BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043L18

Length=746
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAB51610.1|  ADP-glucose pyrophosphorylase large subunit            293   3e-95   Ipomoea batatas [batate]
emb|CAB52196.1|  ADP-glucose pyrophosphorylase                          296   2e-94   Ipomoea batatas [batate]
dbj|BAF47746.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1A    295   3e-93   Ipomoea batatas [batate]
gb|AFL55396.1|  ADP-glucose pyrophosphorylase large subunit 1           295   3e-93   Ipomoea batatas [batate]
gb|AGB85109.1|  ADP-glucose pyrophosphorylase large subunit 1           294   1e-92   Ipomoea batatas [batate]
emb|CAB55496.1|  ADP-glucose pyrophosphorylase                          288   4e-92   Ipomoea batatas [batate]
emb|CAB55495.1|  ADP-glucose pyrophosphorylase                          290   2e-91   Ipomoea batatas [batate]
gb|AAC21562.1|  ADP-glucose pyrophosphorylase large subunit             290   3e-91   Ipomoea batatas [batate]
ref|XP_009763056.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    278   3e-86   Nicotiana sylvestris
ref|XP_009621409.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    276   7e-86   Nicotiana tomentosiformis
gb|AFO84074.1|  ADP glucose pyrophosphorylase                           269   3e-85   Actinidia chinensis
gb|KDO42003.1|  hypothetical protein CISIN_1g0097201mg                  267   2e-84   Citrus sinensis [apfelsine]
ref|XP_011088418.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    271   1e-83   
sp|Q00081.1|GLGL1_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    268   2e-83   Solanum tuberosum [potatoes]
gb|AFL55397.1|  ADP-glucose pyrophosphorylase large subunit 2           270   2e-83   Ipomoea batatas [batate]
dbj|BAF47747.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb1B    270   3e-83   Ipomoea batatas [batate]
gb|KDO42001.1|  hypothetical protein CISIN_1g0097201mg                  266   3e-83   Citrus sinensis [apfelsine]
gb|AAD56405.1|AF184345_1  ADP-glucose pyrophosphorylase large sub...    270   3e-83   Solanum habrochaites
gb|ABC26923.1|  ADPglucose pyrophosphorylase large subunit              269   4e-83   Solanum habrochaites
ref|NP_001233918.1|  ADP-glucose pyrophosphorylase large subunit        269   4e-83   
gb|AAC49941.1|  ADP-glucose pyrophosphorylase large subunit 1           269   6e-83   Solanum lycopersicum
gb|ABC26921.1|  ADPglucose pyrophosphorylase large subunit              268   8e-83   Solanum lycopersicum
gb|KDO41998.1|  hypothetical protein CISIN_1g0097201mg                  266   9e-83   Citrus sinensis [apfelsine]
ref|XP_006365120.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    268   9e-83   Solanum tuberosum [potatoes]
ref|NP_001275823.1|  glucose-1-phosphate adenylyltransferase larg...    268   2e-82   Citrus sinensis [apfelsine]
gb|AAD56042.1|AF184598_1  ADP-glucose pyrophosphorylase large sub...    267   3e-82   Citrus unshiu [satsuma mandarin]
ref|XP_006423322.1|  hypothetical protein CICLE_v10028195mg             266   6e-82   Citrus clementina [clementine]
gb|AGB85110.1|  ADP-glucose pyrophosphorylase large subunit 2           265   1e-81   Ipomoea batatas [batate]
gb|AGS94412.1|  ADP-glucose pyrophosphorylase large subunit 4           265   1e-81   Actinidia deliciosa [Chinese gooseberry]
gb|KJB32481.1|  hypothetical protein B456_005G244900                    261   3e-81   Gossypium raimondii
ref|XP_002512925.1|  glucose-1-phosphate adenylyltransferase, put...    264   6e-81   Ricinus communis
ref|XP_003537869.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    263   1e-80   Glycine max [soybeans]
ref|XP_003541029.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    263   1e-80   Glycine max [soybeans]
gb|KDP41770.1|  hypothetical protein JCGZ_26788                         262   2e-80   Jatropha curcas
emb|CDO97030.1|  unnamed protein product                                262   2e-80   Coffea canephora [robusta coffee]
ref|NP_001284451.1|  myeloid leukemia factor 1                          262   2e-80   Cucumis melo [Oriental melon]
ref|XP_010088945.1|  Glucose-1-phosphate adenylyltransferase larg...    261   1e-79   Morus notabilis
gb|KDO41999.1|  hypothetical protein CISIN_1g0097201mg                  258   2e-79   Citrus sinensis [apfelsine]
ref|XP_008460955.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    260   2e-79   
gb|KJB32479.1|  hypothetical protein B456_005G244900                    259   3e-79   Gossypium raimondii
gb|KJB32482.1|  hypothetical protein B456_005G244900                    259   3e-79   Gossypium raimondii
gb|KHG23571.1|  Glucose-1-phosphate adenylyltransferase large sub...    259   3e-79   Gossypium arboreum [tree cotton]
gb|KCW55368.1|  hypothetical protein EUGRSUZ_I01281                     255   3e-79   Eucalyptus grandis [rose gum]
gb|AAB91467.1|  ADP-glucose pyrophosphorylase large subunit 1           259   3e-79   Citrullus lanatus subsp. vulgaris
emb|CBI37674.3|  unnamed protein product                                258   6e-79   Vitis vinifera
ref|XP_002283855.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    258   6e-79   Vitis vinifera
ref|XP_007042146.1|  Glucose-1-phosphate adenylyltransferase fami...    258   1e-78   
ref|XP_007131817.1|  hypothetical protein PHAVU_011G044000g             257   2e-78   Phaseolus vulgaris [French bean]
ref|XP_011037496.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    257   2e-78   Populus euphratica
ref|XP_002306116.2|  ADP-glucose pyrophosphorylase large subunit ...    257   2e-78   
ref|XP_006581117.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    253   3e-78   Glycine max [soybeans]
ref|XP_004500804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    256   4e-78   Cicer arietinum [garbanzo]
gb|AES74194.2|  glucose-1-phosphate adenylyltransferase family pr...    256   5e-78   Medicago truncatula
ref|XP_010028607.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    256   6e-78   Eucalyptus grandis [rose gum]
ref|XP_007199332.1|  hypothetical protein PRUPE_ppa023764mg             251   6e-78   
ref|XP_009345668.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   8e-78   Pyrus x bretschneideri [bai li]
ref|XP_009345666.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    255   8e-78   
ref|XP_003522921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   2e-77   Glycine max [soybeans]
ref|XP_003527197.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   3e-77   Glycine max [soybeans]
gb|EYU37810.1|  hypothetical protein MIMGU_mgv1a004455mg                254   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_010690849.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   3e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004148834.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    254   3e-77   
ref|XP_002313036.1|  ADP-glucose pyrophosphorylase large subunit ...    254   4e-77   Populus trichocarpa [western balsam poplar]
gb|KJB79161.1|  hypothetical protein B456_013G035800                    254   5e-77   Gossypium raimondii
gb|AHM92232.1|  AGPase large subunit protein                            253   7e-77   Hevea brasiliensis [jebe]
gb|KHF99865.1|  Glucose-1-phosphate adenylyltransferase large sub...    253   7e-77   Gossypium arboreum [tree cotton]
ref|XP_011048155.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    253   8e-77   Populus euphratica
ref|XP_003606943.1|  Glucose-1-phosphate adenylyltransferase            253   1e-76   Medicago truncatula
ref|XP_008385901.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    252   2e-76   
ref|XP_011015433.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    252   2e-76   Populus euphratica
gb|AAF66436.1|AF249917_1  ADP-glucose pyrophosphorylase large sub...    252   2e-76   Perilla frutescens [beefsteak-mint]
ref|XP_008385898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    252   2e-76   
ref|XP_008800701.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    252   2e-76   Phoenix dactylifera
gb|AGV54292.1|  ADP-glucose pyrophosphorylase large subunit             251   3e-76   Phaseolus vulgaris [French bean]
ref|XP_007201161.1|  hypothetical protein PRUPE_ppa004192mg             251   4e-76   Prunus persica
ref|XP_008236919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    251   4e-76   Prunus mume [ume]
ref|XP_010060971.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    250   1e-75   Eucalyptus grandis [rose gum]
ref|XP_003603943.1|  Glucose-1-phosphate adenylyltransferase larg...    250   1e-75   
ref|XP_004507462.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Cicer arietinum [garbanzo]
ref|XP_007136621.1|  hypothetical protein PHAVU_009G059800g             243   2e-75   Phaseolus vulgaris [French bean]
ref|XP_011007450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Populus euphratica
ref|XP_007136623.1|  hypothetical protein PHAVU_009G059800g             244   2e-75   Phaseolus vulgaris [French bean]
ref|XP_011028874.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   2e-75   Populus euphratica
ref|XP_010254773.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    249   4e-75   Nelumbo nucifera [Indian lotus]
ref|NP_001289786.1|  glucose-1-phosphate adenylyltransferase larg...    249   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_007136619.1|  hypothetical protein PHAVU_009G059800g             243   4e-75   Phaseolus vulgaris [French bean]
ref|XP_007136159.1|  hypothetical protein PHAVU_009G023100g             248   4e-75   Phaseolus vulgaris [French bean]
dbj|BAC66692.1|  ADP-glucose pyrophosphorylase large subunit PvAGPL1    248   4e-75   Phaseolus vulgaris [French bean]
ref|XP_007136620.1|  hypothetical protein PHAVU_009G059800g             244   5e-75   Phaseolus vulgaris [French bean]
ref|XP_002300758.1|  ADP-glucose pyrophosphorylase large subunit ...    248   5e-75   Populus trichocarpa [western balsam poplar]
ref|XP_007136618.1|  hypothetical protein PHAVU_009G059800g             243   6e-75   Phaseolus vulgaris [French bean]
ref|XP_007136622.1|  hypothetical protein PHAVU_009G059800g             244   7e-75   Phaseolus vulgaris [French bean]
gb|AAB91468.1|  ADP-glucose pyrophosphorylase large subunit 2           246   1e-74   Citrullus lanatus subsp. vulgaris
ref|XP_010531437.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    247   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_002281223.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    247   1e-74   Vitis vinifera
emb|CDP07489.1|  unnamed protein product                                247   2e-74   Coffea canephora [robusta coffee]
ref|XP_006435035.1|  hypothetical protein CICLE_v10000842mg             247   2e-74   Citrus clementina [clementine]
ref|XP_006473534.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    247   2e-74   Citrus sinensis [apfelsine]
emb|CAA65541.1|  ADP-glucose pyrophosphorylase                          246   2e-74   Pisum sativum [garden pea]
ref|XP_008466540.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    247   2e-74   
gb|EPS74142.1|  glucose-1-phosphate adenylyltransferase                 247   2e-74   Genlisea aurea
ref|XP_002307668.2|  hypothetical protein POPTR_0005s25130g             246   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_004147856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    246   3e-74   Cucumis sativus [cucumbers]
ref|XP_004154849.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    246   3e-74   
dbj|BAF47748.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb2     246   3e-74   Ipomoea batatas [batate]
gb|AFL55398.1|  ADP-glucose pyrophosphorylase large subunit 3           246   3e-74   Ipomoea batatas [batate]
ref|XP_007017590.1|  ADPGLC-PPase large subunit isoform 1               246   4e-74   
ref|XP_009378639.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    245   5e-74   
ref|XP_009378637.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    245   6e-74   Pyrus x bretschneideri [bai li]
emb|CDY41275.1|  BnaA01g12640D                                          239   7e-74   Brassica napus [oilseed rape]
ref|XP_009378638.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    245   7e-74   Pyrus x bretschneideri [bai li]
gb|KEH36175.1|  glucose-1-phosphate adenylyltransferase family pr...    244   2e-73   Medicago truncatula
ref|XP_009617843.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   2e-73   Nicotiana tomentosiformis
ref|XP_007136616.1|  hypothetical protein PHAVU_009G059800g             244   2e-73   Phaseolus vulgaris [French bean]
ref|NP_179753.1|  glucose-1-phosphate adenylyltransferase large s...    244   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472156.1|  PREDICTED: probable glucose-1-phosphate aden...    244   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010472157.1|  PREDICTED: probable glucose-1-phosphate aden...    244   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008388042.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   3e-73   
ref|XP_009759775.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    244   3e-73   Nicotiana sylvestris
ref|XP_006878500.1|  hypothetical protein AMTR_s00011p00201790          243   3e-73   
ref|XP_009113743.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   4e-73   Brassica rapa
gb|KJB58232.1|  hypothetical protein B456_009G200400                    243   5e-73   Gossypium raimondii
ref|XP_011083898.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   5e-73   Sesamum indicum [beniseed]
ref|XP_010263606.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   5e-73   Nelumbo nucifera [Indian lotus]
gb|EYU45186.1|  hypothetical protein MIMGU_mgv1a004400mg                243   5e-73   Erythranthe guttata [common monkey flower]
ref|XP_010429080.1|  PREDICTED: probable glucose-1-phosphate aden...    243   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006294016.1|  hypothetical protein CARUB_v10023004mg             243   5e-73   Capsella rubella
ref|XP_010416915.1|  PREDICTED: probable glucose-1-phosphate aden...    243   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_011074558.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   6e-73   Sesamum indicum [beniseed]
ref|XP_010416916.1|  PREDICTED: probable glucose-1-phosphate aden...    243   6e-73   Camelina sativa [gold-of-pleasure]
gb|AJG44463.1|  ADP-glucose pyrophosphorylase large subunit             243   6e-73   Lilium davidii var. unicolor
emb|CDX99581.1|  BnaC04g33380D                                          243   6e-73   
ref|XP_009365525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    242   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_003523570.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    243   9e-73   Glycine max [soybeans]
ref|XP_010924297.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    242   9e-73   Elaeis guineensis
ref|XP_002510419.1|  glucose-1-phosphate adenylyltransferase, put...    242   1e-72   Ricinus communis
ref|NP_001266081.1|  glucose-1-phosphate adenylyltransferase larg...    242   1e-72   Cicer arietinum [garbanzo]
gb|ACW82825.1|  ADP-glucose pyrophosphorylase large subunit L1 is...    242   1e-72   Lens culinaris
ref|XP_011007451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    242   1e-72   Populus euphratica
ref|XP_010110050.1|  Glucose-1-phosphate adenylyltransferase larg...    242   1e-72   Morus notabilis
ref|XP_009336061.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_009365102.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   2e-72   Pyrus x bretschneideri [bai li]
emb|CDY15884.1|  BnaA04g12270D                                          241   2e-72   Brassica napus [oilseed rape]
ref|XP_010926128.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   2e-72   
ref|XP_009140291.1|  PREDICTED: probable glucose-1-phosphate aden...    241   2e-72   Brassica rapa
gb|AFK36497.1|  unknown                                                 241   3e-72   Lotus japonicus
gb|AGB85111.1|  ADP-glucose pyrophosphorylase large subunit 3           241   4e-72   Ipomoea batatas [batate]
ref|XP_009406290.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001289992.1|  glucose-1-phosphate adenylyltransferase larg...    241   4e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009396671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008377280.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   4e-72   Malus domestica [apple tree]
ref|XP_008377281.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    240   4e-72   Malus domestica [apple tree]
ref|XP_010673183.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    240   5e-72   
ref|XP_009406289.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    241   5e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006346702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    240   7e-72   
gb|AAB82604.1|  ADP-glucose-pyrophosphorylase large subunit             233   8e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003528021.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    240   8e-72   Glycine max [soybeans]
ref|XP_006411722.1|  hypothetical protein EUTSA_v10024927mg             240   8e-72   
ref|XP_006415741.1|  hypothetical protein EUTSA_v10007379mg             239   1e-71   Eutrema salsugineum [saltwater cress]
ref|NP_195632.1|  glucose-1-phosphate adenylyltransferase large s...    239   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878559.1|  predicted protein                                  239   1e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_009394804.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    239   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK36157.1|  hypothetical protein AALP_AA4G085400                    238   2e-71   Arabis alpina [alpine rockcress]
ref|XP_006303972.1|  hypothetical protein CARUB_v10008862mg             238   2e-71   Capsella rubella
ref|XP_004291856.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    238   4e-71   Fragaria vesca subsp. vesca
gb|ADE77153.1|  unknown                                                 228   5e-71   Picea sitchensis
ref|XP_010323163.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    237   7e-71   Solanum lycopersicum
sp|P55242.1|GLGL2_SOLTU  RecName: Full=Glucose-1-phosphate adenyl...    237   7e-71   Solanum tuberosum [potatoes]
ref|XP_010499251.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    237   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_009101892.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    237   7e-71   Brassica rapa
ref|NP_001233947.1|  ADP-glucose pyrophosphorylase large subunit        237   7e-71   
ref|XP_009101891.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    238   7e-71   Brassica rapa
gb|KDP38538.1|  hypothetical protein JCGZ_04463                         237   8e-71   Jatropha curcas
ref|XP_010460525.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    237   1e-70   Camelina sativa [gold-of-pleasure]
gb|ABF69950.1|  ADP-glucose pyrophosphorylase (glucose-1-phosphat...    235   1e-70   Musa acuminata [banana]
ref|XP_010478113.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    237   1e-70   Camelina sativa [gold-of-pleasure]
gb|AFW79323.1|  ADP-glucose pyrophosphorylase large subunit             237   1e-70   
gb|AIO11223.1|  AGPL1 protein                                           236   1e-70   Gladiolus hybrid cultivar
ref|XP_010478112.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008648319.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   1e-70   
emb|CDY56761.1|  BnaA06g40730D                                          238   2e-70   Brassica napus [oilseed rape]
ref|XP_006282507.1|  hypothetical protein CARUB_v10007053mg             236   2e-70   Capsella rubella
ref|XP_010446453.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002890743.1|  hypothetical protein ARALYDRAFT_472972             236   2e-70   
gb|AJG44462.1|  ADP-glucose pyrophosphorylase large subunit             236   2e-70   Lilium davidii var. unicolor
ref|XP_010431888.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010437035.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002866835.1|  hypothetical protein ARALYDRAFT_490693             236   3e-70   
ref|XP_010437034.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010431887.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    236   4e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006654841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    235   4e-70   Oryza brachyantha
ref|XP_008220832.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    235   5e-70   Prunus mume [ume]
ref|XP_007222521.1|  hypothetical protein PRUPE_ppa004135mg             235   5e-70   Prunus persica
emb|CDX72711.1|  BnaC07g47330D                                          238   6e-70   
ref|XP_009416548.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    235   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010540326.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    235   7e-70   Tarenaya hassleriana [spider flower]
ref|NP_174089.1|  glucose-1-phosphate adenylyltransferase large s...    234   8e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AHA11391.1|  cytosolic ADP-glucose pyrophosphorylase large sub...    234   1e-69   Hordeum vulgare [barley]
sp|P12299.2|GLGL2_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    234   1e-69   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007160732.1|  hypothetical protein PHAVU_001G012500g             234   1e-69   Phaseolus vulgaris [French bean]
emb|CAA32532.1|  ADP-glucose pyrophosophorylase (1 is 2nd base in...    228   1e-69   Triticum aestivum [Canadian hard winter wheat]
sp|P30524.2|GLGL1_HORVU  RecName: Full=Glucose-1-phosphate adenyl...    234   1e-69   Hordeum vulgare [barley]
emb|CAD98749.1|  ADP-glucose pyrophosphorylase large subunit            234   1e-69   Triticum aestivum [Canadian hard winter wheat]
gb|AEH27531.1|  putative ADP-glucose pyrophosphorylase                  234   2e-69   Amorphophallus konjac [devil's-tongue]
gb|EMT32758.1|  hypothetical protein F775_52189                         234   3e-69   
prf||1909370A  ADP glucose pyrophosphorylase:SUBUNIT=L                  233   4e-69   Hordeum vulgare [barley]
ref|NP_001056424.2|  Os05g0580000                                       233   4e-69   
gb|AAC49942.1|  ADP-glucose pyrophosphorylase large subunit             233   5e-69   Solanum lycopersicum
gb|AAD39597.1|AC007858_11  10A19I.12                                    233   5e-69   Oryza sativa Japonica Group [Japonica rice]
gb|KJB63621.1|  hypothetical protein B456_010G008700                    232   7e-69   Gossypium raimondii
gb|EMS53815.1|  Glucose-1-phosphate adenylyltransferase large sub...    230   1e-68   Triticum urartu
ref|XP_006491439.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    231   2e-68   
gb|KDO86722.1|  hypothetical protein CISIN_1g043870mg                   231   2e-68   Citrus sinensis [apfelsine]
ref|XP_006444661.1|  hypothetical protein CICLE_v10023395mg             231   2e-68   
ref|NP_001284415.1|  myeloid leukemia factor 2                          231   2e-68   Cucumis melo [Oriental melon]
gb|AGT17180.1|  glucose-1-phosphate adenylyltransferase                 230   3e-68   Saccharum hybrid cultivar R570
ref|XP_004961109.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    230   4e-68   Setaria italica
gb|AFO84073.1|  ADP glucose pyrophosphorylase                           229   7e-68   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002440313.1|  hypothetical protein SORBIDRAFT_09g029610          229   9e-68   Sorghum bicolor [broomcorn]
gb|AEV40474.1|  ADP-glucose pyrophosphorylase 3                         229   1e-67   Spirodela polyrhiza
ref|XP_009113739.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    229   2e-67   Brassica rapa
ref|XP_003567817.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    228   3e-67   Brachypodium distachyon [annual false brome]
gb|KCW46725.1|  hypothetical protein EUGRSUZ_K00547                     226   4e-67   Eucalyptus grandis [rose gum]
gb|KHN20962.1|  Glucose-1-phosphate adenylyltransferase large sub...    228   4e-67   Glycine soja [wild soybean]
ref|XP_003545270.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    228   4e-67   Glycine max [soybeans]
ref|XP_002515141.1|  glucose-1-phosphate adenylyltransferase, put...    228   4e-67   Ricinus communis
dbj|BAA23490.1|  ADP glucose pyrophosphorylase large subunit            227   4e-67   Oryza sativa Japonica Group [Japonica rice]
