BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043K13

Length=835
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341815.1|  PREDICTED: uncharacterized protein LOC102587665    389   1e-130   
ref|XP_006367511.1|  PREDICTED: uncharacterized protein LOC102589547    394   2e-130   
ref|XP_004239150.1|  PREDICTED: uncharacterized protein LOC101248575    389   2e-128   Solanum lycopersicum
ref|XP_004245178.1|  PREDICTED: uncharacterized protein LOC101258288    383   2e-126   
ref|XP_009765489.1|  PREDICTED: uncharacterized protein LOC104217035    383   3e-126   Nicotiana sylvestris
emb|CDP13254.1|  unnamed protein product                                374   3e-123   Coffea canephora [robusta coffee]
gb|KDP26669.1|  hypothetical protein JCGZ_17827                         361   7e-118   Jatropha curcas
gb|KHG05074.1|  Endoglucanase                                           353   9e-115   Gossypium arboreum [tree cotton]
gb|KJB15656.1|  hypothetical protein B456_002G188600                    351   6e-114   Gossypium raimondii
ref|XP_007044872.1|  Cellulase protein                                  351   9e-114   
ref|XP_011086688.1|  PREDICTED: uncharacterized protein LOC105168334    351   1e-113   Sesamum indicum [beniseed]
ref|XP_002515055.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    350   2e-113   Ricinus communis
ref|XP_011042367.1|  PREDICTED: uncharacterized protein LOC105138074    349   3e-113   Populus euphratica
ref|XP_010248702.1|  PREDICTED: uncharacterized protein LOC104591536    349   3e-113   Nelumbo nucifera [Indian lotus]
gb|KDO82153.1|  hypothetical protein CISIN_1g008330mg                   337   3e-111   Citrus sinensis [apfelsine]
ref|XP_002312657.2|  hypothetical protein POPTR_0008s18380g             343   1e-110   Populus trichocarpa [western balsam poplar]
gb|KDO82152.1|  hypothetical protein CISIN_1g008330mg                   337   4e-110   Citrus sinensis [apfelsine]
ref|XP_011034023.1|  PREDICTED: uncharacterized protein LOC105132312    340   1e-109   Populus euphratica
gb|KHN06535.1|  Endoglucanase                                           337   3e-109   Glycine soja [wild soybean]
ref|XP_002285424.1|  PREDICTED: uncharacterized protein LOC100244027    339   3e-109   Vitis vinifera
ref|XP_006483983.1|  PREDICTED: uncharacterized protein LOC102624331    339   7e-109   Citrus sinensis [apfelsine]
gb|KDO82151.1|  hypothetical protein CISIN_1g008330mg                   338   9e-109   Citrus sinensis [apfelsine]
ref|XP_006438205.1|  hypothetical protein CICLE_v10031098mg             338   9e-109   Citrus clementina [clementine]
ref|XP_004504142.1|  PREDICTED: uncharacterized protein LOC101503968    334   2e-107   Cicer arietinum [garbanzo]
ref|XP_011042368.1|  PREDICTED: uncharacterized protein LOC105138075    331   2e-106   Populus euphratica
ref|XP_010100346.1|  hypothetical protein L484_027655                   331   4e-106   
ref|XP_008389746.1|  PREDICTED: uncharacterized protein LOC103452050    329   2e-105   
ref|XP_007159685.1|  hypothetical protein PHAVU_002G258500g             328   6e-105   Phaseolus vulgaris [French bean]
ref|XP_009359244.1|  PREDICTED: uncharacterized protein LOC103949843    326   2e-104   Pyrus x bretschneideri [bai li]
gb|KHN29014.1|  Endoglucanase                                           325   4e-104   Glycine soja [wild soybean]
ref|XP_003532808.1|  PREDICTED: uncharacterized protein LOC100818309    325   1e-103   Glycine max [soybeans]
ref|XP_004309996.1|  PREDICTED: uncharacterized protein LOC101307271    323   3e-103   Fragaria vesca subsp. vesca
