDMVRGALDEGKVEECVDRRLQGEFPADEAIPVIKLGLICASQVP  967

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  968  SNRPDMGEVVNILELIQCP  986



>ref|XP_010103654.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB96537.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=978

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 81/145 (56%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  830  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  889

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+ PVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +P +KL L+CTSQ+P
Sbjct  890  GKMPVEYMEDDVVVLCDMVRGALEEGRVEECVDARLHGKFPAEEAIPAMKLGLICTSQVP  949

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P  ++ E
Sbjct  950  SNRPDMGEVVNILELIRCPSEDQEE  974



>ref|XP_009793754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nicotiana sylvestris]
Length=965

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/138 (57%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLARL+  LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L LE+VTG
Sbjct  820  KVGDFGLARLLPVLDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILTLEVVTG  879

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            ++PVEY ED+VL+L D VR  LE+G + EC+DQ + G +P EE +PV+KL L+C SQ+PS
Sbjct  880  KKPVEYMEDDVLVLCDMVRGALEEGRIEECIDQRLQGHFPVEEAIPVVKLGLICASQVPS  939

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EV++IL++I+ P
Sbjct  940  NRPDMEEVIKILELIRCP  957



>gb|EYU42026.1| hypothetical protein MIMGU_mgv1a000905mg [Erythranthe guttata]
Length=946

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 79/144 (55%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLA+L+  LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE++TG
Sbjct  801  KVGDFGLAKLLPALDRYILSSKVQSALGYMAPEFACQTVKITEKCDVYGFGVLILEVITG  860

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  L++G V EC+D+ + GGY  EE +PV+KL L+C SQ+PS
Sbjct  861  KRPVEYMEDDVVVLCDMVREALDEGRVEECIDKKLNGGYSMEEAIPVIKLGLICASQVPS  920

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP M EV++IL++I+ P  ++ E
Sbjct  921  NRPDMEEVIRILELIQCPSESQEE  944



>ref|XP_004240861.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Solanum lycopersicum]
Length=894

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  748  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  807

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +C+D  M G +P +EV+PV+KL L+CTSQ+P
Sbjct  808  GKRPVEYMEDDVVVLCDMVRGALEEGRVEDCIDARMQGKFPADEVIPVMKLGLICTSQVP  867

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  868  SNRPDMGEVVNILELIRYP  886



>ref|XP_009372024.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Pyrus x bretschneideri]
Length=965

 Score =   184 bits (466),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D GLARL+  LDR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDIGLARLLPTLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D+  +G +P EE +PV+KL L+C SQ+P
Sbjct  879  GKRPVEYMEDDVIVLCDMVRGALEEGRVEECLDKNLLGNFPAEEAIPVIKLGLICASQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EV+ IL++I+ P   + E
Sbjct  939  SNRPDMNEVINILELIQCPSEGQEE  963



>ref|XP_010253067.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Nelumbo nucifera]
Length=970

 Score =   184 bits (466),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 83/145 (57%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  824  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLLLEVVT  883

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +CVD  + G +  EE +PV+KL L+CTSQ+P
Sbjct  884  GKRPVEYMEDDVVVLCDMVRGALEEGRVEQCVDGRLSGNFLAEEAIPVMKLGLICTSQVP  943

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  944  SNRPDMAEVVNILELIRCPSEGQEE  968



>ref|XP_008672259.1| PREDICTED: uncharacterized protein LOC100216746 isoform X1 [Zea 
mays]
Length=1150

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 119/151 (79%), Gaps = 7/151 (5%)
 Frame = -3

Query  538   TPKISDFGLARLVA----KLDRHVMSNRFQ-AAIGYVAPELACQSLRVNEKCDVYGFGML  374
              P + +FGLARL+A    +    +   RFQ    GYVAPELACQSLRVNEKCD+YG G+L
Sbjct  998   NPAVGEFGLARLLADGGGRQQVAMGGGRFQQGGAGYVAPELACQSLRVNEKCDIYGLGVL  1057

Query  373   ILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALV  197
             ILE+VTGRR VEYG+D+V++L D VR LLE GN LECVD GMGG  P+EEVLPVLKL +V
Sbjct  1058  ILELVTGRRAVEYGDDDVVVLVDQVRALLEHGNALECVDPGMGGRVPEEEVLPVLKLGMV  1117

Query  196   CTSQIPSSRPSMAEVVQILQVIKTPVPNRME  104
             CTSQIPS+RPSMAEVVQILQVIK PV  RME
Sbjct  1118  CTSQIPSNRPSMAEVVQILQVIKAPV-GRME  1147



>ref|XP_006341303.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=982

 Score =   184 bits (466),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 78/140 (56%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = -3

Query  538  TPKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIV  359
            + K+ DFGLARL+  LDR+++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+LILE+V
Sbjct  835  STKVGDFGLARLLPVLDRYILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILILEVV  894

Query  358  TGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQI  182
            TG+RP+EY ED+V++L D VR  LE+G + EC+D  + G +P EE +PV+KL L+C SQ+
Sbjct  895  TGKRPMEYMEDDVIVLCDMVRGALEEGRIEECIDGRLQGNFPVEEAIPVVKLGLICASQV  954

Query  181  PSSRPSMAEVVQILQVIKTP  122
            PS+RP M EV++IL++I+ P
Sbjct  955  PSNRPDMEEVIKILELIRCP  974



>ref|XP_010525412.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=965

 Score =   184 bits (466),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVTG
Sbjct  818  KVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIVTG  877

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE G   ECVD  + G +P EE +PV+KL L+CTSQ+PS
Sbjct  878  KRPVEYMEDDVVVLCDMVREALEDGRAEECVDARLQGKFPTEEAVPVIKLGLICTSQVPS  937

Query  175  SRPSMAEVVQILQVIKTP  122
            SRP M EVV IL++I+ P
Sbjct  938  SRPDMGEVVNILKMIRCP  955



>ref|XP_009416321.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=969

 Score =   183 bits (465),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 80/139 (58%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D GLA+L+  LDR+V+S++ Q+A+GY+APE ACQ++++ +KCDVYGFG+L+LEI+T
Sbjct  821  PKVGDCGLAKLLPMLDRYVLSSKIQSALGYMAPEFACQTVKITDKCDVYGFGVLVLEIMT  880

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L+D VR  L++G V EC+D+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  881  GKRPVEYMEDDVVLLSDMVRETLDEGKVEECMDERLCGKFPLEETIPVMKLGLICTSQVP  940

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  941  SNRPEMAEVVNILELIRFP  959



>ref|XP_002528692.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
 gb|EEF33681.1| Brassinosteroid LRR receptor kinase precursor, putative [Ricinus 
communis]
Length=968

 Score =   183 bits (465),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 81/145 (56%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  822  PKVGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVT  881

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V ECVD + +G +P +E +PV+KL L+C SQ+P
Sbjct  882  GKRPVEYMEDDVVVLCDMVRGALENGRVEECVDGRLLGNFPADEAIPVIKLGLICASQVP  941

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  942  SNRPDMEEVVNILELIQCPAEGQEE  966



>gb|KDO64103.1| hypothetical protein CISIN_1g002094mg [Citrus sinensis]
Length=967

 Score =   183 bits (464),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  821  PKVGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  880

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+P
Sbjct  881  GKRPVEYMEDDVVVLCDMVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVP  940

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I++P+  + E
Sbjct  941  SNRPDMEEVVNILELIQSPLDGQEE  965



>gb|EYU35201.1| hypothetical protein MIMGU_mgv1a000839mg [Erythranthe guttata]
Length=967

 Score =   183 bits (464),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 79/136 (58%), Positives = 115/136 (85%), Gaps = 1/136 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++TG
Sbjct  816  KVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVLTG  875

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L+D VR  +E+G V ECVD  M G +P EE +PV+KL L+CTSQ+PS
Sbjct  876  KRPVEYMEDDVVVLSDMVRGAVEEGRVEECVDSRMLGKFPVEEAIPVMKLGLICTSQVPS  935

Query  175  SRPSMAEVVQILQVIK  128
            +RP M EVV IL++I+
Sbjct  936  NRPDMDEVVNILEMIR  951



>ref|XP_006481196.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Citrus sinensis]
Length=967

 Score =   183 bits (464),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  821  PKVGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  880