emb|CBI37074.3|  unnamed protein product                                225   1e-66   Vitis vinifera
ref|XP_006658430.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    224   1e-66   
gb|AGT17354.1|  ADP-glucose pyrophosphorylase                           225   1e-66   Saccharum hybrid cultivar R570
ref|XP_003549440.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    226   1e-66   Glycine max [soybeans]
ref|XP_004289659.1|  PREDICTED: LOW QUALITY PROTEIN: glucose-1-ph...    226   1e-66   Fragaria vesca subsp. vesca
ref|XP_010035362.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    226   2e-66   Eucalyptus grandis [rose gum]
emb|CDX84911.1|  BnaC05g21440D                                          226   2e-66   
ref|XP_010652349.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    225   2e-66   Vitis vinifera
ref|XP_006841529.1|  hypothetical protein AMTR_s00003p00152830          226   3e-66   
ref|XP_002994500.1|  hypothetical protein SELMODRAFT_138695             223   3e-66   
ref|XP_011039886.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    225   3e-66   Populus euphratica
ref|XP_002970384.1|  hypothetical protein SELMODRAFT_231637             223   3e-66   
ref|XP_004959119.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    228   4e-66   
ref|XP_002274245.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    225   4e-66   
gb|KHN12692.1|  Glucose-1-phosphate adenylyltransferase large sub...    225   4e-66   Glycine soja [wild soybean]
gb|AEV40472.1|  ADP-glucose pyrophosphorylase 2                         225   5e-66   Spirodela polyrhiza
ref|XP_008799957.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    225   6e-66   
ref|XP_002968152.1|  hypothetical protein SELMODRAFT_169778             223   6e-66   
ref|XP_002320247.2|  hypothetical protein POPTR_0014s10560g             224   8e-66   Populus trichocarpa [western balsam poplar]
emb|CAN67125.1|  hypothetical protein VITISV_040166                     222   9e-66   Vitis vinifera
gb|KJB09550.1|  hypothetical protein B456_001G149300                    224   1e-65   Gossypium raimondii
ref|XP_010323162.1|  PREDICTED: ADP-glucose pyrophosphorylase lar...    224   2e-65   Solanum lycopersicum
ref|XP_010914841.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    223   2e-65   Elaeis guineensis
gb|EPS60253.1|  glucose-1-phosphate adenylyltransferase                 222   3e-65   Genlisea aurea
ref|XP_002461745.1|  hypothetical protein SORBIDRAFT_02g007310          216   3e-65   
ref|XP_003561277.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    223   3e-65   Brachypodium distachyon [annual false brome]
gb|KDP28372.1|  hypothetical protein JCGZ_14143                         221   3e-65   Jatropha curcas
gb|KDO42000.1|  hypothetical protein CISIN_1g0097201mg                  220   3e-65   Citrus sinensis [apfelsine]
gb|KHG05254.1|  Glucose-1-phosphate adenylyltransferase large sub...    222   6e-65   Gossypium arboreum [tree cotton]
gb|KCW86631.1|  hypothetical protein EUGRSUZ_B03259                     214   1e-64   Eucalyptus grandis [rose gum]
gb|EAZ03355.1|  hypothetical protein OsI_25494                          219   2e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_007051343.1|  ADPGLC-PPase large subunit                         221   2e-64   
gb|ACL52683.1|  unknown                                                 219   5e-64   Zea mays [maize]
gb|AAS00542.1|  ADP-glucose pyrophosphorylase large subunit             219   5e-64   Fragaria x ananassa
tpg|DAA60137.1|  TPA: glucose-1-phosphate adenylyltransferase           219   5e-64   
ref|NP_001059276.1|  Os07g0243200                                       219   6e-64   
dbj|BAC16096.1|  putative glucose-1-phosphate adenylyltransferase...    219   7e-64   Oryza sativa Japonica Group [Japonica rice]
gb|KCW81736.1|  hypothetical protein EUGRSUZ_C03089                     215   1e-63   Eucalyptus grandis [rose gum]
ref|XP_006644406.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    218   1e-63   Oryza brachyantha
dbj|BAG31808.1|  putative ADP-glucose pyrophosphorylase large sub...    206   1e-63   Zanthoxylum ailanthoides
dbj|BAD68891.1|  glucose-1-phosphate adenylyltransferase large chain    218   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ71339.1|  ADP-glucose pyrophosphorylase large subunit             218   1e-63   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ71342.1|  ADP-glucose pyrophosphorylase large subunit             218   1e-63   Oryza sativa [red rice]
gb|ACJ71341.1|  ADP-glucose pyrophosphorylase large subunit             218   1e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_003553688.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    219   1e-63   Glycine max [soybeans]
ref|NP_001043654.1|  Os01g0633100                                       218   1e-63   
gb|KHN43393.1|  Glucose-1-phosphate adenylyltransferase large sub...    218   1e-63   Glycine soja [wild soybean]
gb|ACJ71347.1|  ADP-glucose pyrophosphorylase large subunit             218   1e-63   Oryza sativa Indica Group [Indian rice]
gb|ACJ71336.1|  ADP-glucose pyrophosphorylase large subunit             218   1e-63   Oryza sativa [red rice]
gb|ACJ71335.1|  ADP-glucose pyrophosphorylase large subunit             218   1e-63   Oryza sativa [red rice]
gb|ACJ71334.1|  ADP-glucose pyrophosphorylase large subunit             218   2e-63   Oryza sativa Indica Group [Indian rice]
gb|ACJ71344.1|  ADP-glucose pyrophosphorylase large subunit             218   2e-63   Oryza sativa Indica Group [Indian rice]
gb|ACJ71333.1|  ADP-glucose pyrophosphorylase large subunit             218   2e-63   
sp|P12300.1|GLGL3_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    218   2e-63   
gb|EEE55040.1|  hypothetical protein OsJ_02724                          218   2e-63   
gb|EEE66870.1|  hypothetical protein OsJ_23681                          219   3e-63   
gb|KDO42002.1|  hypothetical protein CISIN_1g0097201mg                  214   5e-63   
dbj|BAG31796.1|  putative ADP-glucose pyrophosphorylase large sub...    204   5e-63   
ref|XP_010556665.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    217   6e-63   
gb|ACJ71332.1|  ADP-glucose pyrophosphorylase large subunit             216   6e-63   
ref|XP_006850726.1|  hypothetical protein AMTR_s00025p00042290          207   1e-62   
ref|NP_001106058.1|  putative glucose-1-phosphate adenylyltransfe...    216   1e-62   
gb|AGT17259.1|  ADP-glucose pyrophosphorylase                           213   1e-62   
ref|XP_002975788.1|  hypothetical protein SELMODRAFT_267891             214   3e-62   
ref|XP_002973739.1|  hypothetical protein SELMODRAFT_149205             214   4e-62   
ref|XP_004494490.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    214   4e-62   
gb|ACJ71343.1|  ADP-glucose pyrophosphorylase large subunit             214   5e-62   
ref|XP_010907343.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   9e-62   
gb|AAK27727.1|  ADP-glucose pyrophosphorylase large subunit isoform     213   2e-61   
gb|AFK40596.1|  unknown                                                 200   2e-61   
gb|AGT17261.1|  ADP-glucose pyrophosphorylase                           212   3e-61   
ref|XP_008673450.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    212   7e-61   
gb|KEH24450.1|  glucose-1-phosphate adenylyltransferase family pr...    208   7e-61   
ref|XP_008673451.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    212   8e-61   
ref|XP_003520778.2|  PREDICTED: glucose-1-phosphate adenylyltrans...    211   8e-61   
ref|XP_007163265.1|  hypothetical protein PHAVU_001G219900g             211   1e-60   
ref|XP_004162474.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    205   1e-60   
gb|AFP90368.1|  endosperm glucose-1-phosphate adenylyltransferase...    210   2e-60   
tpg|DAA58441.1|  TPA: shrunken2                                         212   2e-60   
tpg|DAA58443.1|  TPA: shrunken2                                         212   3e-60   
ref|XP_002456012.1|  hypothetical protein SORBIDRAFT_03g028850          209   3e-60   
gb|AFO84093.1|  ADP glucose pyrophosphorylase                           209   4e-60   
ref|XP_004969255.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    209   4e-60   
ref|NP_001121104.1|  glucose-1-phosphate adenylyltransferase larg...    209   4e-60   
gb|AGT16790.1|  ADP-glucose pyrophosphorylase large subunit             208   7e-60   
gb|AES82317.2|  glucose-1-phosphate adenylyltransferase family pr...    208   1e-59   
gb|AEV91541.1|  ADP-glucose pyrophosphorylase                           205   1e-59   
ref|XP_008458581.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    207   1e-59   
ref|XP_004149284.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   3e-59   
ref|XP_008800702.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   4e-59   
ref|XP_001784075.1|  predicted protein                                  204   5e-59   
gb|ABR17521.1|  unknown                                                 206   6e-59   
ref|XP_004134146.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   6e-59   
ref|XP_001767907.1|  predicted protein                                  204   7e-59   
ref|XP_004164723.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    206   7e-59   
ref|XP_007222671.1|  hypothetical protein PRUPE_ppa008581mg             201   7e-59   
ref|NP_001233977.1|  ADP-glucose pyrophosphorylase large subunit        204   2e-58   
ref|XP_008438706.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   3e-58   
gb|AEV40470.1|  ADP-glucose pyrophosphorylase 1                         204   3e-58   
ref|XP_009405044.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    204   6e-58   
ref|NP_197423.1|  glucose-1-phosphate adenylyltransferase large s...    203   6e-58   
ref|XP_001751725.1|  predicted protein                                  204   6e-58   
dbj|BAA76362.1|  glucose-1-phosphate adenylyltransferase                203   7e-58   
gb|AAS00543.1|  ADP-glucose pyrophosphorylase large subunit             199   7e-58   
ref|XP_009342669.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    203   7e-58   
ref|XP_009342671.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    203   7e-58   
ref|XP_010666778.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    202   1e-57   
ref|XP_001782975.1|  predicted protein                                  203   1e-57   
ref|XP_010666779.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    202   1e-57   
emb|CBI26204.3|  unnamed protein product                                201   1e-57   
ref|XP_001759196.1|  predicted protein                                  200   1e-57   
ref|XP_007136617.1|  hypothetical protein PHAVU_009G059800g             199   1e-57   
ref|XP_002873938.1|  hypothetical protein ARALYDRAFT_488807             202   2e-57   
ref|XP_002281069.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    202   2e-57   
ref|XP_010255929.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    202   2e-57   
ref|XP_003626099.1|  Glucose-1-phosphate adenylyltransferase            202   3e-57   
ref|XP_002517196.1|  glucose-1-phosphate adenylyltransferase, put...    202   3e-57   
gb|AES92592.2|  glucose-1-phosphate adenylyltransferase family pr...    201   3e-57   
ref|NP_001266131.1|  glucose-1-phosphate adenylyltransferase larg...    201   5e-57   
ref|XP_011090768.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   5e-57   
ref|XP_009120906.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   5e-57   
ref|XP_010551763.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   5e-57   
ref|XP_009603253.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    201   6e-57   
emb|CDY68209.1|  BnaC09g54280D                                          200   7e-57   
ref|XP_009760082.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    200   7e-57   
gb|AHG12640.1|  ADP-glucose pyrophosphorylase large subunit             200   8e-57   
gb|AHL44840.1|  glucose-1-phosphate adenylyltransferase large sub...    200   9e-57   
gb|KCW84250.1|  hypothetical protein EUGRSUZ_B01108                     200   9e-57   
ref|XP_001774318.1|  predicted protein                                  199   1e-56   
gb|KDO74746.1|  hypothetical protein CISIN_1g013483mg                   196   1e-56   
ref|XP_010035400.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    200   1e-56   
gb|KJB38095.1|  hypothetical protein B456_006G236600                    198   1e-56   
ref|XP_004296919.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    200   1e-56   
gb|AFL55399.1|  ADP-glucose pyrophosphorylase large subunit 4           200   1e-56   
dbj|BAF47749.1|  ADP-glucose pyrophosphorylase beta subunit IbAGPb3     200   1e-56   
ref|XP_011034216.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    200   1e-56   
emb|CDY02573.1|  BnaC02g08620D                                          199   1e-56   
emb|CDY47206.1|  BnaAnng08760D                                          200   2e-56   
ref|XP_002311802.1|  ADP-glucose pyrophosphorylase family protein       199   2e-56   
ref|XP_007034660.1|  ADP glucose pyrophosphorylase large subunit ...    196   2e-56   
gb|EPS66248.1|  hypothetical protein M569_08527                         199   2e-56   
ref|XP_009126310.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   2e-56   
ref|XP_010454187.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   2e-56   
ref|XP_010039908.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   2e-56   
gb|AGB85112.1|  ADP-glucose pyrophosphorylase large subunit 4           199   3e-56   
gb|KJB38094.1|  hypothetical protein B456_006G236600                    199   3e-56   
ref|XP_010042059.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    191   4e-56   
ref|XP_007153923.1|  hypothetical protein PHAVU_003G076500g             199   4e-56   
ref|XP_008340932.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    199   4e-56   
ref|XP_006400480.1|  hypothetical protein EUTSA_v10013265mg             198   4e-56   
ref|XP_010420717.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    198   4e-56   
emb|CDO99014.1|  unnamed protein product                                198   5e-56   
ref|XP_009338465.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    198   5e-56   
ref|XP_008222970.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    198   6e-56   
ref|NP_001275395.1|  glucose-1-phosphate adenylyltransferase larg...    197   6e-56   
ref|XP_009345065.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    197   6e-56   
ref|NP_001241391.1|  uncharacterized protein LOC100810451               198   6e-56   
ref|XP_001784242.1|  predicted protein                                  196   7e-56   
gb|EEE59878.1|  hypothetical protein OsJ_12478                          196   7e-56   
ref|XP_001778378.1|  predicted protein                                  196   8e-56   
gb|KFK26166.1|  hypothetical protein AALP_AA8G211600                    197   9e-56   
ref|XP_006577921.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    197   1e-55   
gb|KDO74743.1|  hypothetical protein CISIN_1g013483mg                   195   1e-55   
gb|AIZ00993.1|  ADP-glucose pyrophosphorylase large subunit 1           197   1e-55   
ref|XP_009364201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    197   1e-55   
gb|KDO74742.1|  hypothetical protein CISIN_1g013483mg                   195   2e-55   
ref|XP_003549968.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    197   2e-55   
ref|XP_008390847.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    197   2e-55   
ref|XP_007034659.1|  ADP glucose pyrophosphorylase large subunit ...    197   2e-55   
ref|XP_010492975.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    196   3e-55   
ref|XP_006651788.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    195   3e-55   
ref|NP_001051184.1|  Os03g0735000                                       196   4e-55   
gb|EEC76133.1|  hypothetical protein OsI_13419                          196   4e-55   
gb|AAM95945.1|  ADP-glucose pyrophosphorylase large subunit             196   5e-55   
ref|XP_006489328.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    196   5e-55   
gb|KDP40133.1|  hypothetical protein JCGZ_02131                         196   5e-55   
ref|XP_010093993.1|  Glucose-1-phosphate adenylyltransferase larg...    196   6e-55   
tpg|DAA51190.1|  TPA: hypothetical protein ZEAMMB73_768829              189   6e-55   
ref|XP_006419854.1|  hypothetical protein CICLE_v10004731mg             196   6e-55   
ref|NP_001105717.1|  glucose-1-phosphate adenylyltransferase larg...    195   7e-55   
ref|XP_006289333.1|  hypothetical protein CARUB_v10002818mg             194   1e-54   
sp|P12298.1|GLGL1_WHEAT  RecName: Full=Glucose-1-phosphate adenyl...    187   6e-54   
gb|AGT16263.1|  plastid ADP-glucose pyrophosphorylase                   191   6e-54   
gb|EYU41519.1|  hypothetical protein MIMGU_mgv1a004639mg                192   9e-54   
ref|XP_006581201.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    191   2e-53   
gb|AGT17074.1|  glucose-1-phosphate adenylyltransferase                 191   2e-53   
gb|KCW45857.1|  hypothetical protein EUGRSUZ_L00275                     187   2e-53   
ref|XP_006404613.1|  hypothetical protein EUTSA_v10000141mg             191   3e-53   
ref|XP_010941806.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    191   3e-53   
ref|NP_001106017.1|  plastid ADP-glucose pyrophosphorylase large ...    189   7e-53   
ref|XP_002463921.1|  hypothetical protein SORBIDRAFT_01g008940          189   8e-53   
emb|CAX51356.1|  large subunit of ADP-glucose pyrophosphorylase         189   9e-53   
dbj|BAJ90901.1|  predicted protein                                      189   9e-53   
gb|AAC49729.1|  ADP-glucose pyrophosphorylase large subunit             189   1e-52   
ref|XP_003610395.1|  Glucose-1-phosphate adenylyltransferase            189   1e-52   
gb|EMT06319.1|  Glucose-1-phosphate adenylyltransferase large sub...    188   1e-52   
gb|AGT16453.1|  glucose-1-phosphate adenylyltransferase                 189   2e-52   
gb|ABD66657.1|  plastid ADP-glucose pyrophosphorylase large subunit     189   2e-52   
ref|XP_003560093.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    188   2e-52   
gb|EMS50037.1|  Glucose-1-phosphate adenylyltransferase large sub...    187   3e-52   
ref|XP_010914842.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    186   7e-52   
ref|XP_007034661.1|  ADP glucose pyrophosphorylase large subunit ...    184   1e-51   
gb|ABS19875.1|  putative glucose-1-phosphate adenylyltransferase ...    186   1e-51   
emb|CAA51778.1|  glucose-1-phosphate adenylyltransferase                176   6e-51   
ref|XP_004981865.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    186   7e-51   
ref|XP_005842916.1|  hypothetical protein CHLNCDRAFT_37654              184   1e-50   
ref|XP_010910891.1|  PREDICTED: glucose-1-phosphate adenylyltrans...    175   1e-50   
pir||S42547  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    174   4e-50   
gb|AAK27685.1|AF347698_1  ADP-glucose pyrophosphorylase large sub...    183   5e-50   
ref|WP_015176220.1|  Glucose-1-phosphate adenylyltransferase            179   2e-49   
ref|WP_022607393.1|  glucose-1-phosphate adenylyltransferase            179   2e-49   
gb|ACJ06583.1|  chloroplast putative glucose-1-phosphate adenylyl...    169   4e-49   
ref|WP_012597885.1|  glucose-1-phosphate adenylyltransferase            178   4e-49   
gb|KCW45645.1|  hypothetical protein EUGRSUZ_L00600                     179   7e-49   
gb|ACJ06586.1|  chloroplast putative glucose-1-phosphate adenylyl...    168   7e-49   
ref|WP_035156038.1|  glucose-1-phosphate adenylyltransferase            177   8e-49   
ref|WP_015228619.1|  glucose-1-phosphate adenylyltransferase            177   9e-49   
ref|WP_002761951.1|  glucose-1-phosphate adenylyltransferase            177   1e-48   
ref|WP_006635221.1|  glucose-1-phosphate adenylyltransferase            176   1e-48   
ref|WP_015129202.1|  glucose-1-phosphate adenylyltransferase            176   1e-48   
gb|AAB65844.1|  ADP-glucose pyrophosphorylase                           170   1e-48   
gb|AAM73733.1|  ADP-glucose pyrophosphorylase large subunit             169   2e-48   
gb|AAB24191.2|  endosperm ADP-glucose pyrophosphorylase subunit h...    178   2e-48   
gb|AAM73734.1|  ADP-glucose pyrophosphorylase large subunit             169   2e-48   
ref|XP_005649170.1|  glucose-1-phosphate adenylyltransferase            177   3e-48   
emb|CAB37841.1|  ADP-glucose pyrophosphorylase large subunit            169   3e-48   
ref|WP_015200127.1|  glucose-1-phosphate adenylyltransferase            176   3e-48   
ref|WP_029636857.1|  glucose-1-phosphate adenylyltransferase [          175   4e-48   
ref|WP_002789937.1|  glucose-1-phosphate adenylyltransferase            175   4e-48   
ref|WP_012265852.1|  glucose-1-phosphate adenylyltransferase            175   6e-48   
ref|WP_035759831.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    174   8e-48   
ref|WP_015195259.1|  Glucose-1-phosphate adenylyltransferase            174   8e-48   
ref|XP_011401140.1|  Glucose-1-phosphate adenylyltransferase larg...    175   8e-48   
gb|KCW55369.1|  hypothetical protein EUGRSUZ_I01281                     175   8e-48   
ref|WP_006621302.1|  glucose-1-phosphate adenylyltransferase            174   1e-47   
ref|WP_002768734.1|  glucose-1-phosphate adenylyltransferase            174   1e-47   
ref|WP_002784562.1|  Glucose-1-phosphate adenylyltransferase            174   1e-47   
ref|WP_040930274.1|  glucose-1-phosphate adenylyltransferase            166   2e-47   
pir||S22525  glucose-1-phosphate adenylyltransferase (EC 2.7.7.27...    167   2e-47   
gb|AAB38781.1|  ADP-glucose pyrophosphorylase large subunit             175   2e-47   
ref|WP_015189052.1|  Glucose-1-phosphate adenylyltransferase            173   2e-47   
ref|XP_001422382.1|  predicted protein                                  174   2e-47   
ref|WP_006853039.1|  glucose-1-phosphate adenylyltransferase            173   3e-47   
ref|WP_015226172.1|  glucose-1-phosphate adenylyltransferase            173   3e-47   
ref|WP_004268476.1|  glucose-1-phosphate adenylyltransferase            173   4e-47   
ref|WP_011619605.1|  glucose-1-phosphate adenylyltransferase            173   4e-47   
ref|WP_002798919.1|  glucose-1-phosphate adenylyltransferase            173   4e-47   
ref|XP_002507549.1|  adp-glucose pyrophosphorylase                      173   5e-47   
gb|ABQ81973.1|  ADP-glucose pyrophosphorylase                           164   6e-47   
ref|WP_013322137.1|  glucose-1-phosphate adenylyltransferase            172   7e-47   
ref|WP_017653597.1|  glucose-1-phosphate adenylyltransferase            172   7e-47   
ref|WP_006171646.1|  glucose-1-phosphate adenylyltransferase            172   7e-47   
gb|KDD76751.1|  nucleotidyl transferase                                 172   8e-47   
dbj|GAL94421.1|  glucose-1-phosphate adenylyltransferase                172   8e-47   
ref|WP_015208914.1|  glucose-1-phosphate adenylyltransferase            172   9e-47   
ref|WP_019489832.1|  glucose-1-phosphate adenylyltransferase            172   9e-47   
ref|WP_038652218.1|  glucose-1-phosphate adenylyltransferase            172   1e-46   
ref|WP_006617056.1|  glucose-1-phosphate adenylyltransferase            171   1e-46   
ref|WP_011933203.1|  glucose-1-phosphate adenylyltransferase            171   1e-46   
ref|WP_008201765.1|  glucose-1-phosphate adenylyltransferase            171   1e-46   
ref|WP_006041310.1|  glucose-1-phosphate adenylyltransferase            171   1e-46   
ref|WP_042151366.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|WP_027249398.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|WP_026793759.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    171   2e-46   
ref|WP_024971182.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|WP_026787044.1|  MULTISPECIES: glucose-1-phosphate adenylyltr...    171   2e-46   
ref|WP_026797575.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|WP_004158460.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|WP_039741952.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|WP_017306779.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   
ref|XP_003056043.1|  adp-glucose pyrophosphorylase                      172   2e-46   
gb|KHN14186.1|  Glucose-1-phosphate adenylyltransferase large sub...    172   2e-46   
ref|WP_002733318.1|  glucose-1-phosphate adenylyltransferase            171   2e-46   



>emb|CAB51610.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=306

 Score =   293 bits (751),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  160  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  219

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESD
Sbjct  220  LMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESD  279

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  280  RPDEGFYIRSGITIIMEKATIRDGTVI  306



>emb|CAB52196.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=450

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/147 (97%), Positives = 145/147 (99%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC+VEHSIIGERSRLDCGVELKDT
Sbjct  304  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECSVEHSIIGERSRLDCGVELKDT  363

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQ+SD
Sbjct  364  LMMGADTYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQDSD  423

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATIPDGTVI
Sbjct  424  RPDEGFYIRSGITIIMEKATIPDGTVI  450



>dbj|BAF47746.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1A [Ipomoea 
batatas]
Length=517

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  371  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESD
Sbjct  431  LMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  491  RPDEGFYIRSGITIIMEKATIRDGTVI  517



>gb|AFL55396.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/147 (98%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  371  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESD
Sbjct  431  LMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  491  RPDEGFYIRSGITIIMEKATIRDGTVI  517



>gb|AGB85109.1| ADP-glucose pyrophosphorylase large subunit 1 [Ipomoea batatas]
Length=517

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/147 (97%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFY SPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  371  YDPKTPFYASPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESD
Sbjct  431  LMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI DGTVI
Sbjct  491  RPDEGFYIRSGITIIMEKATIRDGTVI  517



>emb|CAB55496.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=385

 Score =   288 bits (738),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPK PFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  239  YDPKIPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  298

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGKDVVI NKDGVQESD
Sbjct  299  LMMGADTYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKDVVITNKDGVQESD  358

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI  GTVI
Sbjct  359  RPDEGFYIRSGITIIMEKATIRYGTVI  385



>emb|CAB55495.1| ADP-glucose pyrophosphorylase [Ipomoea batatas]
Length=490

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/147 (97%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  344  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  403

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGADNYETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGK VVI NKDGVQESD
Sbjct  404  LMMGADNYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKHVVITNKDGVQESD  463

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI  GTVI
Sbjct  464  RPDEGFYIRSGITIIMEKATIRYGTVI  490



>gb|AAC21562.1| ADP-glucose pyrophosphorylase large subunit [Ipomoea batatas]
Length=517

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/147 (96%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT
Sbjct  371  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETESEIASLLADG VPIGVGENTKIRNAIIDKNVRIGK VVI NKDGVQESD
Sbjct  431  LMMGADTYETESEIASLLADGKVPIGVGENTKIRNAIIDKNVRIGKHVVITNKDGVQESD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGITIIMEKATI DGTV+
Sbjct  491  RPDEGFYIRSGITIIMEKATIRDGTVV  517



>ref|XP_009763056.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana sylvestris]
Length=528

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC+V+HSI+GERSRLDCGVELKDT
Sbjct  382  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECSVDHSIVGERSRLDCGVELKDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IGKDVVIMNKDGVQE+D
Sbjct  442  LMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKDVVIMNKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR+G+TI+ EKATI DGTVI
Sbjct  502  RPEEGFYIRAGLTIVAEKATIKDGTVI  528



>ref|XP_009621409.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Nicotiana tomentosiformis]
Length=528

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC+V+HSI+GERSRLDCGVELKDT
Sbjct  382  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECSVDHSIVGERSRLDCGVELKDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+G VPIG+GENTKIRN IIDKN +IGKDVVIMNKDGVQE+D
Sbjct  442  LMMGADYYQTESEIASLLAEGKVPIGIGENTKIRNCIIDKNAKIGKDVVIMNKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR G+TII EKATI DGTVI
Sbjct  502  RPEEGFYIRGGLTIIAEKATIKDGTVI  528



>gb|AFO84074.1| ADP glucose pyrophosphorylase, partial [Actinidia chinensis]
Length=344

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKID CKIKD+IISHGCFLREC+VEHSI+GERSRLD GVELKDT
Sbjct  198  YDPKTPFFTSPRFLPPTKIDRCKIKDSIISHGCFLRECSVEHSIVGERSRLDYGVELKDT  257

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+GN+PIG+G+NTKIRN IIDKN +IGKDVVI+NKDGV+E+D
Sbjct  258  LMMGADYYQTESEIASLLAEGNIPIGIGKNTKIRNCIIDKNAKIGKDVVIVNKDGVEEAD  317

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPD+GFYIRSGITII+EKATI DGTVI
Sbjct  318  RPDQGFYIRSGITIILEKATITDGTVI  344



>gb|KDO42003.1| hypothetical protein CISIN_1g0097201mg [Citrus sinensis]
Length=353

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT
Sbjct  207  YDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDT  266

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+D
Sbjct  267  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEAD  326

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  327  RPELGFYIRSGITIIMEKATIEDGMVI  353



>ref|XP_011088418.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088419.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088420.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088421.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088422.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
 ref|XP_011088423.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Sesamum indicum]
Length=526

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVELKD+
Sbjct  380  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDSGVELKDS  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA G VP+G+G NTKIRN IIDKN RIGKDV+I NKDGVQE+D
Sbjct  440  LMMGADYYQTESEIASLLAQGKVPMGIGRNTKIRNCIIDKNARIGKDVIIKNKDGVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII+EKATI DGTVI
Sbjct  500  RPEEGFYIRSGITIIVEKATISDGTVI  526



>sp|Q00081.1|GLGL1_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1; AltName: Full=ADP-glucose pyrophosphorylase; AltName: 
Full=ADP-glucose synthase; AltName: Full=AGPase S; AltName: 
Full=Alpha-D-glucose-1-phosphate adenyl transferase, partial 
[Solanum tuberosum]
 emb|CAA43490.1| ADP-glucose pyrophosphorylase large subunit [Solanum tuberosum]
Length=470

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT
Sbjct  324  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDT  383

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  384  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  443

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI II+EKATI DGTVI
Sbjct  444  RPEEGFYIRSGIIIILEKATIRDGTVI  470



>gb|AFL55397.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVELKDT
Sbjct  369  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDFGVELKDT  428

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETESEIASLLADG VPIG+G NTKI N IIDKNVRIGKDV+I NKDGV+E+D
Sbjct  429  LMMGADYYETESEIASLLADGKVPIGIGHNTKISNCIIDKNVRIGKDVIIANKDGVEEAD  488

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI +IMEKA I DGTVI
Sbjct  489  RPEEGFYIRSGIPVIMEKAVIKDGTVI  515



>dbj|BAF47747.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb1B [Ipomoea 
batatas]
Length=515

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVELKDT
Sbjct  369  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDFGVELKDT  428

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETESEIASLLADG VPIG+G NTKI N IIDKNVRIGKDV+I NKDGV+E+D
Sbjct  429  LMMGADYYETESEIASLLADGKVPIGIGHNTKISNCIIDKNVRIGKDVIIANKDGVEEAD  488

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI +IMEKA I DGTVI
Sbjct  489  RPEEGFYIRSGIPVIMEKAVIKDGTVI  515



>gb|KDO42001.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=419

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT
Sbjct  273  YDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDT  332

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+D
Sbjct  333  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEAD  392

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  393  RPELGFYIRSGITIIMEKATIEDGMVI  419



>gb|AAD56405.1|AF184345_1 ADP-glucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=520

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT
Sbjct  374  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  434  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII EKATI DGTVI
Sbjct  494  RPEEGFYIRSGITIISEKATIRDGTVI  520



>gb|ABC26923.1| ADPglucose pyrophosphorylase large subunit [Solanum habrochaites]
Length=527

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT
Sbjct  381  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  441  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII EKATI DGTVI
Sbjct  501  RPEEGFYIRSGITIISEKATIRDGTVI  527



>ref|NP_001233918.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40723.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=516

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVELKDT
Sbjct  370  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVELKDT  429

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  430  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  489

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI II EKATI DGTVI
Sbjct  490  RPEEGFYIRSGIIIISEKATIRDGTVI  516



>gb|AAC49941.1| ADP-glucose pyrophosphorylase large subunit 1 [Solanum lycopersicum]
Length=524

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVELKDT
Sbjct  378  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVELKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  438  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI II EKATI DGTVI
Sbjct  498  RPEEGFYIRSGIIIIAEKATIRDGTVI  524



>gb|ABC26921.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|ABC26922.1| ADPglucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=524

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+CTVEHSI+GERSRLDCGVELKDT
Sbjct  378  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCTVEHSIVGERSRLDCGVELKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  438  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI II EKATI DGTVI
Sbjct  498  RPEEGFYIRSGIIIISEKATIRDGTVI  524



>gb|KDO41998.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=449

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT
Sbjct  303  YDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDT  362

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+D
Sbjct  363  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEAD  422

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  423  RPELGFYIRSGITIIMEKATIEDGMVI  449



>ref|XP_006365120.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Solanum tuberosum]
 ref|XP_006365121.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Solanum tuberosum]
Length=527

 Score =   268 bits (686),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLR+C+VEHSI+GERSRLDCGVELKDT
Sbjct  381  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRDCSVEHSIVGERSRLDCGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+GENTKIR  IIDKN +IGK+V I+NKDGVQE+D
Sbjct  441  FMMGADYYQTESEIASLLAEGKVPIGIGENTKIRKCIIDKNAKIGKNVSIINKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI II+EKATI DGTVI
Sbjct  501  RPEEGFYIRSGIIIILEKATIRDGTVI  527



>ref|NP_001275823.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Citrus sinensis]
 gb|ACF77017.1| ADP-glucose pyrophosphorylase large subunit [Citrus sinensis]
Length=527

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC++KDAIISHGCFLRECTVEHSI+GERSR+D GVELKDT
Sbjct  381  YDPKTPFYTSPRFLPPTKIDNCRMKDAIISHGCFLRECTVEHSIVGERSRIDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKDGVQE+D
Sbjct  441  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  501  RPELGFYIRSGITIIMEKATIEDGMVI  527



>gb|AAD56042.1|AF184598_1 ADP-glucose pyrophosphorylase large subunit [Citrus unshiu]
Length=531

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 139/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC++KDAIISHGCFLRECTVEHSI+GERSR+D GVELKDT
Sbjct  385  YDPKTPFYTSPRFLPPTKIDNCRMKDAIISHGCFLRECTVEHSIVGERSRIDYGVELKDT  444

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKDGVQE+D
Sbjct  445  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDGVQEAD  504

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  505  RPELGFYIRSGITIIMEKATIEDGMVI  531



>ref|XP_006423322.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
 ref|XP_006487217.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Citrus sinensis]
 gb|ESR36562.1| hypothetical protein CICLE_v10028195mg [Citrus clementina]
Length=527

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD VQE+D
Sbjct  441  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  501  RPELGFYIRSGITIIMEKATIEDGMVI  527



>gb|AGB85110.1| ADP-glucose pyrophosphorylase large subunit 2 [Ipomoea batatas]
Length=515

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR LPPTKIDNCKIKDAIISHGCFLREC VEHSI+GERSRLD GVELKDT
Sbjct  369  YDPKTPFYTSPRLLPPTKIDNCKIKDAIISHGCFLRECIVEHSIVGERSRLDFGVELKDT  428

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETESEIASLLADG VPIG+G NTKI N IIDKNVRIGKDV+I NKDGV+E+D
Sbjct  429  LMMGADYYETESEIASLLADGKVPIGIGHNTKISNCIIDKNVRIGKDVIIANKDGVEEAD  488

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI +IMEK  I DGTVI
Sbjct  489  RPEEGFYIRSGIPVIMEKVVIKDGTVI  515



>gb|AGS94412.1| ADP-glucose pyrophosphorylase large subunit 4 [Actinidia deliciosa]
Length=524

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKID CKIKD+IISHGCFLREC+VEHSI+GERSRLD GVELKDT
Sbjct  378  YDPKTPFFTSPRFLPPTKIDRCKIKDSIISHGCFLRECSVEHSIVGERSRLDYGVELKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+GN+PIGVG+NTKIRN IIDKN +IGK VVI+NKDGV+E+D
Sbjct  438  LMMGADYYQTESEIASLLAEGNIPIGVGKNTKIRNCIIDKNAKIGKGVVIVNKDGVEEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +PD+GFYIRSGITII+EKATI DGTVI
Sbjct  498  QPDQGFYIRSGITIILEKATITDGTVI  524



>gb|KJB32481.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=395

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT
Sbjct  249  YDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDT  308

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+D
Sbjct  309  VMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEAD  368

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  369  RPEEGFYIRSGLTIIMEKATIADGTVI  395



>ref|XP_002512925.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF49428.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=531

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLRECTV HS++GERSRLD GVELKDT
Sbjct  385  YDPKTPFYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVRHSVVGERSRLDYGVELKDT  444

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE+EIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NKDGVQE+D
Sbjct  445  VMLGADYYQTETEIASLLAEGKVPIGVGRNTKIKNCIIDKNAKIGKDVVIVNKDGVQEAD  504

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITIIMEKATI DGTVI
Sbjct  505  RPEEGFYIRSGITIIMEKATIEDGTVI  531



>ref|XP_003537869.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006590891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN39792.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=530

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSPRFLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVEL+DT
Sbjct  384  YDPKTPIYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVELQDT  443

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  444  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEAD  503

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  504  RPEDGFYIRSGITVILEKATIEDGTVI  530



>ref|XP_003541029.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Glycine max]
 gb|KHN25384.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=528

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSPRFLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVEL+DT
Sbjct  382  YDPKTPIYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  442  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  502  RPEDGFYIRSGITVILEKATIEDGTVI  528



>gb|KDP41770.1| hypothetical protein JCGZ_26788 [Jatropha curcas]
Length=527

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK+D C+I DAIISHGCFLRECT++HS++GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSPRFLPPTKMDKCRIVDAIISHGCFLRECTIQHSVVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE+EIASLLADG VPIGVG NTKI+N IIDKN +IGKDVVIMNKDGVQE+D
Sbjct  441  VMLGADYYQTEAEIASLLADGKVPIGVGRNTKIKNCIIDKNAKIGKDVVIMNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII EKATI DG VI
Sbjct  501  RPEEGFYIRSGITIIAEKATIEDGIVI  527



>emb|CDO97030.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKID C+I D+IISHGCFLRECTVEHSI+GERSRLD GVELKDT
Sbjct  376  YDPKTPFFTSPRFLPPTKIDKCQIMDSIISHGCFLRECTVEHSIVGERSRLDYGVELKDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
             MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKN +IGKDV I+NKDGVQE+D
Sbjct  436  FMMGADYYQTESEIASLLAEGKVPIGIGQNTKIRNCIIDKNAKIGKDVAILNKDGVQEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR+GIT+I+EKATI D TVI
Sbjct  496  RPEEGFYIRAGITVILEKATINDRTVI  522



>ref|NP_001284451.1| myeloid leukemia factor 1 [Cucumis melo]
 gb|AAB91463.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=525

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLREC+++HSI+GERSRLD GVELKDT
Sbjct  379  YDPKTPFYTSPRFLPPTKIDRCQIVDAIISHGCFLRECSIQHSIVGERSRLDYGVELKDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TESEI  LLA+G VP+G+G NTKIR  IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  439  IMMGADNYQTESEITGLLAEGKVPVGIGPNTKIRKCIIDKNAKIGKDVIIMNKDGVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITI+MEKATI DGTVI
Sbjct  499  RPEQGFYIRSGITIVMEKATIEDGTVI  525



>ref|XP_010088945.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
 gb|EXB37149.1| Glucose-1-phosphate adenylyltransferase large subunit 3 [Morus 
notabilis]
Length=535

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKID C+I DAIISHGCFLREC+V+ SI+GERSRLD GVELKDT
Sbjct  389  YDPKTPFFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQRSIVGERSRLDYGVELKDT  448

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKNV+IGKDVVI NKDGV E+D
Sbjct  449  IMMGADYYQTESEIASLLAEGKVPIGIGQNTKIRNCIIDKNVKIGKDVVIRNKDGVHEAD  508

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII+EKATI DGTVI
Sbjct  509  RPEEGFYIRSGITIIVEKATIEDGTVI  535



>gb|KDO41999.1| hypothetical protein CISIN_1g0097201mg, partial [Citrus sinensis]
Length=446

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 136/147 (93%), Gaps = 3/147 (2%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKIDNC+IKDAIISHGCFLRECTVEHSI+GERSRLD GVELKDT
Sbjct  303  YDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVGERSRLDYGVELKDT  362

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIGVG NTKIRN IIDKNV+IGKDVVI+NKD   E+D
Sbjct  363  VMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKD---EAD  419

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ GFYIRSGITIIMEKATI DG VI
Sbjct  420  RPELGFYIRSGITIIMEKATIEDGMVI  446



>ref|XP_008460955.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
 ref|XP_008460956.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis melo]
Length=526

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLREC+++HSI+GERSRLD GVELKDT
Sbjct  380  YDPKTPFYTSPRFLPPTKIDRCQIVDAIISHGCFLRECSIQHSIVGERSRLDYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TE EI  LLA+G VP+G+G NTKIR  IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  440  IMMGADNYQTELEITGLLAEGKVPVGIGPNTKIRKCIIDKNAKIGKDVIIMNKDGVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITI+MEKATI DGTVI
Sbjct  500  RPEQGFYIRSGITIVMEKATIEDGTVI  526



>gb|KJB32479.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
 gb|KJB32480.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=524

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT
Sbjct  378  YDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+D
Sbjct  438  VMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  498  RPEEGFYIRSGLTIIMEKATIADGTVI  524



>gb|KJB32482.1| hypothetical protein B456_005G244900 [Gossypium raimondii]
Length=521

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT
Sbjct  375  YDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDT  434

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+D
Sbjct  435  VMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEAD  494

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  495  RPEEGFYIRSGLTIIMEKATIADGTVI  521



>gb|KHG23571.1| Glucose-1-phosphate adenylyltransferase large subunit 3, chloroplastic 
-like protein [Gossypium arboreum]
Length=526

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT
Sbjct  380  YDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G VPIG+G N+KIRN IIDKN +IGKDVVI+NKDGV+E+D
Sbjct  440  VMLGADYYQTEPEIASLLAEGKVPIGIGRNSKIRNCIIDKNAKIGKDVVIVNKDGVEEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSG+TIIMEKATI DGTVI
Sbjct  500  RPEEGFYIRSGLTIIMEKATIADGTVI  526



>gb|KCW55368.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=395

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKIDNCK+KDAIISHGCFLREC VE SI+GERSRLD GVELKDT
Sbjct  249  YDPKTPIFTSPRFLPPTKIDNCKLKDAIISHGCFLRECRVERSIVGERSRLDSGVELKDT  308

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKN +IGKDV I+NKDGV+E+D
Sbjct  309  VMMGADYYQTESEIASLLAEGKVPIGIGKNTKIRNCIIDKNAKIGKDVAIVNKDGVEEAD  368

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIR GIT+I+EKATI DGTVI
Sbjct  369  RPGDGFYIRLGITVILEKATIEDGTVI  395



>gb|AAB91467.1| ADP-glucose pyrophosphorylase large subunit 1 [Citrullus lanatus 
subsp. vulgaris]
Length=526

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVELKDT
Sbjct  380  YDPKTPIYTSPRFLPPTKIDKCQIVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIA LLA+G VPIG+G NTKIRN IIDKN +IGKDVVIMNK+GVQE+D
Sbjct  440  IMMGADTYQTEPEIAGLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVVIMNKEGVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITII+EKATI DGTVI
Sbjct  500  RPEQGFYIRSGITIILEKATIEDGTVI  526



>emb|CBI37674.3| unnamed protein product [Vitis vinifera]
Length=517

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            Y+PKTP +TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+GERSRLD GVELKDT
Sbjct  371  YNPKTPIFTSPRFLPPTKIEQCQVVDAIISHGCFLRECSVKHSIVGERSRLDYGVELKDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+GNVPIG+G NTKIRN IIDKN +IGKD VI+NKDGVQE+D
Sbjct  431  LMMGADFYQTESEIASLLAEGNVPIGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVQEAD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPD+GFYIRSGITII+EKATI DGTVI
Sbjct  491  RPDDGFYIRSGITIILEKATIKDGTVI  517



>ref|XP_002283855.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
Length=527

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            Y+PKTP +TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+GERSRLD GVELKDT
Sbjct  381  YNPKTPIFTSPRFLPPTKIEQCQVVDAIISHGCFLRECSVKHSIVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+GNVPIG+G NTKIRN IIDKN +IGKD VI+NKDGVQE+D
Sbjct  441  LMMGADFYQTESEIASLLAEGNVPIGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPD+GFYIRSGITII+EKATI DGTVI
Sbjct  501  RPDDGFYIRSGITIILEKATIKDGTVI  527



>ref|XP_007042146.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
 gb|EOX97977.1| Glucose-1-phosphate adenylyltransferase family protein [Theobroma 
cacao]
Length=526

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC V+HSI+GERSRLD GVEL+DT
Sbjct  380  YDPKTPFYTSPRYLPPTKIDKCQIKDAIISHGCFLRECNVQHSIVGERSRLDYGVELQDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+G VPIG+G NTKIR  IIDKN +IGKDVVI+NKD VQE+D
Sbjct  440  VMLGADYYQTESEIASLLAEGKVPIGIGRNTKIRTCIIDKNAKIGKDVVIVNKDDVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII EKATI DGTVI
Sbjct  500  RPEEGFYIRSGITIIQEKATIEDGTVI  526



>ref|XP_007131817.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
 gb|ESW03811.1| hypothetical protein PHAVU_011G044000g [Phaseolus vulgaris]
Length=528

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSPR LPPTKID C+I DAIISHGCFLREC V+HSI+GERSRLD GVEL+DT
Sbjct  382  YDPKTPIYTSPRLLPPTKIDKCRIVDAIISHGCFLRECIVQHSIVGERSRLDYGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  442  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  502  RPEDGFYIRSGITVILEKATIEDGTVI  528



>ref|XP_011037496.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011037497.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSP FLPPTKID C+I DAIISHGCFLRECTV+HS++GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSVVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE+EIASLLA+G VPIGVG N+KIRN IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  441  VMLGADYYQTEAEIASLLAEGKVPIGVGRNSKIRNCIIDKNAKIGKDVIIMNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R ++GFYIRSGITII+EKATI DGTVI
Sbjct  501  REEKGFYIRSGITIILEKATIEDGTVI  527



>ref|XP_002306116.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86627.2| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=526

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSP FLPPTKID C+I DAIISHGCFLRECTV+HS++GERSRLD GVELKDT
Sbjct  380  YDPKTPFYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSVVGERSRLDYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD+Y+TE+EIASLLA+G VPIGVG NTKIRN IIDKN +IGKDV+I NKDGVQE+D
Sbjct  440  VMLGADHYQTEAEIASLLAEGKVPIGVGRNTKIRNCIIDKNAKIGKDVIITNKDGVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R ++GFYIRSGITII+EKATI DGTVI
Sbjct  500  REEKGFYIRSGITIILEKATIEDGTVI  526



>ref|XP_006581117.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
Length=409

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPK P YTSP FLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVE+ DT
Sbjct  263  YDPKIPIYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEVLDT  322

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+D
Sbjct  323  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEAD  382

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITIIMEKATI DGTVI
Sbjct  383  RPEDGFYIRSGITIIMEKATIEDGTVI  409



>ref|XP_004500804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=518

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC++ DAIISHGCFLRECT++HSI+GERSRLD GVEL++T
Sbjct  372  YDPKTPIFTSPGFLPPTKIDNCRVVDAIISHGCFLRECTIQHSIVGERSRLDYGVELQET  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+D
Sbjct  432  VMMGADNYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEAD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R ++GFYIRSGITIIMEKATI DGTVI
Sbjct  492  RSEDGFYIRSGITIIMEKATIEDGTVI  518