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+P
Sbjct  881  GKRPVEYMEDDVVVLCDMVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVP  940

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I++P+  + E
Sbjct  941  SNRPDMEEVVNILELIQSPLDGQEE  965



>ref|XP_006429586.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
 gb|ESR42826.1| hypothetical protein CICLE_v10010994mg [Citrus clementina]
Length=969

 Score =   183 bits (464),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  823  PKVGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V +CVD  + G +P +E +PV+KL L+C SQ+P
Sbjct  883  GKRPVEYMEDDVVVLCDMVRGALEDGRVEDCVDARLRGNFPADEAIPVIKLGLICASQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I++P+  + E
Sbjct  943  SNRPDMEEVVNILELIQSPLDGQEE  967



>ref|XP_007033525.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04451.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=965

 Score =   182 bits (463),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  819  PKVGDFGLARLLPTLDRCILSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVIT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L+D VR  LE G V EC+D  +   +P EE +PV+KL L+C SQ+P
Sbjct  879  GKRPVEYMEDDVVVLSDMVRGALEDGRVEECIDGSLRSNFPAEEAIPVIKLGLICASQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  939  SNRPDMEEVVNILELIQCPSDGQEE  963



>ref|XP_006358746.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Solanum tuberosum]
Length=894

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK++D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  748  PKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  807

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +C+D  + G +P +EV+PV+KL L+CTSQ+P
Sbjct  808  GKRPVEYMEDDVVVLCDMVRGALEEGRVEDCIDARLQGKFPADEVIPVMKLGLICTSQVP  867

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  868  SNRPDMGEVVNILELIRCP  886



>ref|XP_010043193.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW88339.1| hypothetical protein EUGRSUZ_A00726 [Eucalyptus grandis]
Length=962

 Score =   182 bits (462),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 80/144 (56%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG
Sbjct  817  KVGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEIITG  876

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D VR  LE+  V +C+D  +GG +P EE +PV+KL L+C SQ+PS
Sbjct  877  RRPVEYMEDDVVVLCDMVRGALEENKVEKCIDGSLGGSFPPEEAIPVIKLGLICASQVPS  936

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP M+EVV IL++I+ P   + E
Sbjct  937  NRPEMSEVVNILELIQCPSEGQEE  960



>ref|XP_010683484.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Beta vulgaris subsp. vulgaris]
Length=972

 Score =   182 bits (462),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 80/144 (56%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ DFGLARL+  LDR+++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG
Sbjct  824  KVGDFGLARLLPMLDRYILSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEVVTG  883

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R+PVEY ED+V++L + VR  LE+G   +C+DQ + G +  EEV+PV+KL L+C SQ+PS
Sbjct  884  RKPVEYMEDDVVVLAEMVRGALEEGKSEDCIDQRLHGNFIAEEVIPVIKLGLICASQVPS  943

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP MAEVV IL++I+ P   R E
Sbjct  944  NRPEMAEVVNILELIQCPSEGRDE  967



>ref|XP_008370260.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Malus domestica]
Length=965

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLARLLPTLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D+  +G +P EE +PV+KL L+C SQ+P
Sbjct  879  GKRPVEYLEDDVIVLCDMVRGALEEGRVEECLDKNLLGNFPAEEAIPVVKLGLICASQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M+EV+ IL++I+ P     E
Sbjct  939  SNRPDMSEVINILELIQCPSEGHEE  963



>ref|XP_009125388.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=925

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  782  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVT  841

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  842  GKRPVEYAEDDVMVLCETVREGLEEGRVEECVDARLRGDFPAEEAIPVVKLGLVCGSQVP  901

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I+ P
Sbjct  902  SNRPEMEEVVKILELIQCP  920



>emb|CDY04822.1| BnaAnng00040D [Brassica napus]
Length=928

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 83/139 (60%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  785  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVT  844

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  845  GKRPVEYAEDDVMVLCETVREGLEEGRVEECVDARLRGDFPAEEAIPVIKLGLVCGSQVP  904

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I+ P
Sbjct  905  SNRPEMEEVVKILELIQCP  923



>ref|XP_006279331.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
 gb|EOA12229.1| hypothetical protein CARUB_v10012717mg [Capsella rubella]
Length=967

 Score =   181 bits (460),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  824  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  883

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  884  GKRPVEYAEDDVVVLCETVRERLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVP  943

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I++P
Sbjct  944  SNRPDMEEVVKILELIQSP  962



>ref|XP_004984462.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=972

 Score =   181 bits (460),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 80/138 (58%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TG
Sbjct  826  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTG  885

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  886  RTPVEYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  945

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  946  NRPDMSEVVNILELIRCP  963



>ref|XP_006840189.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
 gb|ERN01864.1| hypothetical protein AMTR_s00089p00108500 [Amborella trichopoda]
Length=975

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+SD+GL RL + L +  +S     + GY+APEL C SL VNEKCDVY FG+L+LEIV+
Sbjct  834  PKLSDYGLVRLFSSLGKRGLS----MSPGYMAPELTCGSLCVNEKCDVYSFGVLLLEIVS  889

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRR VEY ED++++L + VR ++E+G  LECVD  M  Y +EEV+P+L+L LVCTSQ+PS
Sbjct  890  GRRAVEYREDDMVMLCEDVRSMVERGRGLECVDMKMEEYAEEEVVPLLRLGLVCTSQVPS  949

Query  175  SRPSMAEVVQILQVIKTPVPNRMEPY  98
            SRPSMAEVVQILQVIKTPVP RME +
Sbjct  950  SRPSMAEVVQILQVIKTPVPERMEVF  975



>ref|XP_002309183.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
 gb|EEE92706.1| hypothetical protein POPTR_0006s10910g [Populus trichocarpa]
Length=965

 Score =   181 bits (459),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLA+L+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLAKLLPTLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V EC+D  +GG  P +E +PV+KL L+C SQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEDGRVEECIDGKLGGKVPADEAIPVIKLGLICASQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P     E
Sbjct  939  SNRPDMEEVVNILELIQCPAEGHEE  963



>gb|KDP21865.1| hypothetical protein JCGZ_00652 [Jatropha curcas]
Length=638

 Score =   179 bits (453),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  492  PKVGDFGLARLLPMLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVT  551

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V EC+D  + G +P EE +PV+KL L+C SQ+P
Sbjct  552  GKRPVEYMEDDVVVLCDMVRGALEDGRVEECIDGKLRGNFPAEEAIPVIKLGLICASQVP  611

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  612  SNRPDMEEVVNILELIQCPAEGQEE  636



>ref|XP_006650049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Oryza brachyantha]
Length=971

 Score =   181 bits (458),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 79/138 (57%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG
Sbjct  825  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTG  884

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  885  RTPVEYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  944

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  945  NRPDMSEVVNILELIRCP  962



>ref|XP_009416322.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=870

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D GLA+L+  LDR+V+S++ Q+A+GY+APE ACQ++++ +KCDVYGFG+L+LEI+T
Sbjct  722  PKVGDCGLAKLLPMLDRYVLSSKIQSALGYMAPEFACQTVKITDKCDVYGFGVLVLEIMT  781

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L+D VR  L++G V EC+D+ + G +P EE +PV+KL L+CTSQ+P
Sbjct  782  GKRPVEYMEDDVVLLSDMVRETLDEGKVEECMDERLCGKFPLEETIPVMKLGLICTSQVP  841

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  842  SNRPEMAEVVNILELIRFP  860



>gb|KHN40633.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=637

 Score =   178 bits (452),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGL +L+  LD  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEIVT
Sbjct  491  PKVGDFGLVKLLPMLDHCVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGILVLEIVT  550

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +CVD + +G +  EE +PV+KL L+C SQ+P
Sbjct  551  GKRPVEYMEDDVVVLCDMVRGALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVP  610

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  611  SNRPEMAEVVNILELIQCPSEGQEE  635



>ref|XP_002467905.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
 gb|EER94903.1| hypothetical protein SORBIDRAFT_01g036160 [Sorghum bicolor]
Length=972

 Score =   181 bits (458),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 80/138 (58%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TG
Sbjct  826  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTG  885

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  886  RTPVEYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  945

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EVV IL++I+ P
Sbjct  946  NRPDMNEVVNILELIRCP  963



>ref|XP_008456780.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=964

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  818  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  877