>gb|AES74194.2| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=518

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC++ DAIISHGCFLRECT++HSI+GERSRLD GVEL+DT
Sbjct  372  YDPKTPIFTSPGFLPPTKIDNCRVVDAIISHGCFLRECTIQHSIVGERSRLDYGVELQDT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGKDVVI NKDGVQE+D
Sbjct  432  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKDVVITNKDGVQEAD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR+GITI+MEKATI DGTVI
Sbjct  492  RPEDGFYIRAGITIVMEKATIEDGTVI  518



>ref|XP_010028607.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010028608.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW55367.1| hypothetical protein EUGRSUZ_I01281 [Eucalyptus grandis]
Length=527

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKIDNCK+KDAIISHGCFLREC VE SI+GERSRLD GVELKDT
Sbjct  381  YDPKTPIFTSPRFLPPTKIDNCKLKDAIISHGCFLRECRVERSIVGERSRLDSGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G+NTKIRN IIDKN +IGKDV I+NKDGV+E+D
Sbjct  441  VMMGADYYQTESEIASLLAEGKVPIGIGKNTKIRNCIIDKNAKIGKDVAIVNKDGVEEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIR GIT+I+EKATI DGTVI
Sbjct  501  RPGDGFYIRLGITVILEKATIEDGTVI  527



>ref|XP_007199332.1| hypothetical protein PRUPE_ppa023764mg, partial [Prunus persica]
 gb|EMJ00531.1| hypothetical protein PRUPE_ppa023764mg, partial [Prunus persica]
Length=353

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVELKD 
Sbjct  207  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDA  266

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+G+G NTKIRN IIDKN +IGKD VI+NKDGV+E+D
Sbjct  267  IMMGADYYQTETEIASLLAEGKVPVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVREAD  326

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR GITII+EKATI DG VI
Sbjct  327  RPEEGFYIREGITIILEKATIQDGMVI  353



>ref|XP_009345668.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=517

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD 
Sbjct  371  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDA  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN RIGKDV+I+NKDGVQE+D
Sbjct  431  IMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNARIGKDVMIVNKDGVQEAD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKATI DG +I
Sbjct  491  RPEDGFYIREGITIILEKATIEDGMII  517



>ref|XP_009345666.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345667.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=519

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD 
Sbjct  373  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDA  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN RIGKDV+I+NKDGVQE+D
Sbjct  433  IMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNARIGKDVMIVNKDGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKATI DG +I
Sbjct  493  RPEDGFYIREGITIILEKATIEDGMII  519



>ref|XP_003522921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 ref|XP_006577920.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Glycine max]
 gb|KHN33746.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPK P YTSP FLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVEL DT
Sbjct  373  YDPKIPIYTSPGFLPPTKIDKCQIVDAIISHGCFLRECTVQHSIVGERSRLDYGVELLDT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+D
Sbjct  433  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITIIMEKATI DGT++
Sbjct  493  RPEDGFYIRSGITIIMEKATIEDGTIV  519



>ref|XP_003527197.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Glycine max]
 gb|KHN20061.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Glycine 
soja]
Length=519

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPK P YTSP FLPPTKID C+I DAIISHGCFLRECTV+HSI+GERSRLD GVE+ DT
Sbjct  373  YDPKIPIYTSPGFLPPTKIDKCRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEVLDT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+D
Sbjct  433  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIANKDGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITIIMEKATI DGTVI
Sbjct  493  RPEDGFYIRSGITIIMEKATIEDGTVI  519



>gb|EYU37810.1| hypothetical protein MIMGU_mgv1a004455mg [Erythranthe guttata]
Length=526

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKID+ KIK+AIISHGCFLREC V+HSI+GERSRLD GVELKDT
Sbjct  380  YDPKTPFFTSPRFLPPTKIDSSKIKNAIISHGCFLRECIVDHSIVGERSRLDSGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGV+E+D
Sbjct  440  LMMGADYYQTESEIASLLAQGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDGVEEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGI I+ EKATI DGTVI
Sbjct  500  RPEEGFYIRSGIIIVPEKATINDGTVI  526



>ref|XP_010690849.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK+D C+IKD IIS GCFLREC VEHSI+GERSRLD GVELKDT
Sbjct  378  YDPKTPFYTSPRFLPPTKMDRCQIKDTIISDGCFLRECKVEHSIVGERSRLDSGVELKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y+TESEIASLLA+G VPIG+G NT IRN IIDKN +IGKDV+I NKDGV E+D
Sbjct  438  LMMGADYYQTESEIASLLAEGKVPIGIGRNTIIRNCIIDKNAKIGKDVIITNKDGVIEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+I+EKATI DGTVI
Sbjct  498  RPEQGFYIRSGITVIVEKATIEDGTVI  524



>ref|XP_004148834.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 ref|XP_004172290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cucumis sativus]
 gb|KGN61813.1| hypothetical protein Csa_2G248700 [Cucumis sativus]
Length=526

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLR+C+V+HSI+GERSRLD GVELKDT
Sbjct  380  YDPKTPFYTSPRFLPPTKIDRCQIVDAIISHGCFLRDCSVQHSIVGERSRLDYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TE EI  LLA+G VP+G+G N+KI+  IIDKN +IGKDV+IMNKDGVQE+ 
Sbjct  440  IMMGADNYQTELEITGLLAEGKVPVGIGRNSKIKKCIIDKNAKIGKDVIIMNKDGVQEAA  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITIIMEKAT+ DGTVI
Sbjct  500  RPEQGFYIRSGITIIMEKATVGDGTVI  526



>ref|XP_002313036.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
 gb|EEE86991.1| ADP-glucose pyrophosphorylase large subunit family protein [Populus 
trichocarpa]
Length=527

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRF PPTK D C+I +AIISHGCFLRECTV+HS++GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSPRFSPPTKFDKCRIVNAIISHGCFLRECTVQHSVVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G VPIGVG NTKIRN IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  441  VMLGADCYQTEVEIASLLAEGEVPIGVGRNTKIRNCIIDKNAKIGKDVIIMNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EGFYIRSGITII EKATI DGTVI
Sbjct  501  REEEGFYIRSGITIISEKATIEDGTVI  527



>gb|KJB79161.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79162.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
 gb|KJB79163.1| hypothetical protein B456_013G035800 [Gossypium raimondii]
Length=528

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HS+IGERSRLD GVEL+DT
Sbjct  382  YDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSVIGERSRLDSGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EI SLLA+G VPIG+G NTKI N IIDKN +IG+DV+I NKDGVQE+D
Sbjct  442  VMMGADYYQTELEIISLLAEGKVPIGIGHNTKISNCIIDKNAKIGRDVIIANKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R DEGFYIRSGITII++KATI DGT+I
Sbjct  502  RSDEGFYIRSGITIILDKATIKDGTII  528



>gb|AHM92232.1| AGPase large subunit protein [Hevea brasiliensis]
Length=527

 Score =   253 bits (647),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTKID C+I DAIISHGCFLRECT++HS++GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSPRFLPPTKIDKCRIVDAIISHGCFLRECTIQHSVVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE+EIASLLA+G VPIGVG +TKI+  IIDKN ++GK+VVI NKDGVQE+D
Sbjct  441  VMLGADCYQTEAEIASLLAEGEVPIGVGRDTKIKKCIIDKNAKMGKNVVITNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII EKATI DGTVI
Sbjct  501  RPEEGFYIRSGITIISEKATIEDGTVI  527



>gb|KHF99865.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
 gb|KHG27467.1| Glucose-1-phosphate adenylyltransferase large subunit 1 [Gossypium 
arboreum]
Length=528

 Score =   253 bits (646),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR+LPPTKID C+IKDAIISHGCFLREC+V+HS+IGERSRLD GVEL+DT
Sbjct  382  YDPKTPFYTSPRYLPPTKIDKCRIKDAIISHGCFLRECSVQHSVIGERSRLDSGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EI SLLA+G VPIG+G NTKI N IIDKN +IG+DV+I NKDGVQE+D
Sbjct  442  VMMGADYYQTELEIISLLAEGKVPIGIGHNTKISNCIIDKNAKIGRDVIIANKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R DEGFYIRSGIT+I++KATI DGT+I
Sbjct  502  RSDEGFYIRSGITVILDKATIKDGTII  528



>ref|XP_011048155.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=540

 Score =   253 bits (647),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRF PPTK D C+I +AIISHGCFLRECTVEHS++GERSRLD GVELKDT
Sbjct  394  YDPKTPFYTSPRFSPPTKFDKCRIVNAIISHGCFLRECTVEHSVVGERSRLDYGVELKDT  453

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G VPIGVG NTKIRN IIDKN +IGK+V+IMNKDGVQE+D
Sbjct  454  VMLGADCYQTEVEIASLLAEGEVPIGVGRNTKIRNCIIDKNAKIGKNVIIMNKDGVQEAD  513

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EGFYIRSGITII EKATI DGTVI
Sbjct  514  REEEGFYIRSGITIISEKATIEDGTVI  540



>ref|XP_003606943.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula]
 gb|AES89140.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=528

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVEL+DT
Sbjct  382  YDPKTPIFTSPGFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIAS LA+G VPIG+G N+K+R  IIDKN RIGKDV+IMNKDGVQE+D
Sbjct  442  VMMGADYYQTESEIASELAEGKVPIGIGSNSKVRKCIIDKNARIGKDVIIMNKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITI+MEKATI DGTVI
Sbjct  502  RPEDGFYIRSGITIVMEKATIEDGTVI  528



>ref|XP_008385901.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD 
Sbjct  371  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDA  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN +IGKDV+I+NK+GVQE+D
Sbjct  431  IMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNAKIGKDVMIVNKEGVQEAD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKATI DG +I
Sbjct  491  RPEDGFYIREGITIILEKATIEDGMII  517



>ref|XP_011015433.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015434.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011015435.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=527

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRF PPTK D C+I +AIISHGCFLRECTVEHS++GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSPRFSPPTKFDKCRIVNAIISHGCFLRECTVEHSVVGERSRLDYGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE EIASLLA+G +PIGVG NTKIRN IIDKN +IG DV+IMNKDGVQE+D
Sbjct  441  VMLGADCYQTEVEIASLLAEGEIPIGVGRNTKIRNCIIDKNAKIGNDVIIMNKDGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EGFYIRSGITII EKATI DGTVI
Sbjct  501  REEEGFYIRSGITIISEKATIEDGTVI  527



>gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large subunit [Perilla frutescens]
Length=527

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTS RFLPPTKIDNCKIKDAIISHGCFLREC  +HSI+GERSRLD GVELKDT
Sbjct  381  YDPKTPFYTSLRFLPPTKIDNCKIKDAIISHGCFLRECVCQHSILGERSRLDSGVELKDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD Y TESEIASLL  G VP+G+G NTKI N IIDKN RIGKDV+I NKDGV+E+D
Sbjct  441  LMMGADYYPTESEIASLLVQGKVPMGIGRNTKISNCIIDKNARIGKDVIIKNKDGVEEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EGFYIRSGITI++EKATI DGT+I
Sbjct  501  RSEEGFYIRSGITIVVEKATINDGTII  527



>ref|XP_008385898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385899.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
 ref|XP_008385900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFL+EC+V+HSI+GERSRL+ GVELKD 
Sbjct  373  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLQECSVQHSIVGERSRLNYGVELKDA  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNY+TESEIASLLADG VPIG+G NTKIRN IIDKN +IGKDV+I+NK+GVQE+D
Sbjct  433  IMMGADNYQTESEIASLLADGEVPIGIGSNTKIRNCIIDKNAKIGKDVMIVNKEGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKATI DG +I
Sbjct  493  RPEDGFYIREGITIILEKATIEDGMII  519



>ref|XP_008800701.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Phoenix dactylifera]
Length=525

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+G RSRLD G ELKDT
Sbjct  379  YDPKTPFFTSPRFLPPTKIEKCRVLDAIISHGCFLRECSVQHSIVGVRSRLDYGAELKDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGADNYETE+EIASLLA+G VPIGVG NTKI N IID NVRIGK++VI NKDGVQE+D
Sbjct  439  VMMGADNYETEAEIASLLAEGKVPIGVGRNTKISNCIIDMNVRIGKNIVIANKDGVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGITII++ ATI DGT+I
Sbjct  499  RPHEGFYIRSGITIILKNATIKDGTII  525



>gb|AGV54292.1| ADP-glucose pyrophosphorylase large subunit [Phaseolus vulgaris]
Length=525

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+GERSRLD GVE++DT
Sbjct  379  YDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEIQDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKDGVQE+D
Sbjct  439  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDGVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITII EKATI DGTVI
Sbjct  499  RPEDGFYIRSGITIIAEKATIEDGTVI  525



>ref|XP_007201161.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
 gb|EMJ02360.1| hypothetical protein PRUPE_ppa004192mg [Prunus persica]
Length=524

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVELKD 
Sbjct  378  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDA  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+G+G NTKIRN IIDKN +IGKD VI+NKDGV+E+D
Sbjct  438  IMMGADYYQTETEIASLLAEGKVPVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVREAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR GITII+EKATI DG VI
Sbjct  498  RPEEGFYIREGITIILEKATIQDGMVI  524



>ref|XP_008236919.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Prunus mume]
Length=524

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKID C+I DAIISHGCFLREC+V+HSI+GERSRLD GVELKD 
Sbjct  378  YDPKTPIFTSPRFLPPTKIDKCRIVDAIISHGCFLRECSVQHSIVGERSRLDYGVELKDA  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+G+G NTKIRN IIDKN +IGKD VI+NKDGV+E+D
Sbjct  438  IMMGADYYQTETEIASLLAEGKVPVGIGRNTKIRNCIIDKNAKIGKDAVIVNKDGVREAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR GITII+EKATI DG VI
Sbjct  498  RPEEGFYIREGITIILEKATIQDGMVI  524



>ref|XP_010060971.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 ref|XP_010060972.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
 gb|KCW67874.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
 gb|KCW67875.1| hypothetical protein EUGRSUZ_F01590 [Eucalyptus grandis]
Length=524

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TPFYTSPRFLPP+K+D C+I DAIISHGCFL+EC++EHSI+G RSRLD GVE KDT
Sbjct  378  YDPQTPFYTSPRFLPPSKVDKCRIVDAIISHGCFLQECSIEHSIVGVRSRLDYGVEFKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA G VPIGVG+NTKIRN IIDKN RIGK+VVI N DGVQE+D
Sbjct  438  MMMGADYYQTEAEIASLLAQGKVPIGVGQNTKIRNCIIDKNARIGKNVVIHNTDGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I++ ATI DGTV+
Sbjct  498  RPEEGFYIRSGITVILKNATIKDGTVV  524



>ref|XP_003603943.1| Glucose-1-phosphate adenylyltransferase large subunit [Medicago 
truncatula]
Length=526

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 137/155 (88%), Gaps = 8/155 (5%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIK--------DAIISHGCFLRECTVEHSIIGERSRLD  591
            YDPKTP +TSP FLPPTKIDNC+++        DAIISHGCFLRECT++HSI+GERSRLD
Sbjct  372  YDPKTPIFTSPGFLPPTKIDNCRVRQSIHLVVVDAIISHGCFLRECTIQHSIVGERSRLD  431

Query  590  CGVELKDTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMN  411
             GVEL+DT+MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGKDVVI N
Sbjct  432  YGVELQDTVMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKDVVITN  491

Query  410  KDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  306
            KDGVQE+DRP++GFYIR+GITI+MEKATI DGTVI
Sbjct  492  KDGVQEADRPEDGFYIRAGITIVMEKATIEDGTVI  526



>ref|XP_004507462.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Cicer arietinum]
Length=528

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSPRFLPPTKIDNC+I DAIISHGCFLREC+V HSI+GERSRLD GVEL+DT
Sbjct  382  YDPKTPIFTSPRFLPPTKIDNCRIVDAIISHGCFLRECSVHHSIVGERSRLDYGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIAS +A+G VPI +G NTKIR  IIDKN RIGKDV+IMNKDGV+E+D
Sbjct  442  IMMGADYYQTEPEIASQVAEGKVPIRIGRNTKIRKCIIDKNARIGKDVIIMNKDGVEEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R D+GFYIRSGITIIMEKATI DGTVI
Sbjct  502  REDDGFYIRSGITIIMEKATIEDGTVI  528



>ref|XP_007136621.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08615.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=310

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  164  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  223

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  224  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  283

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  284  RAKEGFYIRSGITITLKNATIKDGTVI  310



>ref|XP_011007450.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Populus euphratica]
Length=528

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT
Sbjct  382  YDPQTPFFTSPRFLPPTKVDRCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN RIGKDV+I N DGVQE+D
Sbjct  442  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNARIGKDVIITNADGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT +++ ATI DGT+I
Sbjct  502  RPAEGFYIRSGITAVLKNATIKDGTLI  528



>ref|XP_007136623.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08617.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=337

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  191  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  250

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  251  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  310

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  311  RAKEGFYIRSGITITLKNATIKDGTVI  337



>ref|XP_011028874.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Populus euphratica]
Length=528

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT
Sbjct  382  YDPKTPFFTSPRFLPPTKVDKCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IGKDV+I N DGVQE D
Sbjct  442  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKDVIITNADGVQEGD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT +++ ATI DGT+I
Sbjct  502  RPSEGFYIRSGITAVLKNATIKDGTII  528



>ref|XP_010254773.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I +AIISHGCFLREC+V+HSI+G RSRL+ G ELKDT
Sbjct  382  YDPKTPFFTSPRFLPPTKVDKCRIVNAIISHGCFLRECSVQHSIVGVRSRLEYGCELKDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DV+I NKDGVQE+D
Sbjct  442  MMMGADYYHTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVIIANKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPD+GFYIRSGI +I++ ATI DGTVI
Sbjct  502  RPDDGFYIRSGIIVILKNATIKDGTVI  528



>ref|NP_001289786.1| glucose-1-phosphate adenylyltransferase large subunit 1-like 
[Nelumbo nucifera]
 gb|AHZ08829.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
 gb|AHZ08830.1| ADP-glucose pyrophosphorylase large subunit [Nelumbo nucifera]
Length=528

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I +AIISHGCFLREC+V+HSI+G RSRL+ G ELKDT
Sbjct  382  YDPKTPFFTSPRFLPPTKVDKCRIVNAIISHGCFLRECSVQHSIVGVRSRLEYGCELKDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DV+I NKDGVQE+D
Sbjct  442  MMMGADYYHTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVIIANKDGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPD+GFYIRSGI +I++ ATI DGTVI
Sbjct  502  RPDDGFYIRSGIIVILKNATIKDGTVI  528



>ref|XP_007136619.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08613.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=338

 Score =   243 bits (620),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  192  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  251

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  252  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  311

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  312  RAKEGFYIRSGITITLKNATIKDGTVI  338



>ref|XP_007136159.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 ref|XP_007136160.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08153.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
 gb|ESW08154.1| hypothetical protein PHAVU_009G023100g [Phaseolus vulgaris]
Length=525

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+GERSRLD GVE++DT
Sbjct  379  YDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEIQDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKD VQE+D
Sbjct  439  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDDVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITII EKATI DGTVI
Sbjct  499  RPEDGFYIRSGITIIAEKATIEDGTVI  525



>dbj|BAC66692.1| ADP-glucose pyrophosphorylase large subunit PvAGPL1 [Phaseolus 
vulgaris]
Length=525

 Score =   248 bits (634),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP YTSP FLPPTKID  +I DAIISHGCFLRECTV+HSI+GERSRLD GVE++DT
Sbjct  379  YDPKTPIYTSPGFLPPTKIDKSRIVDAIISHGCFLRECTVQHSIVGERSRLDYGVEIQDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKIRN IIDKN +IGKDV+I NKD VQE+D
Sbjct  439  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIRNCIIDKNAKIGKDVIIKNKDDVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITII EKATI DGTVI
Sbjct  499  RPEDGFYIRSGITIIAEKATIEDGTVI  525



>ref|XP_007136620.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08614.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=369

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  223  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  282

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  283  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  342

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  343  RAKEGFYIRSGITITLKNATIKDGTVI  369



>ref|XP_002300758.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
 gb|EEE80031.1| ADP-glucose pyrophosphorylase large subunit 2 family protein 
[Populus trichocarpa]
Length=528

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT
Sbjct  382  YDPKTPFFTSPRFLPPTKVDKCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIAS+LA+G VPIGVG+NTKIRN IIDKN +IGKDV+I N DGVQE+D
Sbjct  442  MMMGADYYQTESEIASVLAEGKVPIGVGQNTKIRNCIIDKNAKIGKDVIITNADGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT +++ ATI DGT+I
Sbjct  502  RPSEGFYIRSGITAVLKNATIKDGTII  528



>ref|XP_007136618.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08612.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=365

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  219  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  278

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  279  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  338

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  339  RAKEGFYIRSGITITLKNATIKDGTVI  365



>ref|XP_007136622.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=396

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  250  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  309

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  310  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  369

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  370  RAKEGFYIRSGITITLKNATIKDGTVI  396



>gb|AAB91468.1| ADP-glucose pyrophosphorylase large subunit 2 [Citrullus lanatus 
subsp. vulgaris]
Length=481

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPP+K++ C+I DAIISHGCFLREC+VEHSI+G RSRL+ GVELKDT
Sbjct  335  YDPKTPFYTSPRFLPPSKVEKCRIVDAIISHGCFLRECSVEHSIVGVRSRLEYGVELKDT  394

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN RIG++VVI N D VQE+D
Sbjct  395  MMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNARIGRNVVIANSDDVQEAD  454

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+ ++ ATI DGT+I
Sbjct  455  RPEDGFYIRSGITVTLKNATIKDGTII  481



>ref|XP_010531437.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
 ref|XP_010531439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic [Tarenaya hassleriana]
Length=526

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPP+KI+ C+I D+IISHGCFLREC+V+ SI+GERSRLD GV+L+DT
Sbjct  380  YDPDTPFYTSPRFLPPSKIEMCRIVDSIISHGCFLRECSVQRSIVGERSRLDYGVDLQDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TESEIASLLA+GNVPIG+G NTKIR  IIDKN +IGKDV+I+NKD VQE+D
Sbjct  440  VMLGADYYQTESEIASLLAEGNVPIGIGRNTKIRKCIIDKNAKIGKDVMIVNKDDVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGIT+I+EKATI DGTVI
Sbjct  500  RPDEGFYIRSGITVIVEKATIEDGTVI  526



>ref|XP_002281223.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 ref|XP_010664711.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Vitis vinifera]
 emb|CBI19730.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+ SI+G RSRL+ GVELKDT
Sbjct  378  YDPKTPFYTSPRFLPPTKVEECRILDAIISHGCFLRECSVQRSIVGVRSRLEYGVELKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NT+IRN IIDKN +IG+DVVI N DGVQE+D
Sbjct  438  MMMGADYYQTESEIASLLAEGKVPIGVGQNTRIRNCIIDKNAKIGRDVVIANADGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT+I++ ATI DGT+I
Sbjct  498  RPSEGFYIRSGITVILKNATINDGTII  524



>emb|CDP07489.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+VEHSI+G RSRLD GVEL DT+
Sbjct  385  DPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVEHSIVGVRSRLDYGVELMDTM  444

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DVVI N DGV+E+DR
Sbjct  445  MMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNTKIGRDVVITNADGVEEADR  504

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
            P+EGFYIRSGI +I++ ATI DGTVI
Sbjct  505  PEEGFYIRSGIIVILKNATIKDGTVI  530



>ref|XP_006435035.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
 gb|ESR48275.1| hypothetical protein CICLE_v10000842mg [Citrus clementina]
Length=526

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTS RFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE +DT
Sbjct  380  YDPKTPFYTSARFLPPTKVDRCKIVDAIISHGCFLRECSVQHSIVGVRSRLESGVEFQDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKI+N IIDKN +IGK+V+I N +GVQE+D
Sbjct  440  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIKNCIIDKNAKIGKNVIIANAEGVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I++ ATI DGTVI
Sbjct  500  RPNEGFYIRSGITVILKNATINDGTVI  526



>ref|XP_006473534.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Citrus sinensis]
Length=526

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTS RFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVE +DT
Sbjct  380  YDPKTPFYTSARFLPPTKVDRCKIVDAIISHGCFLRECSVQHSIVGVRSRLESGVEFQDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKI+N IIDKN +IGK+V+I N +GVQE+D
Sbjct  440  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIKNCIIDKNAKIGKNVIIANAEGVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I++ ATI DGTVI
Sbjct  500  RPNEGFYIRSGITVILKNATINDGTVI  526



>emb|CAA65541.1| ADP-glucose pyrophosphorylase [Pisum sativum]
Length=510

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDN ++ DAIISHGCFLR+CT++HSI+GERSRLD GVEL+DT
Sbjct  364  YDPKTPIFTSPGFLPPTKIDNSRVVDAIISHGCFLRDCTIQHSIVGERSRLDYGVELQDT  423

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGK+VVI NK+GVQE+D
Sbjct  424  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKEVVIANKEGVQEAD  483

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R ++GFYIRSGITIIMEKATI DGTVI
Sbjct  484  RSEDGFYIRSGITIIMEKATIEDGTVI  510



>ref|XP_008466540.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 [Cucumis melo]
 gb|ADN34184.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo subsp. 
melo]
Length=533

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPP+K++ C+I DAIISHGCFLRECTVEHSI+G RSRL+ GVELKDT
Sbjct  387  YDPKTPFYTSPRFLPPSKVEKCRIVDAIISHGCFLRECTVEHSIVGVRSRLEYGVELKDT  446

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D VQE+D
Sbjct  447  MMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEAD  506

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  507  RPEEGFYIRSGITVTLKNATIKDGTII  533



>gb|EPS74142.1| glucose-1-phosphate adenylyltransferase [Genlisea aurea]
Length=543

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 135/169 (80%), Gaps = 22/169 (13%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELK--  573
            YDPKTPFYTSPRFLPPTKIDN KIKDAIISHGCFLREC VEHSIIGERSRLD GVELK  
Sbjct  375  YDPKTPFYTSPRFLPPTKIDNSKIKDAIISHGCFLRECIVEHSIIGERSRLDIGVELKAC  434

Query  572  --------------------DTLMMGADNYETESEIASLLADGNVPIGVGENTKIRNAII  453
                                DTLMMGAD+Y+TESEIASLLA G VP+G+G ++KIRN II
Sbjct  435  LYTHTRMDVYVYEFAIIFSQDTLMMGADSYQTESEIASLLAQGKVPVGIGRDSKIRNCII  494

Query  452  DKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  306
            DKN RIGK+V+I NKDGV+E+DRP+EGFYIR GITII EKATI DGTVI
Sbjct  495  DKNARIGKNVIIENKDGVEEADRPEEGFYIRGGITIISEKATINDGTVI  543



>ref|XP_002307668.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
 gb|EEE94664.2| hypothetical protein POPTR_0005s25130g [Populus trichocarpa]
Length=528

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT
Sbjct  382  YDPQTPFFTSPRFLPPTKVDRCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IGKDV+I N DGVQE+D
Sbjct  442  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKDVIITNADGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT +++ A I DGT+I
Sbjct  502  RPSEGFYIRSGITAVLKNAAIKDGTLI  528



>ref|XP_004147856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Cucumis sativus]
 gb|KGN59984.1| hypothetical protein Csa_3G859710 [Cucumis sativus]
Length=532

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPP+K++ CKI DAIISHGCFLRECTVEHSI+G RSRL+ GVELKDT
Sbjct  386  YDPKTPFYTSPRFLPPSKVEKCKIVDAIISHGCFLRECTVEHSIVGVRSRLEYGVELKDT  445

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D VQE++
Sbjct  446  MMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEAE  505

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  506  RPEEGFYIRSGITVTLKNATIKDGTII  532



>ref|XP_004154849.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic/amyloplastic-like [Cucumis 
sativus]
Length=532

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPP+K++ CKI DAIISHGCFLRECTVEHSI+G RSRL+ GVELKDT
Sbjct  386  YDPKTPFYTSPRFLPPSKVEKCKIVDAIISHGCFLRECTVEHSIVGVRSRLEYGVELKDT  445

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D VQE++
Sbjct  446  MMMGADYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEAE  505

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  506  RPEEGFYIRSGITVTLKNATIKDGTII  532



>dbj|BAF47748.1| ADP-glucose pyrophosphorylase beta subunit IbAGPb2 [Ipomoea batatas]
Length=518

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRLD GVEL+DT+
Sbjct  373  DPKTPFYTSPRFLPPTKVDKCKIVDAIISHGCFLRECSVKHSIVGIRSRLDYGVELEDTM  432

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            +MGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN RIGKDVVI NKDGV E+DR
Sbjct  433  VMGADYYQTESEIASLLATGKVPIGIGTNTKIRNCIIDKNARIGKDVVIANKDGVDEADR  492

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGITI+++ ATI DGTVI
Sbjct  493  ADEGFYIRSGITIVLKNATIRDGTVI  518



>gb|AFL55398.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=518

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G RSRLD GVEL+DT+
Sbjct  373  DPKTPFYTSPRFLPPTKVDKCKIVDAIISHGCFLRECSVKHSIVGIRSRLDYGVELEDTM  432

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            +MGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN RIGKDVVI NKDGV E+DR
Sbjct  433  VMGADYYQTESEIASLLATGKVPIGIGTNTKIRNCIIDKNARIGKDVVIANKDGVDEADR  492

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGITI+++ ATI DGTVI
Sbjct  493  ADEGFYIRSGITIVLKNATIRDGTVI  518



>ref|XP_007017590.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
 gb|EOY14815.1| ADPGLC-PPase large subunit isoform 1 [Theobroma cacao]
Length=526

 Score =   246 bits (628),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK+D C+I DAI+SHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  380  YDPKTPFYTSPRFLPPTKVDKCRIVDAIVSHGCFLRECSVQHSIVGVRSRLESGVELEDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE E+ASLLA+G VPIGVG NTKIRN IIDKN +IGKDV+I N   VQE+D
Sbjct  440  MMMGADYYQTEYEVASLLAEGKVPIGVGHNTKIRNCIIDKNAKIGKDVIISNSGAVQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPD+GFYIRSGIT+I++ ATI DGTVI
Sbjct  500  RPDDGFYIRSGITVILKNATIKDGTVI  526



>ref|XP_009378639.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378640.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378642.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009378643.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X3 [Pyrus x bretschneideri]
Length=519

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD+
Sbjct  373  YDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDS  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLADG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+D
Sbjct  433  IMMGADYYQTESEIASLLADGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKAT+ DG VI
Sbjct  493  RPEDGFYIREGITIILEKATVQDGMVI  519



>ref|XP_009378637.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Pyrus x bretschneideri]
Length=525

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD+
Sbjct  379  YDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDS  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLADG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+D
Sbjct  439  IMMGADYYQTESEIASLLADGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKAT+ DG VI
Sbjct  499  RPEDGFYIREGITIILEKATVQDGMVI  525



>emb|CDY41275.1| BnaA01g12640D [Brassica napus]
Length=322

 Score =   239 bits (611),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  176  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDT  235

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VPIGVGENTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  236  MMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGD  295

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG YIRSGIT++++ ATI DG V+
Sbjct  296  RPEEGVYIRSGITVVLKNATIRDGLVL  322



>ref|XP_009378638.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Pyrus x bretschneideri]
Length=523

 Score =   245 bits (626),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD+
Sbjct  377  YDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDS  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLADG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+D
Sbjct  437  IMMGADYYQTESEIASLLADGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GITII+EKAT+ DG VI
Sbjct  497  RPEDGFYIREGITIILEKATVQDGMVI  523



>gb|KEH36175.1| glucose-1-phosphate adenylyltransferase family protein [Medicago 
truncatula]
Length=530

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  384  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFLRECSVQHSIVGIRSRLESGVELQDT  443

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VP+GVGENTKIRN IIDKN +IG++ +I N DGV+E+D
Sbjct  444  MMMGADYYQTESEIASLLAEGKVPVGVGENTKIRNCIIDKNAKIGRNAIITNADGVEEAD  503

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGIT+I++ ATI DGTVI
Sbjct  504  RTKEGFYIRSGITVILKNATIQDGTVI  530



>ref|XP_009617843.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
 ref|XP_009617844.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana tomentosiformis]
Length=529

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK+D  +I DAIISHGCF+REC+++HSI+G RSRLD GVELKDT+
Sbjct  384  DPKTPFYTSPRFLPPTKVDKSRIVDAIISHGCFMRECSIQHSIVGVRSRLDYGVELKDTM  443

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+T+SEIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NK+GV+E++R
Sbjct  444  MMGADYYQTDSEIASLLAEGKVPIGVGPNTKIQNCIIDKNAKIGKDVVIVNKEGVEEAER  503

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
            P+EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  504  PEEGFYIRSGITVIMKNATIKDGTVI  529



>ref|XP_007136616.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
 gb|ESW08610.1| hypothetical protein PHAVU_009G059800g [Phaseolus vulgaris]
Length=528

 Score =   244 bits (623),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCF+R C+V+HSI+G RSRL+ GVEL+DT
Sbjct  382  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFMRNCSVQHSIVGVRSRLESGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVGENTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  442  MMMGADYYQTESEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVIIANADGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  502  RAKEGFYIRSGITITLKNATIKDGTVI  528



>ref|NP_179753.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 ref|NP_001031391.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 sp|Q9SIK1.1|GLGL4_ARATH RecName: Full=Probable glucose-1-phosphate adenylyltransferase 
large subunit, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl 
transferase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD23646.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAL49924.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 gb|AAM20291.1| putative ADP-glucose pyrophosphorylase large subunit [Arabidopsis 
thaliana]
 dbj|BAH19825.1| AT2G21590 [Arabidopsis thaliana]
 gb|AEC07199.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
 gb|AEC07200.1| glucose-1-phosphate adenylyltransferase large subunit [Arabidopsis 
thaliana]
Length=523

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  377  YDPETPFYTSPRFLPPTKAEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  437  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  497  RPEEGFYIRSGITVIVEKATIQDGTVI  523



>ref|XP_010472156.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  382  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+VVIMNK  VQE+D
Sbjct  442  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVVIMNKGDVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  502  RPEEGFYIRSGITVIVEKATIQDGTVI  528



>ref|XP_010472157.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  378  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+VVIMNK  VQE+D
Sbjct  438  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVVIMNKGDVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  498  RPEEGFYIRSGITVIVEKATIQDGTVI  524



>ref|XP_008388042.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Malus domestica]
Length=512

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+
Sbjct  367  DPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTM  426

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA G VP+GVGENTKI N IIDKN +IG++VVI N DGVQE++R
Sbjct  427  MMGADYYQTESEIASLLAQGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVQEAER  486

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGIT++++ ATI DGTVI
Sbjct  487  ADEGFYIRSGITVVLKNATIKDGTVI  512



>ref|XP_009759775.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759780.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759785.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
 ref|XP_009759792.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic [Nicotiana sylvestris]
Length=529

 Score =   244 bits (622),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK+D  +I DAIISHGCF+REC+++HSI+G RSRLD GVELKDT+
Sbjct  384  DPKTPFYTSPRFLPPTKVDKSRIVDAIISHGCFMRECSIQHSIVGVRSRLDYGVELKDTM  443

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+T+SEIASLLA+G VPIGVG NTKIRN IIDKN +IGKDVVI NK+G++E++R
Sbjct  444  MMGADYYQTDSEIASLLAEGKVPIGVGPNTKIRNCIIDKNAKIGKDVVIGNKEGIEEAER  503

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
            P+EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  504  PEEGFYIRSGITVIMKNATIKDGTVI  529



>ref|XP_006878500.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
 gb|ERM94645.1| hypothetical protein AMTR_s00011p00201790 [Amborella trichopoda]
Length=520

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  374  YDPMTPFFTSPRFLPPTKIEKCRILDAIISHGCFLRECSVQHSIVGVRSRLETGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIA+LLA+G VP+GVG+NTKIRN IIDKN +IGK+VVI N DGVQE+D
Sbjct  434  MMMGADYYQTEAEIAALLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVVIANTDGVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT+I++ +TI DG VI
Sbjct  494  RPSEGFYIRSGITVILKNSTIKDGMVI  520



>ref|XP_009113743.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X2 [Brassica rapa]
 emb|CDY27626.1| BnaA09g27810D [Brassica napus]
Length=517

 Score =   243 bits (620),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  371  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VPIGVGENTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  431  MMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT++++ ATI DG V+
Sbjct  491  RPEEGFYIRSGITVVLKNATIRDGLVL  517



>gb|KJB58232.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58233.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
 gb|KJB58234.1| hypothetical protein B456_009G200400 [Gossypium raimondii]
Length=526

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK+D CKI D+IISHGCFLREC+V+HSI+G RSRL+  V+L+DT
Sbjct  380  YDPKTPFYTSPRFLPPTKVDECKIVDSIISHGCFLRECSVQHSIVGVRSRLESSVDLQDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKI+N IIDKN +IGKDV+I N D V+E++
Sbjct  440  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIKNCIIDKNAKIGKDVIISNTDAVEEAE  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+IM+ ATI DGTVI
Sbjct  500  RPEDGFYIRSGITVIMKNATIRDGTVI  526



>ref|XP_011083898.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like, partial [Sesamum indicum]
Length=510

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRLD GVELKDT+
Sbjct  365  DPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVQHSIVGVRSRLDYGVELKDTM  424

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI N IIDKN +IGKDV+I NKD V+E+DR
Sbjct  425  MMGADYYQTESEIASLLAEGKVPIGVGHNTKISNCIIDKNAKIGKDVIIANKDCVEEADR  484

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGIT+I++ +TI DGT+I
Sbjct  485  ADEGFYIRSGITVILKNSTIKDGTII  510



>ref|XP_010263606.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Nelumbo nucifera]
Length=528

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKT F+TSPRFLPPTK+D C+I +AIISHGCFLREC+V+HS++G RSRL+ GVEL DT
Sbjct  382  YDPKTLFFTSPRFLPPTKVDKCRIVNAIISHGCFLRECSVQHSVVGVRSRLEYGVELMDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DVVI NKD VQE+D
Sbjct  442  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVVIENKDNVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEGFYIRSGI +I++ ATI DGT+I
Sbjct  502  RPDEGFYIRSGIVVILKNATIKDGTII  528



>gb|EYU45186.1| hypothetical protein MIMGU_mgv1a004400mg [Erythranthe guttata]
Length=529

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+VEHSI+G RSRLD GVELKDT+
Sbjct  384  DPKTPFYTSPRFLPPTKVEQCRIVDAIISHGCFLRECSVEHSIVGVRSRLDYGVELKDTM  443

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA G VPIGVG N+KI N IIDKN +IGK+V+I NKDGV+E++R
Sbjct  444  MMGADYYQTESEIASLLAQGKVPIGVGHNSKISNCIIDKNAKIGKNVIIANKDGVEEAER  503

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGIT+I++ +TI DGT+I
Sbjct  504  ADEGFYIRSGITVILKNSTIKDGTII  529



>ref|XP_010429080.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
 ref|XP_010429081.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Camelina sativa]
Length=525

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  379  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  439  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  499  RPEEGFYIRSGITVIVEKATIQDGTVI  525



>ref|XP_006294016.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
 gb|EOA26914.1| hypothetical protein CARUB_v10023004mg [Capsella rubella]
Length=523

 Score =   243 bits (620),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  377  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  437  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  497  RPEEGFYIRSGITVIVEKATIEDGTVI  523



>ref|XP_010416915.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X1 [Camelina sativa]
Length=528

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  382  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  442  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  502  RPEEGFYIRSGITVIVEKATIQDGTVI  528



>ref|XP_011074558.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
 ref|XP_011074559.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Sesamum indicum]
Length=529

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRLD GVELKDT+
Sbjct  384  DPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVQHSIVGVRSRLDYGVELKDTM  443

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI N IIDKN +IGKDVVI NKDGV+E++R
Sbjct  444  MMGADYYQTESEIASLLAEGKVPIGVGRNTKISNCIIDKNAKIGKDVVIANKDGVEEAER  503

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGI ++++  TI DGTVI
Sbjct  504  ADEGFYIRSGIVVLLKNTTIKDGTVI  529



>ref|XP_010416916.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010416917.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic isoform X2 [Camelina sativa]
Length=524

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+V+ SIIGERSRLD GVEL+DT
Sbjct  378  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFLRECSVQRSIIGERSRLDYGVELQDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  438  LMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  498  RPEEGFYIRSGITVIVEKATIQDGTVI  524



>gb|AJG44463.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=518

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ C+I +AIISHGCFLREC ++ SI+G RSRLD G EL+DT
Sbjct  372  YDPKTPFFTSPRFLPPTKVEKCRILNAIISHGCFLRECGIQRSIVGVRSRLDYGAELEDT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGADNYETE+EIASLLA+G VPIGVGENTKIRN IID N RIGK+VVI+NKDGVQE+D
Sbjct  432  LMMGADNYETEAEIASLLAEGKVPIGVGENTKIRNCIIDMNARIGKNVVILNKDGVQEAD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGI ++++ ATI D T+I
Sbjct  492  RPEDGFYIRSGIAVVLKNATIRDETII  518



>emb|CDX99581.1| BnaC04g33380D [Brassica napus]
Length=525

 Score =   243 bits (620),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVEL+DT
Sbjct  379  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVELQDT  438

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G++TKIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  439  LMLGADYYQTESEIASLLAEGKVPIGIGQDTKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  498

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  499  RPEEGFYIRSGITVVVEKATIQDGTVI  525



>ref|XP_009365525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365526.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
 ref|XP_009365527.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+
Sbjct  367  DPKTPFYTSPRFLPPTKVEECRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTM  426

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA G VPIGVGENTKI N IIDKN +IG++VVI N DGV+E++R
Sbjct  427  MMGADYYQTESEIASLLAQGKVPIGVGENTKIWNCIIDKNAKIGRNVVISNGDGVEEAER  486

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGIT++++ ATI DGTVI
Sbjct  487  ADEGFYIRSGITVVLKNATIKDGTVI  512



>ref|XP_003523570.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like isoform X1 [Glycine max]
 gb|KHN45868.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=530

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCFLREC+++HSI+G RSRL+ GVEL+DT
Sbjct  384  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFLRECSIQHSIVGVRSRLESGVELQDT  443

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIASLLA+G VPIGVGENTKIRN IIDKN +IG++VVI N DGVQE+D
Sbjct  444  MMMGADYYQTEYEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGRNVVIENIDGVQEAD  503

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGITI ++ ATI DGTVI
Sbjct  504  RAKEGFYIRSGITITLKNATIKDGTVI  530



>ref|XP_010924297.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
 ref|XP_010924298.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=520

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+V+HSI+G RSRLD G ELKDT
Sbjct  374  YDPMTPFFTSPRFLPPTKIEKCRVLDAIISHGCFLRECSVQHSIVGVRSRLDYGAELKDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EIASLLA+G VPIGVG+NTKI N IID NVRIGK+V+I NK+GVQE+D
Sbjct  434  VMMGADYYETEAEIASLLAEGKVPIGVGQNTKISNCIIDMNVRIGKNVIIANKEGVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGITII++ A I DGT+I
Sbjct  494  RPCEGFYIRSGITIILKNAIIKDGTII  520



>ref|XP_002510419.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF52606.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=523

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I DAIISHGCFL+EC+++HSI+G RSRL+  VEL DT
Sbjct  377  YDPKTPFFTSPRFLPPTKVDQCRIVDAIISHGCFLQECSIKHSIVGVRSRLESAVELMDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASL A+G VPIGVG+NTKIRN IIDKN +IG+ VVI N DGVQE++
Sbjct  437  MMMGADYYQTESEIASLQAEGKVPIGVGQNTKIRNCIIDKNAKIGRGVVITNADGVQEAE  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+IME ATI DGT+I
Sbjct  497  RPEEGFYIRSGITVIMENATINDGTII  523



>ref|NP_001266081.1| glucose-1-phosphate adenylyltransferase large subunit 2, chloroplastic-like 
[Cicer arietinum]
 gb|AAK27719.1|AF356003_1 ADP-glucose pyrophosphorylase large subunit CagpL2 [Cicer arietinum]
Length=521

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYT PRFLPPTK++ CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  375  YDPNTPFYTFPRFLPPTKVEKCKIVDAIISHGCFLRECSVQHSIVGIRSRLESGVELQDT  434

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VP+GVGENTKIRN IIDKN RIG++V+I N DGV+E+D
Sbjct  435  MMMGADYYQTESEIASLLAEGKVPVGVGENTKIRNCIIDKNARIGRNVIITNADGVEEAD  494

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGIT I++ ATI DGTVI
Sbjct  495  RTKEGFYIRSGITAILKNATIKDGTVI  521



>gb|ACW82825.1| ADP-glucose pyrophosphorylase large subunit L1 isoform [Lens 
culinaris]
Length=510

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTK DN ++ DAIISHGCFLR+CT++HSI+GERSRLD GVEL+DT
Sbjct  364  YDPKTPIFTSPGFLPPTKFDNSRVVDAIISHGCFLRDCTIQHSIVGERSRLDYGVELQDT  423

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIG+G NTKI+N IIDKN +IGK+VVI NK+GVQE+D
Sbjct  424  VMMGADYYQTESEIASLLAEGKVPIGIGRNTKIKNCIIDKNAKIGKEVVIANKEGVQEAD  483

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R ++GFYIRSGITIIME AT+ DGTV+
Sbjct  484  RSEDGFYIRSGITIIMENATVDDGTVM  510



>ref|XP_011007451.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Populus euphratica]
Length=518

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  737  KTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTLMM  558
            +TPF+TSPRFLPPTK+D C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL DT+MM
Sbjct  375  QTPFFTSPRFLPPTKVDRCRIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELTDTMMM  434

Query  557  GADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDRPD  378
            GAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN RIGKDV+I N DGVQE+DRP 
Sbjct  435  GADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNARIGKDVIITNADGVQEADRPA  494