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+P
Sbjct  878  GKRPVEYMEDDVVVLCDMVRRELEEGQVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVP  937

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  938  SNRPDMAEVVNILELIRCPSEGQEE  962



>dbj|BAK06250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=973

 Score =   180 bits (457),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 77/138 (56%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TG
Sbjct  827  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTG  886

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  887  RTPVEYMEDDVIVLCDVVRAALDEGKVEECVDEKLCGKFPLEEAVPIMKLGLVCTSQVPS  946

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  947  NRPDMSEVVNILELIRCP  964



>ref|XP_010424006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
Length=959

 Score =   180 bits (456),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  815  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  874

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+P
Sbjct  875  GKRPVEYAEDDVVVLCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVP  934

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV+IL++I+ P  + +E
Sbjct  935  SNRPDMEEVVKILELIQCPPSHDLE  959



>ref|XP_004173348.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
Length=964

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  818  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  877

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+P
Sbjct  878  GKRPVEYMEDDVVVLCDMVRRELEEGRVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVP  937

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  938  SNRPDMAEVVNILELIRCPSEGQEE  962



>ref|XP_004138394.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN45839.1| hypothetical protein Csa_6G014590 [Cucumis sativus]
Length=964

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  818  PKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVVT  877

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V EC+D  +   +P EE +PV+KL L+CTSQ+P
Sbjct  878  GKRPVEYMEDDVVVLCDMVRRELEEGRVEECIDGRLQRNFPLEEAIPVVKLGLICTSQVP  937

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  938  SNRPDMAEVVNILELIRCPSEGQEE  962



>ref|XP_011002596.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   180 bits (456),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLA+L+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLAKLLPTLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V EC+D  + G +P +E +PV+KL L+C+SQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEDGRVEECIDGRLRGNFPADEAIPVVKLGLICSSQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  939  SNRPDMEEVVNILELIQCPAGGQEE  963



>ref|XP_010424007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=955

 Score =   180 bits (456),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  811  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  870

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+P
Sbjct  871  GKRPVEYAEDDVVVLCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVP  930

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV+IL++I+ P  + +E
Sbjct  931  SNRPDMEEVVKILELIQCPPSHDLE  955



>ref|XP_010451924.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=953

 Score =   180 bits (456),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  809  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  868

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+P
Sbjct  869  GKRPVEYAEDDVVVLCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVP  928

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV+IL++I+ P  + +E
Sbjct  929  SNRPDMEEVVKILELIQCPPSHDLE  953



>ref|XP_002323672.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
 gb|EEF05433.2| hypothetical protein POPTR_0016s14410g [Populus trichocarpa]
Length=965

 Score =   180 bits (456),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLA+L+  LDR ++S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLAKLLPTLDRCILSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V EC+D  + G +P +E +PV+KL L+C+SQ+P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEDGRVEECIDGRLRGNFPADEAIPVVKLGLICSSQVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  939  SNRPDMEEVVNILELIQCPAGGQEE  963



>gb|KFK24685.1| hypothetical protein AALP_AA8G011600 [Arabis alpina]
Length=976

 Score =   180 bits (456),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  833  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  892

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  893  GKRPVEYAEDDVVVLCETVREGLEEGRVEECVDGRLRGNFPAEEAIPVIKLGLVCGSQVP  952

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I+ P
Sbjct  953  SNRPDMEEVVKILELIQCP  971



>emb|CBI18033.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DF LARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  663  PKVGDFALARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  722

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  L++G V ECVD+ + G +P +E +PV+KL L+C SQ+P
Sbjct  723  GRRPVEYMEDDVVVLCDMVRGALDEGKVEECVDRRLQGEFPADEAIPVIKLGLICASQVP  782

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I+ P
Sbjct  783  SNRPDMGEVVNILELIQCP  801



>ref|XP_010490496.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=967

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  823  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  882

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +P +KL LVC SQ+P
Sbjct  883  GKRPVEYAEDDVVVLCETVRERLEEGRVEECVDPRLRGNFPAEEAIPAIKLGLVCGSQVP  942

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV+IL++I+ P  + +E
Sbjct  943  SNRPDMEEVVKILELIQCPPSHDLE  967



>ref|XP_004492560.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=958

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 81/145 (56%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL +L+  LD  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVT
Sbjct  811  PKIGDFGLVKLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVT  870

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD+  +G +  EE +PV+KL L+C SQ+P
Sbjct  871  GKRPVEYMEDDVVVLCDMVRGALEEGKVEECVDERLLGNFAAEEAIPVIKLGLICASQVP  930

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EV+ IL++I+ P   + E
Sbjct  931  SNRPDMDEVINILELIQCPSEGQEE  955



>ref|XP_002870895.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47154.1| hypothetical protein ARALYDRAFT_486880 [Arabidopsis lyrata subsp. 
lyrata]
Length=968

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ +KCDVYGFG+L+LE+VT
Sbjct  825  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDKCDVYGFGILVLEVVT  884

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  885  GKRPVEYAEDDVVVLCETVREGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVP  944

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I+ P
Sbjct  945  SNRPEMEEVVKILELIQCP  963



>ref|XP_006290555.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23453.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=939

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  791  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  850

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  851  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVP  910

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  911  SSRPHMGEAVNILRMIRCP  929



>gb|EPS70735.1| hypothetical protein M569_04020, partial [Genlisea aurea]
Length=954

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 78/138 (57%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K++D+GLA L+  LDR+V+S++ Q+A+GY+APE A +++++ EKCDVYGFG+L+LE+V+G
Sbjct  816  KVADYGLAGLLPMLDRYVLSSKIQSALGYMAPEFAVKTIKITEKCDVYGFGILVLEMVSG  875

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D +R ++E+G V ECVD  + G +  EEV+PV+KL L+CTSQ+PS
Sbjct  876  RRPVEYMEDDVVVLADMIRGVVEEGKVEECVDSRLQGKFSAEEVVPVMKLGLICTSQVPS  935

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP MAEVV +L++IK P
Sbjct  936  TRPHMAEVVSMLELIKCP  953



>ref|NP_195809.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL11557.1|AF424563_1 AT5g01890/T20L15_160 [Arabidopsis thaliana]
 emb|CAB82759.1| putative protein [Arabidopsis thaliana]
 gb|AAO42766.1| At5g01890/T20L15_160 [Arabidopsis thaliana]
 gb|ACN59360.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90406.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=967

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/139 (58%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLARL+A  LDR V+S + Q+A+GY APE AC+++++ ++CDVYGFG+L+LE+VT
Sbjct  824  KVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDRCDVYGFGILVLEVVT  883

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  884  GKRPVEYAEDDVVVLCETVREGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLVCGSQVP  943

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I+ P
Sbjct  944  SNRPEMEEVVKILELIQCP  962



>gb|AES79844.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=954

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/144 (56%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KI DFGL +L+  LD  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG
Sbjct  808  KIGDFGLVKLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTG  867

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE+GNV  CVD+  +G +  EE +PV+KL L+C SQ+PS
Sbjct  868  KRPVEYMEDDVVVLCDMVRGSLEEGNVEHCVDERLLGNFAAEEAIPVIKLGLICASQVPS  927

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP M+EV+ IL++I+ P   + E
Sbjct  928  NRPDMSEVINILELIQCPSEGQEE  951



>ref|XP_006290556.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
 gb|EOA23454.1| hypothetical protein CARUB_v10016642mg [Capsella rubella]
Length=966

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  818  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  877

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  878  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVP  937

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  938  SSRPHMGEAVNILRMIRCP  956



>ref|XP_003623626.1| Receptor-like protein kinase [Medicago truncatula]
Length=948

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/144 (56%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            KI DFGL +L+  LD  V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEIVTG
Sbjct  802  KIGDFGLVKLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGILILEIVTG  861

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L D VR  LE+GNV  CVD+  +G +  EE +PV+KL L+C SQ+PS
Sbjct  862  KRPVEYMEDDVVVLCDMVRGSLEEGNVEHCVDERLLGNFAAEEAIPVIKLGLICASQVPS  921

Query  175  SRPSMAEVVQILQVIKTPVPNRME  104
            +RP M+EV+ IL++I+ P   + E
Sbjct  922  NRPDMSEVINILELIQCPSEGQEE  945



>ref|XP_009116341.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brassica rapa]
Length=959

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 79/139 (57%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  811  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  870

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   ECVD  + G +P EE + V+KL L+CTSQ+P
Sbjct  871  GKKPVEYMEDDVVVLCDMVREALEDGRAEECVDMRLQGKFPVEEAVAVIKLGLICTSQVP  930

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  931  SSRPHMGEAVNILRMIRCP  949



>ref|XP_007134722.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06716.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=783

 Score =   177 bits (448),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL RL+  LD  V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+LILE+VT
Sbjct  637  PKIGDFGLVRLLPMLDPCVLSSKIQSALGYMAPEFACRTVKITEKCDVYSFGILILEVVT  696

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+P
Sbjct  697  GKRPVEYMEDDVVVLCDKVRSALDDGKVEQCVDENLKGNFAAEEAVPVIKLGLVCASQVP  756

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S RP MAEV+ IL++I+ P   + E
Sbjct  757  SKRPDMAEVINILELIQCPSEGQEE  781



>ref|XP_010938277.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=737

 Score =   176 bits (447),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI D+GLA+L+  LD +V+S++ Q+A+GY+APE AC+++++ EKCDVY FGM++LEI+ 
Sbjct  590  PKIGDYGLAKLLPVLDHYVLSSKLQSALGYLAPEFACRTVKITEKCDVYAFGMVVLEIMA  649

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V ECVD  + G +P EE +PV+KL L+CTSQ+P
Sbjct  650  GKRPVEYLEDDVVVLRDIVRGALEEGKVEECVDGRLCGKFPLEEAIPVIKLGLICTSQVP  709

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV +L++I+ P
Sbjct  710  SNRPDMGEVVNMLELIRCP  728



>gb|EEC75203.1| hypothetical protein OsI_11455 [Oryza sativa Indica Group]
Length=971

 Score =   178 bits (451),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/138 (57%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TG
Sbjct  825  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTG  884

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PV+Y ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  885  RTPVQYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  944

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  945  NRPDMSEVVNILELIRCP  962



>ref|XP_008359946.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423634 
[Malus domestica]
Length=1756

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PK+ D GLARL+  LDR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  1610  PKVGDIGLARLLPTLDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGILVLEVVT  1669

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
             G+RPVEY ED+V++L+D VR  L +G V EC+D+  +G +P EE +PV+KL L+C SQ+P
Sbjct  1670  GKRPVEYVEDDVIVLSDMVRGALGEGRVEECLDKNLLGNFPAEEAIPVIKLGLICASQVP  1729

Query  178   SSRPSMAEVVQILQVIKTPVPNRME  104
             S+RP M EV+ IL++I+ P   + E
Sbjct  1730  SNRPDMGEVINILELIQCPSEGQEE  1754



>gb|EAZ26832.1| hypothetical protein OsJ_10748 [Oryza sativa Japonica Group]
Length=971

 Score =   178 bits (451),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/138 (57%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TG
Sbjct  825  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTG  884

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PV+Y ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  885  RTPVQYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  944

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  945  NRPDMSEVVNILELIRCP  962



>ref|NP_001050035.1| Os03g0335500 [Oryza sativa Japonica Group]
 gb|ABF95811.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11949.1| Os03g0335500 [Oryza sativa Japonica Group]
Length=971

 Score =   178 bits (451),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/138 (57%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+TG
Sbjct  825  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLALEILTG  884

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PV+Y ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  885  RTPVQYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  944

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  945  NRPDMSEVVNILELIRCP  962



>ref|XP_002878081.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54340.1| hypothetical protein ARALYDRAFT_907079 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   178 bits (451),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  816  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  875

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  876  GKKPVEYMEDDVVVLCDMVREALEDGKADECIDPRLQGKFPVEEAVAVIKLGLICTSQVP  935

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  936  SSRPHMGEAVNILRMIRCP  954



>ref|XP_006644919.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Oryza brachyantha]
Length=858

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P+I D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  711  PRIGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  770

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G + +C+D  + G +P EE LP++KL LVCTSQ+P
Sbjct  771  GRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSQVP  830

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  831  SNRPDMGEVVNILELVRSP  849



>gb|KHM99411.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=780

 Score =   176 bits (447),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL RL+  LD  V+S++ Q+A+GY APE AC+++++ EKCD+Y FG+LILE+VT
Sbjct  637  PKIGDFGLVRLLPMLDHCVLSSKIQSALGYTAPEFACRTVKITEKCDIYSFGILILEVVT  696

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L+ G V +CVD+ + G +  +E +PV+KL LVC SQ+P
Sbjct  697  GKRPVEYTEDDVVVLCDKVRSALDDGKVEQCVDEKLKGNFAADEAIPVIKLGLVCASQVP  756

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEV+ IL++I+ P
Sbjct  757  SNRPDMAEVINILELIQCP  775



>ref|XP_010427454.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Camelina sativa]
 ref|XP_010427455.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Camelina sativa]
Length=967

 Score =   178 bits (451),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  879  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVP  938

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  939  SSRPHMGEAVNILRMIRCP  957



>ref|XP_011019007.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   178 bits (451),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLA+L+  LDR ++S + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLAKLLPTLDRCILSRKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V EC+D  +GG  P +E +PV+KL L+C S +P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEDGRVEECIDGRLGGKVPADEAIPVIKLGLICASHVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P     E
Sbjct  939  SNRPDMEEVVNILELIQCPAEGHEE  963



>ref|XP_011019006.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Populus euphratica]
Length=965

 Score =   178 bits (451),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLA+L+  LDR ++S + Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDFGLAKLLPTLDRCILSRKIQSALGYMAPEFACRTVKITEKCDVYGFGILVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE G V EC+D  +GG  P +E +PV+KL L+C S +P
Sbjct  879  GKRPVEYMEDDVVVLCDMVRGALEDGRVEECIDGRLGGKVPADEAIPVIKLGLICASHVP  938

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P     E
Sbjct  939  SNRPDMEEVVNILELIQCPAEGHEE  963



>ref|XP_010504542.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=968

 Score =   178 bits (451),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  820  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  879

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  880  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVP  939

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  940  SSRPHMGEAVNILRMIRCP  958



>gb|KHN11868.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=969

 Score =   177 bits (450),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL RL+  LD  V+S++ Q+A+GY+APE AC+++++ EKCD+Y FG+LILE+VT
Sbjct  826  PKIGDFGLVRLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITEKCDIYSFGILILEVVT  885

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+P
Sbjct  886  GKRPVEYMEDDVVVLCDKVRSALDDGKVEQCVDEKLKGNFAAEEAIPVIKLGLVCASQVP  945

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEV+ IL++I+ P
Sbjct  946  SNRPDMAEVINILELIQCP  964



>ref|XP_003516434.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X1 [Glycine max]
 ref|XP_006573410.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like isoform X2 [Glycine max]
Length=969

 Score =   177 bits (450),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL RL+  LD  V+S++ Q+A+GY+APE AC+++++ EKCD+Y FG+LILE+VT
Sbjct  826  PKIGDFGLVRLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITEKCDIYSFGILILEVVT  885

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+P
Sbjct  886  GKRPVEYMEDDVVVLCDKVRSALDDGKVEQCVDEKLKGNFAAEEAIPVIKLGLVCASQVP  945

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEV+ IL++I+ P
Sbjct  946  SNRPDMAEVINILELIQCP  964



>ref|XP_007140080.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
 gb|ESW12074.1| hypothetical protein PHAVU_008G082500g [Phaseolus vulgaris]
Length=968

 Score =   177 bits (450),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGL +L+  LD  V+S++ Q+A+GY+APE AC+++++ EKCD+YGFG+L+LE+VT
Sbjct  822  PKVGDFGLVKLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITEKCDIYGFGILVLEVVT  881

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +CVD + +G +  EE +PV+KL L+C SQ+P
Sbjct  882  GKRPVEYMEDDVVVLCDMVRGALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVP  941

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEVV IL++I+ P
Sbjct  942  SNRPDMAEVVNILELIQCP  960



>ref|XP_006398567.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
 gb|ESQ40020.1| hypothetical protein EUTSA_v10012579mg [Eutrema salsugineum]
Length=972

 Score =   177 bits (450),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 82/139 (59%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAK-LDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            K+SDFGLA L+A  LDR V+S + Q+A+GY APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  829  KVSDFGLAGLLASTLDRCVLSGKVQSALGYTAPEFACRTVKITEKCDVYGFGILVLEVVT  888