Query  377  EGFYIRSGITIIMEKATIPDGTVI  306
            EGFYIRSGIT +++ ATI DGT+I
Sbjct  495  EGFYIRSGITAVLKNATIKDGTLI  518



>ref|XP_010110050.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
 gb|EXC25068.1| Glucose-1-phosphate adenylyltransferase large subunit [Morus 
notabilis]
Length=524

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+D 
Sbjct  378  YDPKTPFYTSPRFLPPTKVEKCRIVDAIISHGCFLRECSVQHSIVGVRSRLEYGVELQDA  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VPIGVG+NTKIRN IIDKN +IG+DVVI N DGV+E+D
Sbjct  438  MMMGADYYQTESEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGRDVVITNADGVEEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  +GF+IRSGIT+I++ ATI DGTVI
Sbjct  498  RSSKGFHIRSGITVILKNATIKDGTVI  524



>ref|XP_009336061.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Pyrus x bretschneideri]
Length=512

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+
Sbjct  367  DPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTM  426

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA G VP+GVGENTKI N IIDKN +IG++VVI N DGV+E++R
Sbjct  427  MMGADYYQTESEIASLLAQGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVEEAER  486

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGIT++++ ATI DGTVI
Sbjct  487  ADEGFYIRSGITVVLKNATIKDGTVI  512



>ref|XP_009365102.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Pyrus x bretschneideri]
Length=512

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ GVELKDT+
Sbjct  367  DPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLESGVELKDTM  426

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA G VP+GVGENTKI N IIDKN +IG++VVI N DGV+E++R
Sbjct  427  MMGADYYQTESEIASLLAQGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVEEAER  486

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGIT++++ ATI DGTVI
Sbjct  487  ADEGFYIRSGITVVLKNATIKDGTVI  512



>emb|CDY15884.1| BnaA04g12270D [Brassica napus]
Length=520

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVEL+DT
Sbjct  374  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G+++KIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  434  LMLGADYYQTESEIASLLAEGKVPIGIGQDSKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  494  RPEEGFYIRSGITVVVEKATIQDGTVI  520



>ref|XP_010926128.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Elaeis guineensis]
Length=529

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+++HS++G RSRLD GVELKDT
Sbjct  383  YDPMTPFFTSPRFLPPTKIEKCRILDAIISHGCFLRECSIQHSVVGVRSRLDYGVELKDT  442

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EIASLLA+  VPIGVG+NTKI N IID N RIGK+V+I NKDGVQE+D
Sbjct  443  MMMGADYYETEAEIASLLAEDKVPIGVGQNTKISNCIIDMNARIGKNVIIANKDGVQEAD  502

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGI+II++ ATI DG +I
Sbjct  503  RPHEGFYIRSGISIILKNATIKDGAII  529



>ref|XP_009140291.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140292.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140293.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140294.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
 ref|XP_009140295.1| PREDICTED: probable glucose-1-phosphate adenylyltransferase large 
subunit, chloroplastic [Brassica rapa]
Length=520

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCF+REC+V+ SIIGERSRLD GVEL+DT
Sbjct  374  YDPDTPFYTSPRFLPPTKTEKCRMVDSIISHGCFMRECSVQRSIIGERSRLDYGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G+++KIR  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  434  LMLGADYYQTESEIASLLAEGKVPIGIGQDSKIRKCIIDKNAKIGKNVIIMNKGDVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  494  RPEEGFYIRSGITVVVEKATIQDGTVI  520



>gb|AFK36497.1| unknown [Lotus japonicus]
Length=535

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPP+K++ CKI DAIISHGCFLR C V+HSI+G RSRL+ GVEL+DT
Sbjct  389  YDPKTPFFTSPRFLPPSKVEKCKIVDAIISHGCFLRGCNVQHSIVGIRSRLESGVELQDT  448

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASL+A+G VPIGVGENTKIRN IIDKN +IG++VVI N DGVQE++
Sbjct  449  MMMGADYYQTETEIASLVAEGKVPIGVGENTKIRNCIIDKNAKIGRNVVIANTDGVQEAE  508

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT+ ++ ATI DGTVI
Sbjct  509  RPKEGFYIRSGITVTLKNATIKDGTVI  535



>gb|AGB85111.1| ADP-glucose pyrophosphorylase large subunit 3 [Ipomoea batatas]
Length=517

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK+D CKI DAIISHGCFLREC+V+HSI+G  SRLD GVEL+DT+
Sbjct  372  DPKTPFYTSPRFLPPTKVDKCKIVDAIISHGCFLRECSVKHSIVGIWSRLDYGVELEDTM  431

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            +MGAD Y+TESEIASLLA G VPIG+G NTKIRN IIDKN RIGKDVVI NKD V E+DR
Sbjct  432  VMGADYYQTESEIASLLATGKVPIGIGTNTKIRNCIIDKNARIGKDVVIANKDRVDEADR  491

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             DEGFYIRSGITI+++ ATI DGTVI
Sbjct  492  ADEGFYIRSGITIVLKNATIRDGTVI  517



>ref|XP_009406290.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=526

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+VE SI+G RSRLD   ELKDT
Sbjct  380  YDPMTPFFTSPRFLPPTKIEKCRIVDAIISHGCFLRECSVERSIVGVRSRLDFDAELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EIASLLAD  VPIGVG+NT+IRN IID N RIGK+VVI NKDG+QE+D
Sbjct  440  MMMGADIYETEAEIASLLADDKVPIGVGQNTRIRNCIIDMNARIGKNVVIANKDGIQEAD  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGITIIM+ +TI DGTVI
Sbjct  500  RPCEGFYIRSGITIIMKNSTIKDGTVI  526



>ref|NP_001289992.1| glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Beta vulgaris subsp. vulgaris]
 sp|P55233.1|GLGL1_BETVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Beta vulgaris]
 emb|CAA55516.1| ADP-glucose pyrophosphorylase [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTS RFLPPTK+D CKI D+I+SHGCFL+E +++HSI+G RSRL+ GVE +DT
Sbjct  376  YDPKTPFYTSARFLPPTKVDRCKIVDSIVSHGCFLQESSIQHSIVGVRSRLESGVEFQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VP+GVG+NTKI+N IIDKN +IGKDVVI N DGV+E+D
Sbjct  436  MMMGADYYQTESEIASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKDVVIANTDGVEEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII++ ATI DG VI
Sbjct  496  RPNEGFYIRSGITIILKNATIQDGLVI  522



>ref|XP_009396671.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TP +TSPRFLPP KI+ C+I+DAIISHGCFL EC++EHS++G RSR+  G ELK T
Sbjct  378  YDPRTPIFTSPRFLPPNKIEQCRIRDAIISHGCFLHECSIEHSVVGMRSRVYYGAELKHT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD+YETE+EIASLLA+G VPIGVGENTKIRN IID N RIGK+VVI N+DGVQE+D
Sbjct  438  LMMGADDYETEAEIASLLAEGKVPIGVGENTKIRNCIIDMNARIGKNVVIANRDGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT I++ AT+ DGTVI
Sbjct  498  RPSEGFYIRSGITTILKSATVKDGTVI  524



>ref|XP_008377280.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Malus domestica]
Length=519

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD+
Sbjct  373  YDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDS  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIA LL DG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+D
Sbjct  433  IMMGADYYQTESEIALLLVDGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GIT+I+EKATI DG VI
Sbjct  493  RPEDGFYIREGITVILEKATIRDGMVI  519



>ref|XP_008377281.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X2 [Malus domestica]
Length=517

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTP +TSP FLPPTKIDNC+I DAIISHGCFL++C+V+HSI+GERSRL+ GVE+KD+
Sbjct  371  YDPKTPIFTSPGFLPPTKIDNCRIADAIISHGCFLQDCSVQHSIVGERSRLNYGVEIKDS  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIA LL DG VPIG+G NTKI N IIDKN  IGKDV+I+NKDGVQE+D
Sbjct  431  IMMGADYYQTESEIALLLVDGKVPIGIGSNTKIWNCIIDKNASIGKDVMIVNKDGVQEAD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIR GIT+I+EKATI DG VI
Sbjct  491  RPEDGFYIREGITVILEKATIRDGMVI  517



>ref|XP_010673183.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris]
Length=522

 Score =   240 bits (613),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTS RFLPPTK+D CKI D+I+SHGCFL+E +++HSI+G RSRL+ GVE +DT
Sbjct  376  YDPKTPFYTSARFLPPTKVDRCKIVDSIVSHGCFLQESSIQHSIVGVRSRLESGVEFQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VP+GVG+NTKI+N IIDKN +IGKDVVI N DGV+E+D
Sbjct  436  MMMGADYYQTESEIASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKDVVIANTDGVEEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGITII++ ATI DG VI
Sbjct  496  RPNEGFYIRSGITIILKNATIQDGLVI  522



>ref|XP_009406289.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=549

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C+I DAIISHGCFLREC+VE SI+G RSRLD   ELKDT
Sbjct  403  YDPMTPFFTSPRFLPPTKIEKCRIVDAIISHGCFLRECSVERSIVGVRSRLDFDAELKDT  462

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EIASLLAD  VPIGVG+NT+IRN IID N RIGK+VVI NKDG+QE+D
Sbjct  463  MMMGADIYETEAEIASLLADDKVPIGVGQNTRIRNCIIDMNARIGKNVVIANKDGIQEAD  522

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGITIIM+ +TI DGTVI
Sbjct  523  RPCEGFYIRSGITIIMKNSTIKDGTVI  549



>ref|XP_006346702.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic-like [Solanum tuberosum]
Length=521

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+
Sbjct  376  DPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTM  435

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NK+GV+E+DR
Sbjct  436  MMGADYYQTESEIASLLAEGKVPIGVGPNTKIQNCIIDKNAKIGKDVVILNKEGVEEADR  495

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
              EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  496  SAEGFYIRSGITVIMKNATIKDGTVI  521



>gb|AAB82604.1| ADP-glucose-pyrophosphorylase large subunit [Triticum aestivum]
Length=290

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  144  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  203

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  204  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  263

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  264  RPEEGYYIRSGIVVIQKNATIKDGTVV  290



>ref|XP_003528021.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Glycine max]
 gb|KHN22238.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=531

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK++ CKI DAIISHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  385  YDPKTPFFTSPRFLPPTKVEKCKIVDAIISHGCFLRECSVQHSIVGVRSRLESGVELQDT  444

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIASL+A+G VPIGVG NTKIRN IIDKN +IG++V+I N DGVQE+D
Sbjct  445  MMMGADYYQTEYEIASLVAEGKVPIGVGANTKIRNCIIDKNAKIGRNVIIANTDGVQEAD  504

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFYIRSGIT+ ++ ATI DGTVI
Sbjct  505  RAKEGFYIRSGITVTLKNATIKDGTVI  531



>ref|XP_006411722.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
 dbj|BAJ34261.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53175.1| hypothetical protein EUTSA_v10024927mg [Eutrema salsugineum]
Length=521

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+  D+IISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  375  YDQNTPFYTSPRFLPPTKTEKCRFVDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDT  434

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD VQE+D
Sbjct  435  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVQEAD  494

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+I+EKATI DGTVI
Sbjct  495  RPEEGFYIRSGITVIVEKATIKDGTVI  521



>ref|XP_006415741.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
 gb|ESQ34094.1| hypothetical protein EUTSA_v10007379mg [Eutrema salsugineum]
Length=518

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  372  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+  VPIGVGENTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  432  MMMGADFYQTEAEIASLLAERKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT++++ ATI DG V+
Sbjct  492  RPEEGFYIRSGITVVVKNATIRDGFVV  518



>ref|NP_195632.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
 sp|P55231.2|GLGL3_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA77173.1| glucose-1-phosphate adenylyltransferase [Arabidopsis thaliana]
 emb|CAB43636.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 emb|CAB80584.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAL24344.1| glucose-1-phosphate adenylyltransferase (APL3) [Arabidopsis thaliana]
 gb|AAQ56821.1| At4g39210 [Arabidopsis thaliana]
 gb|AEE87038.1| glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis 
thaliana]
Length=521

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I +++ISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  375  YDQNTPFYTSPRFLPPTKTEKCRIVNSVISHGCFLGECSIQRSIIGERSRLDYGVELQDT  434

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+VVIMNKD V+E+D
Sbjct  435  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVVIMNKDDVKEAD  494

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  495  RPEEGFYIRSGITVVVEKATIKDGTVI  521



>ref|XP_002878559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPRFLPPTK + C++ D+IISHGCFLREC+++ SIIGERSRLD GVEL+DT
Sbjct  374  YDPDTPFYTSPRFLPPTKAEKCRMVDSIISHGCFLRECSIQRSIIGERSRLDYGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD Y+TESEIASLLA+G VPIG+G +TK+R  IIDKN +IGK+V+IMNK  VQE+D
Sbjct  434  LMLGADYYQTESEIASLLAEGKVPIGIGRDTKVRKCIIDKNAKIGKNVIIMNKGDVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIR GIT+I+EKATI DGTVI
Sbjct  494  RPEEGFYIRLGITVIVEKATIQDGTVI  520



>ref|XP_009394804.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=538

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TP +TSPRFLPPTKI+ C+I D+IISHGCFL EC++EHSI+G RSR+D G ELKD 
Sbjct  392  YDPRTPIFTSPRFLPPTKIEKCRILDSIISHGCFLHECSIEHSIVGVRSRIDYGAELKDA  451

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD YETE+E+AS+LA+G VPIGVG+NTKIRN IID N RIGK+VVI NKDGVQE+D
Sbjct  452  LMLGADLYETEAELASILAEGKVPIGVGQNTKIRNCIIDMNARIGKNVVIANKDGVQEAD  511

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIR GITIIM+ ATI DGTVI
Sbjct  512  RPSEGFYIRFGITIIMKNATIKDGTVI  538



>gb|KFK36157.1| hypothetical protein AALP_AA4G085400 [Arabis alpina]
Length=514

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  368  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRLESGVELQDT  427

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VPIGVG+NTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  428  MMMGADFYQTEAEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKNVVIANADGVEEGD  487

Query  386  RPDEGFYIRSGITIIMEKATIPDG  315
            RP +GFYIRSGIT++++ ATI DG
Sbjct  488  RPADGFYIRSGITVVLKNATIRDG  511



>ref|XP_006303972.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
 gb|EOA36870.1| hypothetical protein CARUB_v10008862mg [Capsella rubella]
Length=519

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  373  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VPIGVG+NTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  433  MMMGADFYQTEAEIASLLAEGKVPIGVGQNTKIRNCIIDKNAKIGKNVVIANADGVEEGD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  493  RPEEGFHIRSGITVVLKNATIRDGLQI  519



>ref|XP_004291856.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Fragaria vesca subsp. vesca]
Length=521

 Score =   238 bits (607),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAIISHGCFLREC+V+HSI+G RSRL+ G ELKDT+
Sbjct  376  DPKTPFYTSPRFLPPTKVEKCRIMDAIISHGCFLRECSVQHSIVGVRSRLEYGAELKDTM  435

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TE EIASLLA+G VP+GVGENTKI N IIDKN +IG++VVI N DGV+E++R
Sbjct  436  MMGADYYQTEEEIASLLANGKVPVGVGENTKIWNCIIDKNAKIGRNVVITNGDGVEEAER  495

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
            P++GFYIRSGIT++++ ATI DGT+I
Sbjct  496  PEDGFYIRSGITVVLKNATIKDGTII  521



>gb|ADE77153.1| unknown [Picea sitchensis]
Length=220

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSP+FLPPTKI+ C++ D+IISHGCFL+ECTVEHS++G RSRL+ G ELK+T
Sbjct  74   YDPMKPIFTSPQFLPPTKIEKCQVLDSIISHGCFLQECTVEHSVVGIRSRLEYGAELKET  133

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EIASLLA+G VPIGVGENTKIRN IIDKN RIGK+VVI N D V+E++
Sbjct  134  MMMGADYYETEAEIASLLAEGKVPIGVGENTKIRNCIIDKNARIGKNVVIANSDNVEEAE  193

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EG+YIRSGIT+I++ + I DGTVI
Sbjct  194  RPSEGYYIRSGITVILKNSRIKDGTVI  220



>ref|XP_010323163.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
 ref|XP_010323164.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X1 [Solanum lycopersicum]
Length=518

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+
Sbjct  373  DPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTM  432

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK GV+E+DR
Sbjct  433  MMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGVEEADR  492

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
              EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  493  SAEGFYIRSGITVIMKNATIKDGTVI  518



>sp|P55242.1|GLGL2_SOLTU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Solanum tuberosum]
 emb|CAA52917.1| ADP-glucose-pyrophosphorylase [Solanum tuberosum]
Length=519

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+
Sbjct  374  DPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTM  433

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TE EIASLLA+G VPIGVG NTKI+N IIDKN +IGKDVVI+NK+GV+E+DR
Sbjct  434  MMGADYYQTECEIASLLAEGKVPIGVGPNTKIQNCIIDKNAKIGKDVVILNKEGVEEADR  493

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
              EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  494  SAEGFYIRSGITVIMKNATIKDGTVI  519



>ref|XP_010499251.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  374  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  434  MMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVVIANADGVEEGD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  494  RPEEGFHIRSGITVVLKNATIRDGLHI  520



>ref|XP_009101892.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Brassica rapa]
Length=523

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I D+IISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  377  YDQDTPFYTSPRFLPPTKTEKCRILDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+D
Sbjct  437  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  497  RPEEGFYIRSGITVVVEKATIKDGTVI  523



>ref|NP_001233947.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
 gb|AAB40724.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+
Sbjct  373  DPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTM  432

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK GV+E+DR
Sbjct  433  MMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGVEEADR  492

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
              EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  493  SAEGFYIRSGITVIMKNATIKDGTVI  518



>ref|XP_009101891.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Brassica rapa]
Length=529

 Score =   238 bits (606),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I D+IISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  383  YDQDTPFYTSPRFLPPTKTEKCRILDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDT  442

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+D
Sbjct  443  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDVQEAD  502

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  503  RPEEGFYIRSGITVVVEKATIKDGTVI  529



>gb|KDP38538.1| hypothetical protein JCGZ_04463 [Jatropha curcas]
Length=527

 Score =   237 bits (605),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD KTPFYT PRFLPPTK+D CKI DAIISHGCFL+EC+++HS++G RSRL+ GVEL DT
Sbjct  381  YDSKTPFYTCPRFLPPTKVDKCKIVDAIISHGCFLQECSIQHSVVGVRSRLESGVELIDT  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESEIASLLA+G VP+GVG+NTKIRN IIDKN +IG+DVVI N DGV E+D
Sbjct  441  MMMGADYYQTESEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGRDVVITNADGVLEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT I + ATI DGT+I
Sbjct  501  RPEEGFYIRSGITAIPKDATIKDGTII  527



>ref|XP_010460525.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Camelina sativa]
Length=520

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  374  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+V+I N DGV+E D
Sbjct  434  MMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVIIANADGVEEGD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  494  RPEEGFHIRSGITVVLKNATIRDGLHI  520



>gb|ABF69950.1| ADP-glucose pyrophosphorylase (glucose-1-phosphate adenylyltransferase) 
large subunit, putative [Musa acuminata]
Length=445

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+VE SI+G RSRLD GVELKDT
Sbjct  299  YDPMTPFFTSPRFLPPTKIEKCRVMDAIISHGCFLRECSVERSIVGVRSRLDFGVELKDT  358

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EI+S LAD  VPIGVG+ TKIRN +ID N RIGK+VVI NKDGVQE+D
Sbjct  359  MMMGADIYETEAEISSHLADDKVPIGVGQKTKIRNCVIDMNARIGKNVVIANKDGVQEAD  418

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFY+RSGI +I++ ATI DGTVI
Sbjct  419  RASEGFYVRSGIVVILKNATIKDGTVI  445



>ref|XP_010478113.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Camelina sativa]
Length=520

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  374  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+V+I N DGV+E D
Sbjct  434  MMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVIIANADGVEEGD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  494  RPEEGFHIRSGITVVLKNATIRDGLHI  520



>gb|AFW79323.1| ADP-glucose pyrophosphorylase large subunit [Zea mays]
Length=534

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G ELK+T
Sbjct  388  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCELKNT  447

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LLA+G VPIGVGENTKI N IID N R+G++V I NK+GVQE+D
Sbjct  448  MMMGADLYETEDEISRLLAEGKVPIGVGENTKISNCIIDMNARVGRNVSITNKEGVQEAD  507

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEG+YIRSGI ++++ ATI DGTVI
Sbjct  508  RPDEGYYIRSGIVVVLKNATIKDGTVI  534



>gb|AIO11223.1| AGPL1 protein [Gladiolus hybrid cultivar]
Length=517

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK++ C+I DAIISHGCFL+ECTV +SI+G RSRLD GVEL+DT
Sbjct  371  YDPKTPFFTSPRYLPPTKMEKCRIVDAIISHGCFLQECTVHNSIVGVRSRLDYGVELEDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD YETE+EIASLLA+G VPIGVG+NTKIRN IID N RIG +VVI NKDGVQE+D
Sbjct  431  LMMGADVYETEAEIASLLAEGKVPIGVGKNTKIRNCIIDMNARIGANVVIANKDGVQEAD  490

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGITII   + I DGT+I
Sbjct  491  RPLEGFYIRSGITIIPMNSIIKDGTII  517



>ref|XP_010478112.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  376  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+V+I N DGV+E D
Sbjct  436  MMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVIIANADGVEEGD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  496  RPEEGFHIRSGITVVLKNATIRDGLHI  522



>ref|XP_008648319.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 ref|XP_008648320.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic/amyloplastic isoform X1 [Zea mays]
 gb|ACG34981.1| glucose-1-phosphate adenylyltransferase large subunit [Zea mays]
 gb|ACN28262.1| unknown [Zea mays]
 gb|AFW79324.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 1 
[Zea mays]
 gb|AFW79325.1| glucose-1-phosphate adenylyltransferase large subunit 2, /amyloplastic 
Precursor(ADP-glucose pyrophosphorylase) isoform 2 
[Zea mays]
Length=518

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G ELK+T
Sbjct  372  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCELKNT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LLA+G VPIGVGENTKI N IID N R+G++V I NK+GVQE+D
Sbjct  432  MMMGADLYETEDEISRLLAEGKVPIGVGENTKISNCIIDMNARVGRNVSITNKEGVQEAD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RPDEG+YIRSGI ++++ ATI DGTVI
Sbjct  492  RPDEGYYIRSGIVVVLKNATIKDGTVI  518



>emb|CDY56761.1| BnaA06g40730D [Brassica napus]
Length=595

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I D+IISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  449  YDQDTPFYTSPRFLPPTKTEKCRIVDSIISHGCFLGECSIQRSIIGERSRLDYGVELQDT  508

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+D
Sbjct  509  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNSDDVQEAD  568

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  569  RPEEGFYIRSGITVVVEKATIKDGTVI  595



>ref|XP_006282507.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
 gb|EOA15405.1| hypothetical protein CARUB_v10007053mg [Capsella rubella]
Length=521

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DT
Sbjct  375  YDQTTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDT  434

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G++TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  435  LMLGADSYQTESEIASLLAEGNVPIGIGQDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  494