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PV+KL LVC SQ+P
Sbjct  889  GKRPVEYAEDDVVVLCETVREGLEEGRVEECVDGRLRGNFPAEEAIPVIKLGLVCGSQVP  948

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV+IL++I+ P
Sbjct  949  SNRPEMEEVVKILELIQCP  967



>ref|XP_002972654.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
 gb|EFJ25875.1| hypothetical protein SELMODRAFT_98598 [Selaginella moellendorffii]
Length=927

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 115/140 (82%), Gaps = 1/140 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P ISD+GLA L+  LDR+ +S++FQ A+GY+APE A QS +V EKCDVYGFG+++LE+VT
Sbjct  775  PLISDYGLANLLPVLDRYAISSKFQGALGYMAPEFASQSSKVTEKCDVYGFGIILLELVT  834

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEY E++V+IL D+VR LL +G  + CV+  +   P++EVLPV+KL L+C+S +PS
Sbjct  835  GRRPVEYMEEDVVILCDYVRALLNEGRGMSCVEPSLEASPEDEVLPVIKLGLICSSPLPS  894

Query  175  SRPSMAEVVQILQVIKTPVP  116
            +RPSMAEVVQIL++++ P+P
Sbjct  895  NRPSMAEVVQILELVR-PLP  913



>ref|NP_191196.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
 emb|CAB88040.1| putative protein [Arabidopsis thaliana]
 dbj|BAB85646.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 dbj|BAB85647.1| inflorescence and root apices receptor-like kinase [Arabidopsis 
thaliana]
 gb|ACN59335.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE79514.1| leucine-rich repeat protein kinase-like protein [Arabidopsis 
thaliana]
Length=964

 Score =   177 bits (449),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  816  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  875

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  876  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVP  935

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  936  SSRPHMGEAVNILRMIRCP  954



>gb|AAL49790.1| unknown protein [Arabidopsis thaliana]
Length=964

 Score =   177 bits (449),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  816  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  875

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  876  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLICTSQVP  935

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  936  SSRPHMGEAVNILRMIRCP  954



>ref|XP_004305081.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
 ref|XP_011466417.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=956

 Score =   177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D GLARL+  +DR ++S++ Q+A+GY+APE ACQ++++ EKCDVYGFG+L+LE+VT
Sbjct  812  PKVGDSGLARLLPMVDRCILSSKIQSALGYMAPEFACQTVKITEKCDVYGFGVLVLEVVT  871

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V+IL D VR  LE+G V EC+D+  +G YP EE +PV+KL L+C SQ+P
Sbjct  872  GKRPVEYMEDDVVILCDMVRGELEEGRVEECLDRKLLGNYPAEEAIPVIKLGLICASQVP  931

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M+EVV IL++I+ P
Sbjct  932  SNRPDMSEVVNILELIQCP  950



>ref|XP_007134721.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
 gb|ESW06715.1| hypothetical protein PHAVU_010G070400g [Phaseolus vulgaris]
Length=982

 Score =   177 bits (450),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 80/145 (55%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL RL+  LD  V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+LILE+VT
Sbjct  836  PKIGDFGLVRLLPMLDPCVLSSKIQSALGYMAPEFACRTVKITEKCDVYSFGILILEVVT  895

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L+ G V +CVD+ + G +  EE +PV+KL LVC SQ+P
Sbjct  896  GKRPVEYMEDDVVVLCDKVRSALDDGKVEQCVDENLKGNFAAEEAVPVIKLGLVCASQVP  955

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S RP MAEV+ IL++I+ P   + E
Sbjct  956  SKRPDMAEVINILELIQCPSEGQEE  980



>ref|XP_003533657.2| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
 gb|KHN29502.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Glycine soja]
Length=967

 Score =   177 bits (449),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGL +L+  LD  V+S++ Q+A+GY+APE AC+++++ +KCDVYGFG+L+LEIVT
Sbjct  821  PKVGDFGLVKLLPMLDHCVLSSKIQSALGYMAPEFACRTVKITKKCDVYGFGILVLEIVT  880

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVD-QGMGGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  LE+G V +CVD + +G +  EE +PV+KL L+C SQ+P
Sbjct  881  GKRPVEYMEDDVVVLCDMVRGALEEGKVEQCVDGRLLGNFAAEEAIPVIKLGLICASQVP  940

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+ P   + E
Sbjct  941  SNRPDMAEVVNILELIQCPSEGQEE  965



>gb|EEE55595.1| hypothetical protein OsJ_03900 [Oryza sativa Japonica Group]
Length=660

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P++ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  513  PRVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  572

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G + +C+D  + G +P EE LP++KL LVCTS++P
Sbjct  573  GRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVP  632

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  633  SNRPDMGEVVNILELVRSP  651



>gb|EAY76307.1| hypothetical protein OsI_04242 [Oryza sativa Indica Group]
Length=947

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P++ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  800  PRVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  859

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G + +C+D  + G +P EE LP++KL LVCTSQ+P
Sbjct  860  GRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSQVP  919

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  920  SNRPDMGEVVNILELVRSP  938



>ref|XP_010412798.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Camelina sativa]
Length=1231

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  1083  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  1142

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
             G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  1143  GKKPVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVP  1202

Query  178   SSRPSMAEVVQILQVIKTP  122
             SSRP M E V IL++++ P
Sbjct  1203  SSRPHMGEAVNILRMVRCP  1221



>ref|NP_001044651.1| Os01g0821900 [Oryza sativa Japonica Group]
 dbj|BAF06565.1| Os01g0821900, partial [Oryza sativa Japonica Group]
Length=775

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P++ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  628  PRVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  687

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G + +C+D  + G +P EE LP++KL LVCTS++P
Sbjct  688  GRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVP  747

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  748  SNRPDMGEVVNILELVRSP  766



>gb|EMT18823.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=973

 Score =   176 bits (447),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 76/138 (55%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LD++V+S++ Q+A+GY+APE  C+++++ EKCDVYGFG+L+LE++TG
Sbjct  827  KVGDYGLAKLLPMLDQYVLSSKVQSALGYMAPEFTCRTVKITEKCDVYGFGVLVLEVMTG  886

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD  + G +P EE +P++KL LVCTSQ+PS
Sbjct  887  RAPVEYMEDDVIVLCDVVRAALDEGKVEECVDGKLCGKFPLEEAVPIMKLGLVCTSQVPS  946

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  947  NRPDMSEVVNILELIRCP  964



>ref|XP_002988156.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
 gb|EFJ10948.1| hypothetical protein SELMODRAFT_40688, partial [Selaginella moellendorffii]
Length=864

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P ISD+GLA L+  LDR+ +S++FQ A+GY+APE A QS +V EKCDVYGFG+++LE+VT
Sbjct  729  PLISDYGLANLLPVLDRYAISSKFQGALGYMAPEFASQSSKVTEKCDVYGFGIILLELVT  788

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPS  176
            GRRPVEY E++V+IL D+VR LL +G  + CV+  +   P++EVLPV+KL L+C+S +PS
Sbjct  789  GRRPVEYMEEDVVILCDYVRALLNEGRGMSCVEPSLEACPEDEVLPVIKLGLICSSPLPS  848

Query  175  SRPSMAEVVQILQVIK  128
            +RPSMAEVVQIL++++
Sbjct  849  NRPSMAEVVQILELVR  864



>ref|XP_003521989.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Glycine max]
Length=970

 Score =   176 bits (447),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL RL+  LD  V+S++ Q+A+GY APE AC+++++ EKCD+Y FG+LILE+VT
Sbjct  827  PKIGDFGLVRLLPMLDHCVLSSKIQSALGYTAPEFACRTVKITEKCDIYSFGILILEVVT  886

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L+ G V +CVD+ + G +  +E +PV+KL LVC SQ+P
Sbjct  887  GKRPVEYTEDDVVVLCDKVRSALDDGKVEQCVDEKLKGNFAADEAIPVIKLGLVCASQVP  946

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP MAEV+ IL++I+ P
Sbjct  947  SNRPDMAEVINILELIQCP  965



>ref|XP_002458686.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
 gb|EES03806.1| hypothetical protein SORBIDRAFT_03g038240 [Sorghum bicolor]
Length=948

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  801  PKVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  860

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G   +C+D  + G +P +E LP++KL LVCTSQ+P
Sbjct  861  GRRPVEYLEDDVVVLCDLVRSALEEGRPEDCIDPRLCGEFPMDEALPIIKLGLVCTSQVP  920

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  921  SNRPDMGEVVSILELVRSP  939



>gb|EMT15869.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=866

 Score =   175 bits (444),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 76/139 (55%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P++ D+GLA L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L LEI+T
Sbjct  719  PRVGDYGLASLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLALEILT  778

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G + +C+D  + G +  EE +P++KL LVCTSQ+P
Sbjct  779  GRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFAMEEAIPIIKLGLVCTSQVP  838

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EV+ IL+V+++P
Sbjct  839  SNRPDMGEVLSILEVVRSP  857



>ref|XP_003557968.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=970

 Score =   176 bits (446),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/138 (54%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE  C+++++ +KCDVYGFG+L+LE++TG
Sbjct  824  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFTCRTVKITDKCDVYGFGVLVLEVMTG  883

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            + PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  884  KTPVEYMEDDVIVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  943

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  944  NRPDMSEVVNILELIRCP  961



>ref|NP_001142419.1| uncharacterized protein LOC100274594 [Zea mays]
 gb|ACF88448.1| unknown [Zea mays]
Length=511

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE +T
Sbjct  364  PKVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACKTVKITEKCDVYGFGVLLLEALT  423

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G   +CVD  + G +P +E LPV+KL LVCTSQ+P
Sbjct  424  GRRPVEYLEDDVVVLCDLVRGALEEGRPEDCVDPRLRGEFPMDEALPVIKLGLVCTSQVP  483

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV +L++++ P
Sbjct  484  SNRPGMGEVVSMLELVRNP  502



>ref|XP_006402993.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
 gb|ESQ44446.1| hypothetical protein EUTSA_v10005773mg [Eutrema salsugineum]
Length=967

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  819  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  878

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +  EE + V+KL L+CTSQ+P
Sbjct  879  GKKPVEYMEDDVVVLCDMVREALEDGRAEECIDPRLQGKFSAEEAVAVIKLGLICTSQVP  938

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  939  SSRPHMGEAVNILRMIRCP  957



>gb|KJB71525.1| hypothetical protein B456_011G127000 [Gossypium raimondii]
Length=967

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 78/145 (54%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ DFGLARL+  LDR V+S++ Q+A+GY+APE AC+++++ EK DVYGFG+L+LE++T
Sbjct  821  PKVGDFGLARLLPTLDRCVLSSKIQSALGYMAPEFACKTVKITEKSDVYGFGVLVLEVIT  880

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L + VR  LE G V ECVD+ +   +P EE +PV+KL L+C SQ+P
Sbjct  881  GKKPVEYMEDDVVVLCEMVRGALEDGKVEECVDRRLRSNFPTEEAIPVIKLGLICASQVP  940

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P   + E
Sbjct  941  SNRPDMEEVVNILELIQCPSEGQEE  965



>gb|KFK34877.1| Leucine-rich repeat protein kinase family protein [Arabis alpina]
Length=964

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 77/138 (56%), Positives = 110/138 (80%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VTG
Sbjct  817  KVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTG  876

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            ++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+PS
Sbjct  877  KKPVEYMEDDVVVLCDMVREALEDGRAEECIDPRLQGKFPVEEAVAVIKLGLICTSQVPS  936

Query  175  SRPSMAEVVQILQVIKTP  122
            SRP M E V IL++I+ P
Sbjct  937  SRPHMGEAVNILRMIRCP  954



>dbj|BAB85306.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB86487.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=947

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P++ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  800  PRVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  859

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G + +C+D  + G +P EE LP++KL LVCTS++P
Sbjct  860  GRRPVEYLEDDVVVLCDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLVCTSRVP  919

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  920  SNRPDMGEVVNILELVRSP  938



>ref|XP_010931370.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   175 bits (444),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 83/138 (60%), Positives = 117/138 (85%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG
Sbjct  822  KVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIMTG  881

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D V+  LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS
Sbjct  882  RRPVEYMEDDVVVLCDVVKGALEEGRVEECVDGKLGGKFPVEEAVPVMKLGLICTSQVPS  941

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP MAEVV+ILQ+I+ P
Sbjct  942  NRPDMAEVVKILQLIRCP  959



>ref|XP_004970391.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Setaria italica]
Length=946

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLA+L+  LDR+V+S++ Q+++GY+APE AC+++++ EKCDVYGFG+L+LE++T
Sbjct  799  PKVGDYGLAKLLPMLDRYVLSSKIQSSLGYMAPEFACKTVKITEKCDVYGFGVLVLEVLT  858

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G   +C+D  + G +P +E LP++KL LVCTSQ+P
Sbjct  859  GRRPVEYLEDDVVVLCDLVRSTLEEGRPEDCIDPRLCGEFPMDEALPIIKLGLVCTSQVP  918

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL+++++P
Sbjct  919  SNRPDMGEVVSILELVRSP  937



>ref|XP_003567498.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Brachypodium distachyon]
Length=1056

 Score =   175 bits (444),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 91/152 (60%), Positives = 113/152 (74%), Gaps = 10/152 (7%)
 Frame = -3

Query  535   PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
             P ISDFGLARL  +   +    +   A+GY APE+AC SLRVNEKCDVYGFG+++LE VT
Sbjct  906   PLISDFGLARLQPETSPN---EKRGGAMGYAAPEVACGSLRVNEKCDVYGFGVVVLETVT  962

Query  355   GRRPVEYGEDNVLILNDHVRVLLEQ-----GNVLECVDQGMGG-YPDEEVLPVLKLALVC  194
             GRR VEYG+D+V +L D VR  LE      G VL+ VD  MGG +P+EE +PVLKL +VC
Sbjct  963   GRRAVEYGDDDVAVLVDQVRSALETTTTRGGGVLDWVDPAMGGEFPEEEAVPVLKLGIVC  1022

Query  193   TSQIPSSRPSMAEVVQILQVIKTPVPNRMEPY  98
             TSQ+PS+RPSMAEVVQ+L VI+ P+P  MEP+
Sbjct  1023  TSQVPSNRPSMAEVVQVLHVIRAPLPG-MEPF  1053



>ref|XP_008792235.1| PREDICTED: LOW QUALITY PROTEIN: probably inactive leucine-rich 
repeat receptor-like protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   175 bits (443),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 83/138 (60%), Positives = 116/138 (84%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++NEKCDVYGFG+L+LEI+TG
Sbjct  822  KVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACRTVKINEKCDVYGFGVLVLEIMTG  881

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D V+  LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS
Sbjct  882  RRPVEYMEDDVVVLCDVVKGALEEGRVEECVDGKLGGKFPVEEAVPVVKLGLICTSQVPS  941

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EVV ILQ+I+ P
Sbjct  942  NRPDMVEVVNILQLIRCP  959



>emb|CDY27220.1| BnaA09g35820D [Brassica napus]
Length=936

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  788  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  847

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   ECVD  + G +P EE + V+KL L+CTSQ+P
Sbjct  848  GKKPVEYMEDDVVVLCDMVREALEDGRAEECVDMRLQGKFPVEEAVAVIKLGLICTSQVP  907

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  908  SSRPHMGEAVNILRMIRCP  926



>ref|XP_008442319.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Cucumis melo]
Length=958

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/139 (55%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLA L+  LDR ++S++ Q+A+GY+APE AC+++ + EKCDVYGFG+L+LE+VT
Sbjct  812  PKVGDYGLAMLLPMLDRCILSSKIQSALGYMAPEFACKTVTITEKCDVYGFGILVLEVVT  871

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VRV L++G V  CVD+ +   +  EE +PV+KL L+C SQ+P
Sbjct  872  GKRPVEYMEDDVIVLCDMVRVALDEGTVERCVDERLQLNFRVEEAIPVMKLGLICASQVP  931

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I++P
Sbjct  932  SNRPDMNEVVNILELIQSP  950



>ref|XP_010921154.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X1 [Elaeis guineensis]
Length=969

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/145 (53%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK  D+GLA+L+  LD +V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+L+LEI+ 
Sbjct  822  PKTGDYGLAKLLPMLDHYVLSSKIQSALGYMAPEFACRTVKITEKCDVYAFGVLVLEIMA  881