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGT+I
Sbjct  495  RPEEGFYIRSGITVVVEKATIKDGTII  521



>ref|XP_010446453.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446454.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446456.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
 ref|XP_010446457.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like [Camelina sativa]
Length=522

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DT
Sbjct  376  YDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  436  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  496  RPEEGFYIRSGITVVVEKATIKDGTVI  522



>ref|XP_002890743.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67002.1| hypothetical protein ARALYDRAFT_472972 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  372  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRIESGVELQDT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+GVG+NTKIRN IIDKN +IGK+VVI N +GV+E D
Sbjct  432  MMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIRNCIIDKNAKIGKNVVIANAEGVEEGD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  492  RPEEGFHIRSGITVVLKNATIRDGLHI  518



>gb|AJG44462.1| ADP-glucose pyrophosphorylase large subunit [Lilium davidii var. 
unicolor]
Length=514

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPFYTSPR+LPPTK+D C+I +AIISHGCFL +C+V+HS++G RSRL+ GVELKDT
Sbjct  368  YDPMTPFYTSPRYLPPTKVDKCQIVNAIISHGCFLHDCSVQHSVVGVRSRLESGVELKDT  427

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TESE+A+LLA+G VPIGVG NTKI+N IIDKN RIG+DV+I NKDGVQE+D
Sbjct  428  MMMGADFYQTESEVAALLAEGKVPIGVGPNTKIKNCIIDKNARIGRDVIITNKDGVQEAD  487

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGITII +  TI D TVI
Sbjct  488  RPEDGFYIRSGITIIPKNTTIKDETVI  514



>ref|XP_010431888.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431889.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
 ref|XP_010431890.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X2 [Camelina sativa]
Length=522

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DT
Sbjct  376  YDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  436  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  496  RPEEGFYIRSGITVVVEKATIKDGTVI  522



>ref|XP_010437035.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X2 [Camelina sativa]
Length=519

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DT
Sbjct  373  YDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVP+G+G +TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  433  LMLGADSYQTESEIASLLAEGNVPVGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  493  RPEEGFYIRSGITVVVEKATIKDGTVI  519



>ref|XP_002866835.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43094.1| hypothetical protein ARALYDRAFT_490693 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  375  YDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSIQRSIIGERSRLDYGVELQDT  434

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  435  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  494

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI D TVI
Sbjct  495  RPEEGFYIRSGITVVVEKATIKDSTVI  521



>ref|XP_010437034.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic-like isoform X1 [Camelina sativa]
Length=522

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DT
Sbjct  376  YDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVP+G+G +TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  436  LMLGADSYQTESEIASLLAEGNVPVGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  496  RPEEGFYIRSGITVVVEKATIKDGTVI  522



>ref|XP_010431887.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
3, chloroplastic isoform X1 [Camelina sativa]
Length=534

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+V+ SIIGERSRL+ GVEL+DT
Sbjct  388  YDQNTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSVQRSIIGERSRLEYGVELQDT  447

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+NKD V+E+D
Sbjct  448  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNKDDVKEAD  507

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  508  RPEEGFYIRSGITVVVEKATIKDGTVI  534



>ref|XP_006654841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Oryza brachyantha]
Length=519

 Score =   235 bits (600),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLRECT+EHSI+G RSRL+ G ELK+T
Sbjct  373  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVRSRLNSGCELKNT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GVQE+D
Sbjct  433  MMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVVIKNSEGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I++ ATI DGTVI
Sbjct  493  RPEEGYYIRSGIVVILKNATIKDGTVI  519



>ref|XP_008220832.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic isoform X1 [Prunus mume]
Length=527

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAI+SHGCFLREC+V+HSI+G RSRL+ GVELKDT+
Sbjct  382  DPKTPFYTSPRFLPPTKVEKCRIIDAIVSHGCFLRECSVQHSIVGVRSRLESGVELKDTM  441

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASL+A G VP+GVG NTKI N IIDKN +IG++V+I N DGV+E+DR
Sbjct  442  MMGADYYQTESEIASLVALGKVPVGVGSNTKIWNCIIDKNAKIGRNVMITNADGVEEADR  501

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             +EGFYIRSGIT++++ ATI DGTV+
Sbjct  502  AEEGFYIRSGITVVLKNATIKDGTVV  527



>ref|XP_007222521.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
 gb|EMJ23720.1| hypothetical protein PRUPE_ppa004135mg [Prunus persica]
Length=527

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTSPRFLPPTK++ C+I DAI+SHGCFLREC+V+HSI+G RSRL+ GVELKDT+
Sbjct  382  DPKTPFYTSPRFLPPTKVEKCRIIDAIVSHGCFLRECSVQHSIVGVRSRLESGVELKDTM  441

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASL+A G VP+GVG NTKI N IIDKN +IG++V+I N DGV+E+DR
Sbjct  442  MMGADYYQTESEIASLVALGKVPVGVGSNTKIWNCIIDKNAKIGRNVMITNTDGVEEADR  501

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
             +EGFYIRSGIT++++ ATI DGTVI
Sbjct  502  AEEGFYIRSGITVVLKNATIKDGTVI  527



>emb|CDX72711.1| BnaC07g47330D [Brassica napus]
Length=632

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD  TPFYTSPRFLPPTK + C+I ++IISHGCFL EC+++ SIIGERSRLD GVEL+DT
Sbjct  486  YDQDTPFYTSPRFLPPTKTEKCRIVNSIISHGCFLGECSIQRSIIGERSRLDYGVELQDT  545

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LM+GAD+Y+TESEIASLLA+GNVPIG+G +TKIR  IIDKN +IGK+V+I+N D VQE+D
Sbjct  546  LMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGKNVMILNNDDVQEAD  605

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+++EKATI DGTVI
Sbjct  606  RPEEGFYIRSGITVVVEKATIKDGTVI  632



>ref|XP_009416548.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Musa acuminata subsp. malaccensis]
Length=529

 Score =   235 bits (599),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP TPF+TSPRFLPPTKI+ C++ DAIISHGCFLREC+VE SI+G RSRLD GVELKDT
Sbjct  383  YDPMTPFFTSPRFLPPTKIEKCRVMDAIISHGCFLRECSVERSIVGVRSRLDFGVELKDT  442

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE+EI+S LAD  VPIGVG+ TKIRN +ID N RIGK+VVI NKDGVQE+D
Sbjct  443  MMMGADIYETEAEISSHLADDKVPIGVGQKTKIRNCVIDMNARIGKNVVIANKDGVQEAD  502

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R  EGFY+RSGI +I++ ATI DGTVI
Sbjct  503  RASEGFYVRSGIVVILKNATIKDGTVI  529



>ref|XP_010540326.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic [Tarenaya hassleriana]
Length=522

 Score =   235 bits (599),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPPTK+D C+I D+I+SHGCFLREC+V+ SI+G RSRL+ GVEL+DT
Sbjct  376  YDPKTPFYTSPRFLPPTKVDRCRILDSIVSHGCFLRECSVQRSIVGVRSRLESGVELQDT  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIASLLA G VPIGVG +TKIRN IIDKN +IGK+V+I N DGV+E+D
Sbjct  436  MMMGADFYQTEVEIASLLAQGKVPIGVGPDTKIRNCIIDKNAKIGKNVIITNADGVEEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EGFYIRSGIT++++ ATI DG VI
Sbjct  496  RAEEGFYIRSGITVVLKNATIRDGLVI  522



>ref|NP_174089.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
 sp|P55230.2|GLGL2_ARATH RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic; AltName: Full=ADP-glucose pyrophosphorylase; 
AltName: Full=ADP-glucose synthase; AltName: Full=AGPase 
S; AltName: Full=Alpha-D-glucose-1-phosphate adenyl transferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF24945.1|AC012375_8 T22C5.13 [Arabidopsis thaliana]
 gb|AAL36283.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM14190.1| putative ADP-glucose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE30862.1| glucose-1-phosphate adenylyltransferase large subunit 2 [Arabidopsis 
thaliana]
Length=518

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD KTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSRL+ GVEL+DT
Sbjct  372  YDQKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRLESGVELQDT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VP+GVG+NTKI+N IIDKN +IGK+VVI N DGV+E D
Sbjct  432  MMMGADFYQTEAEIASLLAEGKVPVGVGQNTKIKNCIIDKNAKIGKNVVIANADGVEEGD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGF+IRSGIT++++ ATI DG  I
Sbjct  492  RPEEGFHIRSGITVVLKNATIRDGLHI  518



>gb|AHA11391.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  377  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  437  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  497  RPEEGYYIRSGIVVIQKNATIKDGTVV  523



>sp|P12299.2|GLGL2_WHEAT RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; Flags: Precursor [Triticum aestivum]
 emb|CAA79980.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
 gb|ABG88200.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  376  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  436  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  496  RPEEGYYIRSGIVVIQKNATIKDGTVV  522



>ref|XP_007160732.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
 gb|ESW32726.1| hypothetical protein PHAVU_001G012500g [Phaseolus vulgaris]
Length=520

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSP FLPPTK+  CK+ DAIISHGCFL +C V+HSI+G+RSRL+ G EL+DT
Sbjct  374  YDPKTPFFTSPGFLPPTKLIKCKLVDAIISHGCFLNKCKVQHSIVGQRSRLEAGSELQDT  433

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+T+SEIA+LLA+G VP+GVGENTKIRN IIDKN +IGK+V+I N DGVQE+D
Sbjct  434  MMMGADYYQTDSEIATLLAEGKVPVGVGENTKIRNCIIDKNAKIGKNVIIANADGVQEAD  493

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +P+EGFYIRSGI +I++ ATI DGTVI
Sbjct  494  KPEEGFYIRSGIVVIVKNATIKDGTVI  520



>emb|CAA32532.1| ADP-glucose pyrophosophorylase (1 is 2nd base in codon) [Triticum 
aestivum]
 prf||1609236B ADP glucose pyrophosphatase AGA.3
Length=296

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AII HGCFLREC +EHSIIG  SRL+ G ELK+ 
Sbjct  150  YDPKTPFFTSPRYLPPTKSDKCRIKEAIILHGCFLRECKIEHSIIGVPSRLNSGSELKNA  209

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  210  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  269

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  270  RPEEGYYIRSGIVVIQKNATIKDGTVV  296



>sp|P30524.2|GLGL1_HORVU RecName: Full=Glucose-1-phosphate adenylyltransferase large subunit 
1, chloroplastic/amyloplastic; AltName: Full=ADP-glucose 
pyrophosphorylase; AltName: Full=ADP-glucose synthase; AltName: 
Full=AGPase S; AltName: Full=Alpha-D-glucose-1-phosphate 
adenyl transferase; AltName: Full=BEPL; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA47626.1| glucose-1-phosphate adenylyltransferase [Hordeum vulgare subsp. 
vulgare]
 emb|CAX51355.1| large subunit of ADP-glucose pyrophosphorylase [Hordeum vulgare 
subsp. vulgare]
 dbj|BAK04629.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93393.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93437.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AHA11390.1| cytosolic ADP-glucose pyrophosphorylase large subunit [Hordeum 
vulgare]
Length=523

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  377  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  437  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  497  RPEEGYYIRSGIVVIQKNATIKDGTVV  523



>emb|CAD98749.1| ADP-glucose pyrophosphorylase large subunit [Triticum aestivum]
Length=522

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  376  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  436  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  496  RPEEGYYIRSGIVVIQKNATIKDGTVV  522



>gb|AEH27531.1| putative ADP-glucose pyrophosphorylase [Amorphophallus konjac]
Length=543

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TPFYTSPR+LPPTK+D C+I D+IISHGCFL +C++EHSI+G+RSRL+  VELKDT
Sbjct  397  YDPQTPFYTSPRYLPPTKVDKCRIVDSIISHGCFLDQCSIEHSIVGDRSRLEYNVELKDT  456

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE E A+LLA+G VPIGVG+ TK+RN IIDKN +IGK+V+I NKDGVQE+D
Sbjct  457  MMMGADYYQTEVERAALLAEGKVPIGVGQQTKMRNCIIDKNAKIGKNVIITNKDGVQEAD  516

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSG TII++  TI DGTVI
Sbjct  517  RPSEGFYIRSGHTIILKNTTIKDGTVI  543



>gb|EMT32758.1| hypothetical protein F775_52189 [Aegilops tauschii]
Length=574

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  382  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  442  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  502  RPEEGYYIRSGIVVIQKNATIKDGTVV  528



>prf||1909370A ADP glucose pyrophosphorylase:SUBUNIT=L
Length=527

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  381  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  440

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  441  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  500

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I + ATI DGTV+
Sbjct  501  RPEEGYYIRSGIVVIQKNATIKDGTVV  527



>ref|NP_001056424.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|AAU10700.1| putative glucose-1-phosphate adenylyltransferase [Oryza sativa 
Japonica Group]
 gb|EAY99171.1| hypothetical protein OsI_21129 [Oryza sativa Indica Group]
 gb|ACA50479.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 dbj|BAG94825.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64817.1| hypothetical protein OsJ_19673 [Oryza sativa Japonica Group]
 dbj|BAF18338.2| Os05g0580000 [Oryza sativa Japonica Group]
 gb|ACY56044.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56045.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56046.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56047.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56048.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56049.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
 gb|ACY56050.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56051.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56052.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56053.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56054.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56055.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56056.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
 gb|ACY56057.1| ADP-glucose pyrophosphorylase large subunit [Oryza sativa Indica 
Group]
Length=519

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLRECT+EHSI+G RSRL+   ELK+T
Sbjct  373  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVRSRLNSACELKNT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GVQESD
Sbjct  433  MMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNVVITNSEGVQESD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I++ ATI DG VI
Sbjct  493  RPEEGYYIRSGIVVILKNATIKDGKVI  519



>gb|AAC49942.1| ADP-glucose pyrophosphorylase large subunit [Solanum lycopersicum]
Length=518

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTS RFLPPTK+D  +I DAIISHG FLREC ++HSI+G RSRLD GVE KDT+
Sbjct  373  DPKTPFYTSARFLPPTKVDKSRIVDAIISHGGFLRECNIQHSIVGVRSRLDYGVEFKDTM  432

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK GV+E+DR
Sbjct  433  MMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQGVEEADR  492

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
              EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  493  SAEGFYIRSGITVIMKNATIKDGTVI  518



>gb|AAD39597.1|AC007858_11 10A19I.12 [Oryza sativa Japonica Group]
Length=529

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLRECT+EHSI+G RSRL+   ELK+T
Sbjct  383  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECTIEHSIVGVRSRLNSACELKNT  442

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GVQESD
Sbjct  443  MMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNVVITNSEGVQESD  502

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I++ ATI DG VI
Sbjct  503  RPEEGYYIRSGIVVILKNATIKDGKVI  529



>gb|KJB63621.1| hypothetical protein B456_010G008700 [Gossypium raimondii]
Length=523

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPRFLPP+KID C+I +AIISHGCFLR C+V+ S++G RSRL+ GVEL+DT
Sbjct  377  YDPKTPFYTSPRFLPPSKIDQCRIVNAIISHGCFLRNCSVKRSVVGVRSRLESGVELEDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EI SLL +G VPIGVG+NTKI+N IIDKN +IGK+V+I N DGV+E++
Sbjct  437  MMMGADFYQTEMEIMSLLKEGKVPIGVGQNTKIKNCIIDKNAKIGKNVIISNSDGVEEAE  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++GFYIRSGIT+IM+ ATI DG+VI
Sbjct  497  RPEQGFYIRSGITVIMKNATIKDGSVI  523



>gb|EMS53815.1| Glucose-1-phosphate adenylyltransferase large subunit 1, chloroplastic/amyloplastic 
[Triticum urartu]
Length=458

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLREC +EHSIIG RSRL+ G ELK+ 
Sbjct  256  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECKIEHSIIGVRSRLNSGSELKNA  315

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+YETE EI+ L+++G VPIGVGENTKI N IID N RIG+DVVI NK+GVQE+D
Sbjct  316  MMMGADSYETEDEISRLMSEGKVPIGVGENTKISNCIIDMNARIGRDVVISNKEGVQEAD  375

Query  386  RPDEGFYIRSGITIIMEKATIPDGT  312
            RP+EG+YIRSGI +I + ATI DG+
Sbjct  376  RPEEGYYIRSGIVVIQKNATIKDGS  400



>ref|XP_006491439.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Citrus sinensis]
Length=526

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+ P +TSPRFLPP+KI+ C+++D+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT
Sbjct  380  YDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIA+LLA+G VP+G+G +TKI+N IIDKN +IGK+V+I NKDGV+E++
Sbjct  440  MMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAE  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIRSGIT++++  TI DGT+I
Sbjct  500  RPSDGFYIRSGITVVLKNTTIKDGTII  526



>gb|KDO86722.1| hypothetical protein CISIN_1g043870mg [Citrus sinensis]
Length=526

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+ P +TSPRFLPP+KI+ C+++D+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT
Sbjct  380  YDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIA+LLA+G VP+G+G +TKI+N IIDKN +IGK+V+I NKDGV+E++
Sbjct  440  MMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAE  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIRSGIT++++  TI DGT+I
Sbjct  500  RPSDGFYIRSGITVVLKNTTIKDGTII  526



>ref|XP_006444661.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
 gb|ESR57901.1| hypothetical protein CICLE_v10023395mg [Citrus clementina]
Length=526

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+ P +TSPRFLPP+KI+ C+++D+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT
Sbjct  380  YDPQKPIFTSPRFLPPSKIEKCRVQDSIISHGCFLRECSVEHSIVGIRSRLEYGVELKDT  439

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIA+LLA+G VP+G+G +TKI+N IIDKN +IGK+V+I NKDGV+E++
Sbjct  440  MMMGADYYQTEAEIAALLAEGKVPVGIGRDTKIKNCIIDKNAKIGKNVIIANKDGVEEAE  499

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIRSGIT++++  TI DGT+I
Sbjct  500  RPSDGFYIRSGITVVLKNTTIKDGTII  526



>ref|NP_001284415.1| myeloid leukemia factor 2 [Cucumis melo]
 gb|AAB91464.1| ADP-glucose pyrophosphorylase large subunit [Cucumis melo]
Length=518

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPFYTSPR  PP+K++ C+I DAIISHGCFLRECTVE  I+G RSRL+ GVELKDT
Sbjct  372  YDPKTPFYTSPRSCPPSKVEKCRIVDAIISHGCFLRECTVEPLIVGVRSRLEYGVELKDT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGA  Y+TESEIASLLA+G +PIG+GENTKIRN IIDKN +IG++VVI N D VQE+D
Sbjct  432  MMMGAYYYQTESEIASLLAEGKIPIGIGENTKIRNCIIDKNAKIGRNVVIANTDDVQEAD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EGFYIRSGIT+ ++ ATI DGT+I
Sbjct  492  RPEEGFYIRSGITVTLKNATIKDGTII  518



>gb|AGT17180.1| glucose-1-phosphate adenylyltransferase [Saccharum hybrid cultivar 
R570]
Length=519

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G ELK+T
Sbjct  373  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCELKNT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++V I N +GVQE+D
Sbjct  433  MMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVSITNTEGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++G+YIRSG+ +I++ ATI DGTVI
Sbjct  493  RPEQGYYIRSGVVVILKNATIKDGTVI  519



>ref|XP_004961109.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Setaria italica]
Length=518

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D  +IKDAIISHGCFLRECT+EHSI+G RSRL+ G ELK+T
Sbjct  372  YDPKTPFFTSPRYLPPTKSDKSRIKDAIISHGCFLRECTIEHSIVGVRSRLNSGCELKNT  431

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++V I N +GVQE+D
Sbjct  432  MMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVSITNSEGVQEAD  491

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I++ ATI DGTVI
Sbjct  492  RPEEGYYIRSGIVVILKNATIKDGTVI  518



>gb|AFO84073.1| ADP glucose pyrophosphorylase [Actinidia deliciosa]
Length=520

 Score =   229 bits (585),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPF TSPRFLPPTK++ C+I DAIISHGCFL EC ++HSI+G RSRL+ GV+L+DT+
Sbjct  375  DPKTPFCTSPRFLPPTKMEKCRIVDAIISHGCFLHECNIKHSIVGVRSRLETGVKLQDTM  434

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESDR  384
            MMGAD+Y+TE+EIAS LA G VPIGVG NT IRN IID N +IG+DVVI NKDGV+E+DR
Sbjct  435  MMGADDYQTEAEIASHLAWGKVPIGVGRNTNIRNCIIDMNAKIGRDVVIANKDGVEEADR  494

Query  383  PDEGFYIRSGITIIMEKATIPDGTVI  306
            P+EGFYIRSGIT++++ ATI DGT+I
Sbjct  495  PEEGFYIRSGITVVLKNATIKDGTII  520



>ref|XP_002440313.1| hypothetical protein SORBIDRAFT_09g029610 [Sorghum bicolor]
 gb|EES18743.1| hypothetical protein SORBIDRAFT_09g029610 [Sorghum bicolor]
Length=519

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGCFLREC +EHSI+G RSRL+ G ELK+T
Sbjct  373  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCELKNT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++V I N +GVQE+D
Sbjct  433  MMMGADLYETEDEISRLLSEGKVPIGVGENTKISNCIIDMNARVGRNVSITNTEGVQEAD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+ G+YIRSGI +I++ ATI DGTVI
Sbjct  493  RPELGYYIRSGIVVILKNATIKDGTVI  519



>gb|AEV40474.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
 gb|AEV40475.1| ADP-glucose pyrophosphorylase 3 [Spirodela polyrhiza]
Length=539

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+TPFYTSPR+LPPTK+D CKI D+I+SHGCFL  C+++HSI+G+RSRL+ GV+LKD 
Sbjct  393  YDPRTPFYTSPRYLPPTKMDKCKIVDSIVSHGCFLDHCSIQHSIVGDRSRLEYGVQLKDA  452

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            ++MGADNY+TE+E A+LLA+G VPIG+G++T+I+N I+DKN RIG+DVVI N  GVQE+D
Sbjct  453  IVMGADNYQTEAERAALLAEGKVPIGIGQHTRIQNCIVDKNARIGRDVVIANTAGVQEAD  512

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFY+RSGI ++++ +TI DGTVI
Sbjct  513  RPSEGFYVRSGIVVLLKNSTIKDGTVI  539



>ref|XP_009113739.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113740.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
 ref|XP_009113742.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic isoform X1 [Brassica rapa]
Length=543

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 133/173 (77%), Gaps = 26/173 (15%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTK+D C+I D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  371  YDPKTPFFTSPRFLPPTKVDKCRILDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDT  430

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKI--------------------------R  465
            +MMGAD Y+TE+EIASLLA+G VPIGVGENTKI                          R
Sbjct  431  MMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRYLIPNKAESSVVAIHCLTSVVLFKCR  490

Query  464  NAIIDKNVRIGKDVVIMNKDGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  306
            N IIDKN +IGK+VVI N DGV+E DRP+EGFYIRSGIT++++ ATI DG V+
Sbjct  491  NCIIDKNAKIGKNVVIANADGVEEGDRPEEGFYIRSGITVVLKNATIRDGLVL  543