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RP+EY ED+V++L D VR  LE+G V ECVD  + G +P EE + V+KL L+CTSQ+P
Sbjct  882  GKRPLEYMEDDVVVLCDMVRGALEEGKVAECVDGRLCGKFPIEEAIAVMKLGLICTSQVP  941

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P  ++ E
Sbjct  942  SNRPDMGEVVNILELIRCPQDSQEE  966



>ref|XP_010922754.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Elaeis guineensis]
Length=968

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 84/139 (60%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG
Sbjct  822  KVGDAGLAKLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEIITG  881

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D VR  LE+G V ECVD  +GG +P EE +PV+KL L+CTSQ+PS
Sbjct  882  RRPVEYMEDDVVVLCDVVRGALEEGRVEECVDGRLGGKFPVEEAVPVVKLGLICTSQVPS  941

Query  175  SRPSMAEVVQILQVIKTPV  119
            +RP MAEVV ILQ+I+ P+
Sbjct  942  NRPDMAEVVNILQLIRCPL  960



>ref|XP_010921155.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 isoform X2 [Elaeis guineensis]
Length=945

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/145 (53%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK  D+GLA+L+  LD +V+S++ Q+A+GY+APE AC+++++ EKCDVY FG+L+LEI+ 
Sbjct  798  PKTGDYGLAKLLPMLDHYVLSSKIQSALGYMAPEFACRTVKITEKCDVYAFGVLVLEIMA  857

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RP+EY ED+V++L D VR  LE+G V ECVD  + G +P EE + V+KL L+CTSQ+P
Sbjct  858  GKRPLEYMEDDVVVLCDMVRGALEEGKVAECVDGRLCGKFPIEEAIAVMKLGLICTSQVP  917

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP M EVV IL++I+ P  ++ E
Sbjct  918  SNRPDMGEVVNILELIRCPQDSQEE  942



>ref|XP_004137674.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 ref|XP_004160330.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cucumis sativus]
 gb|KGN58686.1| hypothetical protein Csa_3G728030 [Cucumis sativus]
Length=959

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/139 (55%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLA L+  LDR ++S++ Q+A+GY+APE AC+++ + EKCDVYGFG+L+LE+VT
Sbjct  813  PKVGDYGLAMLLPMLDRCILSSKIQSALGYMAPEFACKTVTITEKCDVYGFGILVLEVVT  872

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMG-GYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VRV L++G V  CVD+ +   +  EE +PV+KL L+C SQ+P
Sbjct  873  GKRPVEYMEDDVIVLCDMVRVALDEGTVERCVDERLQLNFRVEEAIPVMKLGLICASQVP  932

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV IL++I++P
Sbjct  933  SNRPDMNEVVNILELIQSP  951



>emb|CDX72142.1| BnaC08g27320D [Brassica napus]
Length=936

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLARL+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE+VT
Sbjct  788  PKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVT  847

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G   EC+D  + G +P EE + V+KL L+CTSQ+P
Sbjct  848  GKKPVEYMEDDVVVLCDMVREALEDGRAEECIDLRLQGKFPVEEAVAVIKLGLICTSQVP  907

Query  178  SSRPSMAEVVQILQVIKTP  122
            SSRP M E V IL++I+ P
Sbjct  908  SSRPHMGEAVNILRMIRCP  926



>tpg|DAA57062.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=949

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PK+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LE +T
Sbjct  802  PKVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACKTVKITEKCDVYGFGVLLLEALT  861

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L D VR  LE+G   +CVD  + G +P +E LPV+KL LVCTSQ+P
Sbjct  862  GRRPVEYLEDDVVVLCDLVRGALEEGRPEDCVDPRLRGEFPMDEALPVIKLGLVCTSQVP  921

Query  178  SSRPSMAEVVQILQVIKTP  122
            S+RP M EVV +L++++ P
Sbjct  922  SNRPGMGEVVSMLELVRNP  940



>ref|NP_001159235.1| uncharacterized protein LOC100304322 [Zea mays]
 gb|ACN25536.1| unknown [Zea mays]
Length=308

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TG
Sbjct  162  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTG  221

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  222  RTPVEYMEDDVVVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  281

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EVV IL++I+ P
Sbjct  282  NRPDMGEVVNILELIRCP  299



>ref|XP_004514781.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like [Cicer arietinum]
Length=946

 Score =   171 bits (432),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 76/145 (52%), Positives = 109/145 (75%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL  L   LD  V+S++ Q+A+GY+APE AC+++ + EKCD+YGFG+L+LE+VT
Sbjct  799  PKIGDFGLLNLFPMLDHCVLSSKVQSALGYMAPEFACRTVNITEKCDIYGFGVLVLEVVT  858

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG-MGGYPDEEVLPVLKLALVCTSQIP  179
            G++PVEY ED+V++L D VR  LE G + +C+D+  +G +  EE +PV+KL LVC S++P
Sbjct  859  GKKPVEYMEDDVVVLCDMVRSSLEDGKIEQCIDEKLLGDFSVEEAMPVIKLGLVCASKVP  918

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            SSRP MAEVV IL++I+     + E
Sbjct  919  SSRPDMAEVVNILELIQCSSEGQQE  943



>ref|XP_003605286.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES87483.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=866

 Score =   169 bits (429),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 1/145 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            PKI DFGL  L+  LD  V+S++ Q+A+GY APE AC+++ + EKCD+YGFG+L+LEIV+
Sbjct  719  PKIGDFGLVNLLPMLDHCVLSSKIQSALGYTAPEFACRTVNITEKCDIYGFGILVLEIVS  778

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIP  179
            G+RPVEY ED+V++L D VR  L  G V +C+D+ + G +  EEV PV+KL LVC SQ+P
Sbjct  779  GKRPVEYMEDDVIVLCDMVRSELGDGKVEQCIDEKLIGKFSLEEVTPVIKLGLVCASQVP  838

Query  178  SSRPSMAEVVQILQVIKTPVPNRME  104
            S+RP MAEVV IL++I+     + E
Sbjct  839  SNRPDMAEVVNILEMIQCSSEGQQE  863



>ref|XP_008788529.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Phoenix dactylifera]
Length=968

 Score =   170 bits (431),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 83/138 (60%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA L+ KLDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+L+LEI+TG
Sbjct  822  KVGDYGLANLLPKLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEILTG  881

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D VR  LE+G V E VD  +GG +P EE +PVLKL L+CTSQ+PS
Sbjct  882  RRPVEYMEDDVVVLCDVVRGALEEGRVEESVDGRLGGKFPVEEAVPVLKLGLICTSQVPS  941

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP MAE V IL++I+ P
Sbjct  942  NRPDMAEAVNILRLIRCP  959



>dbj|BAJ85468.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1052

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 111/161 (69%), Gaps = 22/161 (14%)
 Frame = -3

Query  538   TPKISDFGLARLVAKLDRHVM-----------SNRF--QAAIGYVAPELACQSLRVNEKC  398
              P I+DFGLARL+ K  +              S RF   AA+GY APELAC SLRVNEKC
Sbjct  882   NPLIADFGLARLLRKPKQQQQQPEGNGVGAMGSCRFMQSAAMGYAAPELACSSLRVNEKC  941

Query  397   DVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVL--------ECVDQGM-G  245
             DVYGFG+L+LE+VTGRR VEYGED+V +L D VRV LEQG             VD  + G
Sbjct  942   DVYGFGVLVLELVTGRRAVEYGEDDVAVLTDQVRVALEQGAGGDDDDAAAERVVDPALRG  1001

Query  244   GYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTP  122
              +P+EE LPVLKL +VCTSQIPS+RPSMAEVVQILQVI+ P
Sbjct  1002  EFPEEEALPVLKLGVVCTSQIPSNRPSMAEVVQILQVIRAP  1042



>ref|XP_008681357.1| PREDICTED: uncharacterized protein LOC100304322 isoform X1 [Zea 
mays]
 tpg|DAA45233.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=972

 Score =   167 bits (423),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 80/138 (58%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+++++ EKCDVYGFG+LILEI+TG
Sbjct  826  KVGDYGLAKLLPMLDRYVLSSKVQSALGYMAPEFACRTVKITEKCDVYGFGVLILEILTG  885

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            R PVEY ED+V++L D VR  L++G V ECVD+ + G +P EE +P++KL LVCTSQ+PS
Sbjct  886  RTPVEYMEDDVVVLCDVVRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPS  945

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EVV IL++I+ P
Sbjct  946  NRPDMGEVVNILELIRCP  963



>ref|XP_006655414.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040-like, partial [Oryza brachyantha]
Length=788

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -3

Query  535  PKISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVT  356
            P++ D+GL +L+  LDR+V+S++ Q+A+GY+APE  C+++ V EKCDVYGFG+LILEI+T
Sbjct  641  PRVGDYGLVKLLPMLDRYVLSSKIQSALGYMAPEFTCRTVNVTEKCDVYGFGVLILEILT  700

Query  355  GRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIP  179
            GRRPVEY ED+V++L+D VR  L++G V +C+D+ + G +  EE + ++KL LVCTSQ+P
Sbjct  701  GRRPVEYLEDDVIVLSDVVRAALDEGRVEDCLDRRLSGEFSMEEAMLIIKLGLVCTSQVP  760

Query  178  SSRPSMAEVVQILQVIKT  125
            S RP M EVV +L+++++
Sbjct  761  SHRPDMGEVVSMLEMVRS  778



>emb|CDY70210.1| BnaAnng32980D [Brassica napus]
Length=210

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = -3

Query  430  ACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG  251
            A ++L VNEKCDVYGFG+LILE++TGRR +EYGED+ +IL+DHVRVLLEQGNVLEC+D  
Sbjct  89   AHKNLVVNEKCDVYGFGVLILELLTGRRLMEYGEDSFVILSDHVRVLLEQGNVLECIDPI  148

Query  250  M-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  110
            M   Y ++EVLP LKL+LVCTSQIPS+ P+MAE+VQILQ I +PVP+R
Sbjct  149  MEEEYSEDEVLPFLKLSLVCTSQIPSNLPTMAEIVQILQAISSPVPHR  196



>gb|EMT15187.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=319

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 8/122 (7%)
 Frame = -3

Query  463  QAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLE  284
             AA+GY APELAC SLRVNEKCDVYGFG+L+LE+VTGRR VEYGED+V +L D VRV LE
Sbjct  188  SAAMGYAAPELACSSLRVNEKCDVYGFGVLVLELVTGRRAVEYGEDDVAVLTDQVRVALE  247

Query  283  QGNVL-------ECVDQGMGG-YPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIK  128
            QG            VD  + G +P+EE LPVLKL +VCTSQIPS+RPSMAEVVQILQVI+
Sbjct  248  QGGGGDDDAAAERLVDPALRGEFPEEEALPVLKLGVVCTSQIPSNRPSMAEVVQILQVIR  307

Query  127  TP  122
             P
Sbjct  308  AP  309



>ref|XP_002990711.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
 gb|EFJ08160.1| hypothetical protein SELMODRAFT_132189, partial [Selaginella 
moellendorffii]
Length=908

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            ++SD+GLA+L+   DR V+ N+ Q+++GY+APE  C+S +V EKCDVYGFG+++LE++TG
Sbjct  767  RVSDYGLAKLLHSRDRFVVMNKLQSSLGYLAPECGCESFKVTEKCDVYGFGVVLLELITG  826

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGGYPDEEVLPVLKLALVCTSQIPSS  173
            + PVEY E++V+IL D VR L + G  L CVD  M  YP+EEV+ ++KL LVCTS +P++
Sbjct  827  KPPVEYLENDVVILCDFVRSLADDGKPLLCVDPKMVVYPEEEVMTLIKLGLVCTSPVPAN  886

Query  172  RPSMAEVVQILQVIKTPVPNR  110
            RPSM EVVQIL++IK    NR
Sbjct  887  RPSMTEVVQILELIKPLADNR  907



>ref|XP_009402208.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Musa acuminata subsp. malaccensis]
Length=974

 Score =   164 bits (416),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+ D+GLA+L+  LDR+V+S++ Q+A+GY+APE AC+ +++ EKCDVYGFG+L+LEI+TG
Sbjct  828  KVGDYGLAKLLPMLDRYVLSSKIQSALGYMAPEFACRMVKITEKCDVYGFGVLLLEIITG  887

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGMGG-YPDEEVLPVLKLALVCTSQIPS  176
            RRPVEY ED+V++L D VRV LE+G V E VD  +GG +P EE +PV+KL L+CTSQ+PS
Sbjct  888  RRPVEYMEDDVVVLCDVVRVALEEGRVDELVDGRLGGKFPAEEGVPVVKLGLICTSQVPS  947

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M+EVV IL++I+ P
Sbjct  948  NRPGMSEVVSILEMIRCP  965



>ref|XP_003621709.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Medicago truncatula]
 gb|AES77927.1| leucine-rich receptor-like kinase family protein [Medicago truncatula]
Length=111

 Score =   150 bits (379),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 90/117 (77%), Gaps = 15/117 (13%)
 Frame = -3

Query  457  AIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQG  278
            A+ YVA EL+CQSLRVN+K + YGFG++ILEI TGRRPV+YGEDNVL LNDHVRVLLE G
Sbjct  9    ALDYVATELSCQSLRVNQKVNAYGFGVMILEIGTGRRPVKYGEDNVLTLNDHVRVLLEHG  68

Query  277  NVLECVDQGMGGYPDEEVLPVLKLA-LVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  110
            N              +EVLPVLKLA +VCTSQIPSS P+MAEVVQILQV K  VP R
Sbjct  69   N--------------DEVLPVLKLAIMVCTSQIPSSGPTMAEVVQILQVAKIHVPQR  111



>emb|CDY42780.1| BnaC01g22860D [Brassica napus]
Length=208

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = -3

Query  430  ACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG  251
            A ++L VNEKCDVYGFG+LILE++ GRR VEY ED  +IL DHVRVLLEQGNVLEC+D  
Sbjct  89   AHKNLVVNEKCDVYGFGVLILELLIGRRLVEYSEDIFVILRDHVRVLLEQGNVLECIDPT  148

Query  250  M-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNRM  107
            +   Y ++EVLP LKLALVCTSQIPS+ P+MAE+VQILQ I +PVP+RM
Sbjct  149  IEEEYSEDEVLPFLKLALVCTSQIPSNLPTMAEIVQILQAISSPVPHRM  197



>emb|CDX96323.1| BnaA07g29340D [Brassica napus]
Length=210

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = -3

Query  430  ACQSLRVNEKCDVYGFGMLILEIVTGRRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQG  251
            A ++L VNEK DVYGFG+LILE++TGRR +EYGED+ +IL+DHVRVLLEQGNVLEC+D  
Sbjct  89   AHKNLVVNEKYDVYGFGVLILELLTGRRLMEYGEDSFVILSDHVRVLLEQGNVLECIDPI  148

Query  250  M-GGYPDEEVLPVLKLALVCTSQIPSSRPSMAEVVQILQVIKTPVPNR  110
            M   Y ++EVLP LKL+LVCTSQIPS+ P+MAE+VQILQ I +PVP+R
Sbjct  149  MEEEYSEDEVLPFLKLSLVCTSQIPSNLPTMAEIVQILQAISSPVPHR  196



>ref|XP_010553156.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Tarenaya hassleriana]
Length=969

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 107/138 (78%), Gaps = 4/138 (3%)
 Frame = -3

Query  532  KISDFGLARLVAKLDRHVMSNRFQAAIGYVAPELACQSLRVNEKCDVYGFGMLILEIVTG  353
            K+SD+G+ RL   L+R V+S + Q+++GY APE AC+++++ EK DVYGFG+L++E+VTG
Sbjct  829  KVSDYGIGRL---LERCVLSGKVQSSLGYTAPEFACRTVKITEKSDVYGFGILVMEVVTG  885

Query  352  RRPVEYGEDNVLILNDHVRVLLEQGNVLECVDQGM-GGYPDEEVLPVLKLALVCTSQIPS  176
            +RPVEY ED+V++L + VR  LE+G V ECVD  + G +P EE +PVLKL L+C SQ+PS
Sbjct  886  KRPVEYEEDDVVVLCETVRGALEEGRVEECVDGRLRGSFPGEEAVPVLKLGLICASQVPS  945

Query  175  SRPSMAEVVQILQVIKTP  122
            +RP M EVV IL +I+ P
Sbjct  946  NRPEMEEVVNILDLIQCP  963



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335