>ref|XP_003567817.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Brachypodium distachyon]
 ref|XP_010230974.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic [Brachypodium distachyon]
Length=522

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IK+AIISHGCFLRECT+EHSI+G RSRL+ G ELK+ 
Sbjct  376  YDPKTPFFTSPRYLPPTKSDKCRIKEAIISHGCFLRECTIEHSIVGVRSRLNSGCELKNA  435

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGEN KI N IID N RIG+DV+I N +GV+E+D
Sbjct  436  MMMGADLYETEDEISRLLSEGKVPIGVGENAKISNCIIDMNARIGRDVIIANSEGVEEAD  495

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EG+YIRSGI +I++ ATI DGTV+
Sbjct  496  RAEEGYYIRSGIVVILKNATIKDGTVV  522



>gb|KCW46725.1| hypothetical protein EUGRSUZ_K00547 [Eucalyptus grandis]
Length=445

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+ P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+V+HSI+G RSRL+ GVE+KDT
Sbjct  299  YDPQKPIFTSPRFLPPTKIEKCQVIDSIISHGCFLRECSVQHSIVGVRSRLEYGVEIKDT  358

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E A+ LA+G VPIGVG +TKIRN IIDKN RIGK+VVI+NK  V E+D
Sbjct  359  MMMGADYYQTEAERAAFLAEGQVPIGVGRDTKIRNCIIDKNARIGKNVVIVNKGNVTEAD  418

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIRSGIT+I++ + IPDGT I
Sbjct  419  RPSDGFYIRSGITVILKNSVIPDGTTI  445



>gb|KHN20962.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=523

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD ++PF+TSPRFLPPTK   CKI DAIISHGCFL EC V+HSI+G RSRL+ G EL+DT
Sbjct  377  YDQESPFFTSPRFLPPTKAIKCKIVDAIISHGCFLSECRVQHSIVGVRSRLESGSELQDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+T+SEIA+LL +G VPIGVGENTKIRN IIDKN RIG++V+I N DGVQE+D
Sbjct  437  MMMGADYYQTDSEIATLLKEGKVPIGVGENTKIRNCIIDKNARIGRNVIIANTDGVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGI ++   ATI DGTVI
Sbjct  497  RPMEGFYIRSGIVVVANNATIEDGTVI  523



>ref|XP_003545270.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=523

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD ++PF+TSPRFLPPTK   CKI DAIISHGCFL EC V+HSI+G RSRL+ G EL+DT
Sbjct  377  YDQESPFFTSPRFLPPTKAIKCKIVDAIISHGCFLSECRVQHSIVGVRSRLESGSELQDT  436

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+T+SEIA+LL +G VPIGVGENTKIRN IIDKN RIG++V+I N DGVQE+D
Sbjct  437  MMMGADYYQTDSEIATLLKEGKVPIGVGENTKIRNCIIDKNARIGRNVIIANTDGVQEAD  496

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGI ++   ATI DGTVI
Sbjct  497  RPMEGFYIRSGIVVVANNATIEDGTVI  523



>ref|XP_002515141.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
 gb|EEF47125.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]
Length=528

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            +DP  P +TSPRFLPPTKI+ C++KD+IISHGCFLREC+VEHSI+G RSRL+ GVELKDT
Sbjct  382  FDPLKPIFTSPRFLPPTKIERCQVKDSIISHGCFLRECSVEHSIVGVRSRLEYGVELKDT  441

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E+A+ LA G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+D
Sbjct  442  MMMGADYYQTEAEVAASLAGGKVPIGVGQETKIMNCIIDKNARIGKNVVIANKDHVEEAD  501

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I DGT+I
Sbjct  502  RPSEGFYIRSGITVVLKNSEIKDGTII  528



>dbj|BAA23490.1| ADP glucose pyrophosphorylase large subunit [Oryza sativa Japonica 
Group]
Length=519

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK D C+IKDAIISHGC LRECT+ HSI+G RSRL+   ELK+T
Sbjct  373  YDPKTPFFTSPRYLPPTKSDKCRIKDAIISHGCLLRECTIGHSIVGVRSRLNSACELKNT  432

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++G VPIGVGENTKI N IID N R+G++VVI N +GVQESD
Sbjct  433  MMMGADLYETEDEISRLLSEGKVPIGVGENTKINNCIIDMNARVGRNVVITNSEGVQESD  492

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP+EG+YIRSGI +I++ ATI DG VI
Sbjct  493  RPEEGYYIRSGIVVILKNATIKDGKVI  519



>emb|CBI37074.3| unnamed protein product [Vitis vinifera]
Length=476

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT
Sbjct  330  YDPLKPIFTSPRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDT  389

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIA+ LA+G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+D
Sbjct  390  MMMGADYYQTEEEIAAFLAEGKVPIGVGKGTKIMNCIIDKNARIGKNVVITNKDKVEEAD  449

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I D T+I
Sbjct  450  RPSEGFYIRSGITVVLKNSVIMDETII  476



>ref|XP_006658430.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like, partial [Oryza brachyantha]
Length=426

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSP+FLPPTK++NCK+ ++I+SHGCFL EC+VEHS+IG RSRL+ GV+LKDT
Sbjct  280  YDPVKPIFTSPKFLPPTKVENCKVVNSIVSHGCFLTECSVEHSVIGVRSRLEPGVQLKDT  339

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E  S L+DG VPIG+GENTKIRN IIDKN RIGK+V+I N + VQE++
Sbjct  340  MMMGADYYQTEAERFSELSDGKVPIGLGENTKIRNCIIDKNARIGKNVLITNSENVQEAE  399

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT+I++ A IPDGTVI
Sbjct  400  RPLEGFYIRSGITVILKNAVIPDGTVI  426



>gb|AGT17354.1| ADP-glucose pyrophosphorylase [Saccharum hybrid cultivar R570]
Length=490

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPR+LPPTK + C+IKDAIISHGCFLREC +EHSI+G RSRL+ G ELK+T
Sbjct  344  YDPKTPFFTSPRYLPPTKSEKCRIKDAIISHGCFLRECAIEHSIVGVRSRLNSGCELKNT  403

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD YETE EI+ LL++  VPIGVGENTKI N IID N R+G++V I N +GVQE+D
Sbjct  404  MMMGADLYETEDEISRLLSECKVPIGVGENTKISNCIIDMNARVGRNVSITNTEGVQEAD  463

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP++G+YIRSG+ +I++ ATI DGTVI
Sbjct  464  RPEQGYYIRSGVVVILKNATIKDGTVI  490



>ref|XP_003549440.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit, 
chloroplastic/amyloplastic-like [Glycine max]
Length=524

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD +TPF+TSPRFLPPTK   CKI DAIISHGCFL E  V+HSI+G RSRL+ G EL+DT
Sbjct  378  YDQETPFFTSPRFLPPTKAIKCKIMDAIISHGCFLSESRVQHSIVGVRSRLESGSELQDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+T+SEIA+LL +G VPIGVGENT+IRN IIDKN RIG++V+I N DGVQE+D
Sbjct  438  MMMGADYYQTDSEIATLLEEGKVPIGVGENTRIRNCIIDKNARIGRNVIIANTDGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGI ++++ ATI DGTVI
Sbjct  498  RPAEGFYIRSGIVVVVKNATIEDGTVI  524



>ref|XP_004289659.1| PREDICTED: LOW QUALITY PROTEIN: glucose-1-phosphate adenylyltransferase 
large subunit 1-like [Fragaria vesca subsp. vesca]
Length=507

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKIDN ++ DAIISHGCFL+EC V+ SI+GERSRLD GVELKD+
Sbjct  369  YDPKTPFFTSPRFLPPTKIDNSRVVDAIISHGCFLQECLVQSSIVGERSRLDYGVELKDS  428

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD+Y+TESEIA+LLA G VPIG+G NTKIR  IIDKN +IGKDV+IMNKDGVQE+D
Sbjct  429  IMMGADSYQTESEIAALLARGKVPIGIGRNTKIRKCIIDKNAKIGKDVIIMNKDGVQEAD  488

Query  386  RPDEGFYIR  360
            RPDEGFYIR
Sbjct  489  RPDEGFYIR  497



>ref|XP_010035362.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Eucalyptus grandis]
Length=524

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP+ P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+V+HSI+G RSRL+ GVE+KDT
Sbjct  378  YDPQKPIFTSPRFLPPTKIEKCQVIDSIISHGCFLRECSVQHSIVGVRSRLEYGVEIKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E A+ LA+G VPIGVG +TKIRN IIDKN RIGK+VVI+NK  V E+D
Sbjct  438  MMMGADYYQTEAERAAFLAEGQVPIGVGRDTKIRNCIIDKNARIGKNVVIVNKGNVTEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP +GFYIRSGIT+I++ + IPDGT I
Sbjct  498  RPSDGFYIRSGITVILKNSVIPDGTTI  524



>emb|CDX84911.1| BnaC05g21440D [Brassica napus]
Length=510

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 128/147 (87%), Gaps = 5/147 (3%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDPKTPF+TSPRFLPPTKI      D+I+SHGCFLREC+V+HSI+G RSR++ GVEL+DT
Sbjct  369  YDPKTPFFTSPRFLPPTKI-----LDSIVSHGCFLRECSVQHSIVGIRSRVESGVELQDT  423

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIASLLA+G VPIGVGENTKIRN IIDKN +IGK+VVI N DGV+E D
Sbjct  424  MMMGADFYQTEAEIASLLAEGKVPIGVGENTKIRNCIIDKNAKIGKNVVIANADGVEEGD  483

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            R +EGFYIRSGIT++++ ATI DG V+
Sbjct  484  RQEEGFYIRSGITVVLKNATIRDGLVL  510



>ref|XP_010652349.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like isoform X2 [Vitis vinifera]
Length=486

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT
Sbjct  340  YDPLKPIFTSPRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDT  399

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIA+ LA+G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+D
Sbjct  400  MMMGADYYQTEEEIAAFLAEGKVPIGVGKGTKIMNCIIDKNARIGKNVVITNKDKVEEAD  459

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I D T+I
Sbjct  460  RPSEGFYIRSGITVVLKNSVIMDETII  486



>ref|XP_006841529.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
 gb|ERN03204.1| hypothetical protein AMTR_s00003p00152830 [Amborella trichopoda]
Length=531

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPRFLPP+K++ C++ DAI+SHGCFLREC+V+H+I+G RSRL+ GVELKDT
Sbjct  385  YDPLKPIFTSPRFLPPSKMEKCQVVDAIVSHGCFLRECSVQHAIVGIRSRLEYGVELKDT  444

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+EIA+ LA G VPIGVG+NTKIR  IIDKN +IGK+V+I N+D VQE++
Sbjct  445  MMMGADYYQTEAEIAACLARGEVPIGVGQNTKIRKCIIDKNAKIGKNVIISNRDDVQEAE  504

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ ATI DGTVI
Sbjct  505  RPTEGFYIRSGITVVLKNATIEDGTVI  531



>ref|XP_002994500.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
 gb|EFJ04435.1| hypothetical protein SELMODRAFT_138695, partial [Selaginella 
moellendorffii]
Length=447

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD   P YTSPR+LPPTKI+ C++ D+I+SHGCFL+EC+V HS+IG RSR++ G E++DT
Sbjct  301  YDAAKPIYTSPRYLPPTKIEKCRVLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAEIQDT  360

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD YETE+EIAS++A+G VP+GVG+N KIRN I+DKNVRIGK+VVI NKD VQE++
Sbjct  361  MMLGADFYETEAEIASMVAEGKVPVGVGQNAKIRNCILDKNVRIGKNVVIANKDNVQEAE  420

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +P EG+YIRSGIT+I++ ATI DGTVI
Sbjct  421  KPSEGYYIRSGITVILKNATIADGTVI  447



>ref|XP_011039886.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039894.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
 ref|XP_011039900.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Populus euphratica]
Length=530

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            +DP  P +TSPRFLPPTKI+ C++KD+I+SHGCFLREC+VEHSI+G RSRL+ GVELKDT
Sbjct  384  FDPLKPIFTSPRFLPPTKIEKCRVKDSIVSHGCFLRECSVEHSIVGIRSRLEYGVELKDT  443

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE+EIA+ LA+G VP+GVG++TKI N IIDKN RIGK V I NK+GVQE++
Sbjct  444  MMIGADYYQTEAEIAASLAEGRVPVGVGKDTKIMNCIIDKNARIGKKVTIANKEGVQEAE  503

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I DGT+I
Sbjct  504  RPSEGFYIRSGITVVLKNSVIKDGTII  530



>ref|XP_002970384.1| hypothetical protein SELMODRAFT_231637 [Selaginella moellendorffii]
 gb|EFJ28514.1| hypothetical protein SELMODRAFT_231637 [Selaginella moellendorffii]
Length=460

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD   P YTSPR+LPPTKI+ C++ D+I+SHGCFL+EC+V HS+IG RSR++ G E++DT
Sbjct  314  YDAAKPIYTSPRYLPPTKIEKCRVLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAEIQDT  373

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD YETE+EIAS++A+G VP+GVG+N KIRN I+DKNVRIGK+VVI NKD VQE++
Sbjct  374  MMLGADFYETEAEIASMVAEGKVPVGVGQNAKIRNCILDKNVRIGKNVVIANKDNVQEAE  433

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +P EG+YIRSGIT+I++ ATI DGTVI
Sbjct  434  KPSEGYYIRSGITVILKNATIADGTVI  460



>ref|XP_004959119.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
2, chloroplastic-like [Setaria italica]
Length=652

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPRFLPPT+++NCK+ ++I+SHGCFL EC+VEHS+IG RSRL+ GV+LKDT
Sbjct  506  YDPVKPIFTSPRFLPPTRVENCKVLNSIVSHGCFLTECSVEHSVIGIRSRLEQGVQLKDT  565

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E  S L+DG VP+GVGENT IRN IIDKN RIGK+VVIMN D VQE+D
Sbjct  566  MMMGADYYQTEAERCSELSDGKVPVGVGENTIIRNCIIDKNARIGKNVVIMNSDNVQEAD  625

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ A IPDGT I
Sbjct  626  RPAEGFYIRSGITVVLKNAVIPDGTTI  652



>ref|XP_002274245.2| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010652348.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Vitis vinifera]
Length=514

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPRFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT
Sbjct  368  YDPLKPIFTSPRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDT  427

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIA+ LA+G VPIGVG+ TKI N IIDKN RIGK+VVI NKD V+E+D
Sbjct  428  MMMGADYYQTEEEIAAFLAEGKVPIGVGKGTKIMNCIIDKNARIGKNVVITNKDKVEEAD  487

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I D T+I
Sbjct  488  RPSEGFYIRSGITVVLKNSVIMDETII  514



>gb|KHN12692.1| Glucose-1-phosphate adenylyltransferase large subunit, chloroplastic/amyloplastic 
[Glycine soja]
Length=524

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD ++PF+TSPRFLPPTK   CKI DAIISHGCFL E  V+HSI+G RSRL+ G EL+DT
Sbjct  378  YDQESPFFTSPRFLPPTKAIKCKIMDAIISHGCFLSESRVQHSIVGVRSRLESGSELQDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+T+SEIA+LL +G VPIGVGENT+IRN IIDKN RIG++V+I N DGVQE+D
Sbjct  438  MMMGADYYQTDSEIATLLEEGKVPIGVGENTRIRNCIIDKNARIGRNVIIANTDGVQEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGI ++++ ATI DGTVI
Sbjct  498  RPAEGFYIRSGIVVVVKNATIEDGTVI  524



>gb|AEV40472.1| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]
 gb|AEV40473.1| ADP-glucose pyrophosphorylase 2 [Spirodela polyrhiza]
Length=536

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPRFLPPTKI+ C++ ++I+SHGCFL ECTVEHSIIG RSRL+ G EL DT
Sbjct  390  YDPSKPIFTSPRFLPPTKIEKCRVLNSIVSHGCFLNECTVEHSIIGVRSRLESGAELVDT  449

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            ++MGAD Y+TE+EIAS+LA+G VPIG+G NTKIRN IIDKN +IG+DVVI N + V+E++
Sbjct  450  MVMGADYYQTEAEIASILAEGKVPIGIGRNTKIRNCIIDKNAKIGRDVVIANSEKVEEAE  509

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ ATIP+GTVI
Sbjct  510  RPSEGFYIRSGITVVVKNATIPNGTVI  536



>ref|XP_008799957.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
 ref|XP_008799959.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like [Phoenix dactylifera]
Length=536

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            +DPK P +TSPRFLPPTKI+ C++ D+IISHGCFL +C+V+HSI+G RSRL+ G ELKDT
Sbjct  390  HDPKKPIFTSPRFLPPTKIEKCRVVDSIISHGCFLTQCSVKHSIVGVRSRLEYGAELKDT  449

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E AS LA+G VP+GVGENT+IRN IIDKN RIGKDV+I N D V+E+D
Sbjct  450  MMMGADYYQTEAERASFLAEGKVPVGVGENTRIRNCIIDKNARIGKDVIIANADNVEEAD  509

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +P +GFYIRSGIT++++ + IPDGT+I
Sbjct  510  KPSDGFYIRSGITVVLKNSVIPDGTII  536



>ref|XP_002968152.1| hypothetical protein SELMODRAFT_169778 [Selaginella moellendorffii]
 gb|EFJ30406.1| hypothetical protein SELMODRAFT_169778 [Selaginella moellendorffii]
Length=463

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YD   P YTSPR+LPPTKI+ C++ D+I+SHGCFL+EC+V HS+IG RSR++ G E++DT
Sbjct  317  YDAAKPIYTSPRYLPPTKIEKCRVLDSIVSHGCFLQECSVTHSVIGIRSRVEAGAEIQDT  376

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD YETE+EIAS++A+G VP+GVG+N KIRN I+DKNVRIGK+VVI NKD VQE++
Sbjct  377  MMLGADFYETEAEIASMVAEGKVPVGVGQNAKIRNCILDKNVRIGKNVVIANKDNVQEAE  436

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +P EG+YIRSGIT+I++ ATI DGTVI
Sbjct  437  KPSEGYYIRSGITVILKNATIADGTVI  463



>ref|XP_002320247.2| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 ref|XP_006375412.1| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 gb|EEE98562.2| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
 gb|ERP53209.1| hypothetical protein POPTR_0014s10560g [Populus trichocarpa]
Length=530

 Score =   224 bits (571),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            +DP  P +TSPRFLPPTKI+ C++KD+I+SHGCFLREC+VE SI+G RSRL+ GVELKDT
Sbjct  384  FDPLKPIFTSPRFLPPTKIEKCRVKDSIVSHGCFLRECSVERSIVGVRSRLEYGVELKDT  443

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +M+GAD Y+TE+EIA+ LA+G VP+GVG++TKI N IIDKN RIGK+V+I NK+GVQE++
Sbjct  444  MMIGADYYQTEAEIAASLAEGRVPVGVGKDTKIMNCIIDKNARIGKNVIIANKEGVQEAE  503

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I DGT+I
Sbjct  504  RPSEGFYIRSGITVVLKNSVIKDGTII  530



>emb|CAN67125.1| hypothetical protein VITISV_040166 [Vitis vinifera]
Length=452

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TS RFLPPTKI+ C++ D+IISHGCFLREC+VEHSI+G RSRLD GVE+KDT
Sbjct  306  YDPLKPIFTSSRFLPPTKIEKCRVMDSIISHGCFLRECSVEHSIVGIRSRLDYGVEMKDT  365

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE EIA+ LA+G VPIGVG++TKI N IIDKN RIGK+VVI NKD V+E+D
Sbjct  366  MMMGADYYQTEEEIAAFLAEGKVPIGVGKDTKIMNCIIDKNARIGKNVVITNKDKVEEAD  425

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ + I D T+I
Sbjct  426  RPSEGFYIRSGITVVLKNSVIMDETII  452



>gb|KJB09550.1| hypothetical protein B456_001G149300 [Gossypium raimondii]
 gb|KJB09551.1| hypothetical protein B456_001G149300 [Gossypium raimondii]
Length=524

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            YDP  P +TSPR+LPP++I+ C++ D+IISHGCFLREC+V+HSI+G RSRL+ GVELKDT
Sbjct  378  YDPLKPIFTSPRYLPPSRIEQCRVVDSIISHGCFLRECSVKHSIVGIRSRLEYGVELKDT  437

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            LMMGAD+Y+TE+EIAS +++GN+P+G+G NTKI N IID N RIGK+VVI NKD V+E+D
Sbjct  438  LMMGADHYQTEAEIASCISEGNIPLGIGRNTKIMNCIIDTNTRIGKNVVIANKDNVEEAD  497

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            RP EGFYIRSGIT++++ A I DGT+I
Sbjct  498  RPSEGFYIRSGITVVVKNAVIKDGTII  524



>ref|XP_010323162.1| PREDICTED: ADP-glucose pyrophosphorylase large subunit isoform 
X2 [Solanum lycopersicum]
Length=544

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 127/172 (74%), Gaps = 26/172 (15%)
 Frame = -1

Query  743  DPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDTL  564
            DPKTPFYTS RFLPPTK+D  +I DAIISHGCFLREC ++HSI+G RSRLD GVE KDT+
Sbjct  373  DPKTPFYTSARFLPPTKVDKSRIVDAIISHGCFLRECNIQHSIVGVRSRLDYGVEFKDTM  432

Query  563  MMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNK--------  408
            MMGAD Y+TESEIASLLA+G VPIGVG NTKI+  IIDKN +IGKDVVI+NK        
Sbjct  433  MMGADYYQTESEIASLLAEGKVPIGVGPNTKIQKCIIDKNAKIGKDVVILNKQASIFFLK  492

Query  407  ------------------DGVQESDRPDEGFYIRSGITIIMEKATIPDGTVI  306
                               GV+E+DR  EGFYIRSGIT+IM+ ATI DGTVI
Sbjct  493  FEIITKVNISLTDAWMLLQGVEEADRSAEGFYIRSGITVIMKNATIKDGTVI  544



>ref|XP_010914841.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 
1-like isoform X1 [Elaeis guineensis]
Length=537

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  746  YDPKTPFYTSPRFLPPTKIDNCKIKDAIISHGCFLRECTVEHSIIGERSRLDCGVELKDT  567
            +DPK P +TSPRFLPPTKI+ C++ D+IISHGCFL +C++EHSI+G RSRL+ GVELKDT
Sbjct  391  HDPKKPIFTSPRFLPPTKIEQCRVVDSIISHGCFLTQCSIEHSIVGVRSRLEYGVELKDT  450

Query  566  LMMGADNYETESEIASLLADGNVPIGVGENTKIRNAIIDKNVRIGKDVVIMNKDGVQESD  387
            +MMGAD Y+TE+E AS LA+G VP+GVGEN+KIRN IIDKN RIGK V+I N D V+E+D
Sbjct  451  MMMGADYYQTEAERASFLAEGKVPVGVGENSKIRNCIIDKNGRIGKSVIIANADNVEEAD  510

Query  386  RPDEGFYIRSGITIIMEKATIPDGTVI  306
            +P +GFYIRSGIT++++ + IPDGT+I
Sbjct  511  KPTDGFYIRSGITVVLKNSVIPDGTII  537



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420