gb|KEH20742.1|  cellulase (glycosyl hydrolase family 5)                 323   4e-103   Medicago truncatula
gb|KHN29015.1|  E3 ubiquitin-protein ligase RGLG2                       327   7e-102   Glycine soja [wild soybean]
ref|XP_010044528.1|  PREDICTED: uncharacterized protein LOC104433472    320   1e-101   Eucalyptus grandis [rose gum]
gb|KHN19917.1|  hypothetical protein glysoja_032397                     316   2e-101   Glycine soja [wild soybean]
ref|XP_003539156.1|  PREDICTED: uncharacterized protein LOC100816102    317   1e-100   Glycine max [soybeans]
ref|XP_004170960.1|  PREDICTED: uncharacterized LOC101217177            312   1e-100   
ref|XP_003524249.1|  PREDICTED: uncharacterized protein LOC100789885    317   2e-100   Glycine max [soybeans]
ref|XP_008446127.1|  PREDICTED: uncharacterized protein LOC103488945    316   3e-100   Cucumis melo [Oriental melon]
gb|KHN06534.1|  Endoglucanase                                           314   2e-99    Glycine soja [wild soybean]
ref|XP_004135502.1|  PREDICTED: uncharacterized protein LOC101217177    313   2e-99    
gb|KGN51727.1|  hypothetical protein Csa_5G593400                       313   2e-99    Cucumis sativus [cucumbers]
ref|XP_008221942.1|  PREDICTED: uncharacterized protein LOC103321869    313   7e-99    
gb|KHG22500.1|  Endoglucanase E1                                        308   7e-98    Gossypium arboreum [tree cotton]
ref|XP_007223308.1|  hypothetical protein PRUPE_ppa003807mg             309   7e-98    Prunus persica
ref|XP_007132485.1|  hypothetical protein PHAVU_011G098000g             308   1e-97    Phaseolus vulgaris [French bean]
gb|KJB78033.1|  hypothetical protein B456_012G173600                    309   2e-97    Gossypium raimondii
gb|EPS61076.1|  hypothetical protein M569_13724                         301   2e-96    Genlisea aurea
ref|XP_010904543.1|  PREDICTED: uncharacterized protein LOC105031942    304   1e-95    Elaeis guineensis
ref|XP_007159684.1|  hypothetical protein PHAVU_002G258400g             303   3e-95    Phaseolus vulgaris [French bean]
ref|XP_008236799.1|  PREDICTED: uncharacterized protein LOC103335561    302   6e-95    Prunus mume [ume]
ref|XP_010250986.1|  PREDICTED: uncharacterized protein LOC104593039    301   4e-94    Nelumbo nucifera [Indian lotus]
ref|XP_008793719.1|  PREDICTED: uncharacterized protein LOC103709945    287   1e-89    
ref|XP_004504189.1|  PREDICTED: uncharacterized protein LOC101490831    286   4e-89    Cicer arietinum [garbanzo]
gb|AES72136.2|  cellulase (glycosyl hydrolase family 5)                 288   5e-89    Medicago truncatula
ref|XP_008389747.1|  PREDICTED: uncharacterized protein LOC103452051    285   3e-88    
ref|XP_003601885.1|  Endoglucanase                                      285   3e-87    
gb|KHN43979.1|  Endoglucanase E1                                        279   4e-87    Glycine soja [wild soybean]
ref|XP_010026597.1|  PREDICTED: uncharacterized protein LOC104416968    280   9e-87    
ref|XP_003552802.1|  PREDICTED: uncharacterized protein LOC100805196    279   2e-86    Glycine max [soybeans]
ref|XP_009385963.1|  PREDICTED: uncharacterized protein LOC103973...    278   7e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385956.1|  PREDICTED: uncharacterized protein LOC103973...    278   1e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010250979.1|  PREDICTED: uncharacterized protein LOC104593...    276   5e-85    
ref|XP_010250982.1|  PREDICTED: uncharacterized protein LOC104593...    276   5e-85    
ref|XP_010682344.1|  PREDICTED: uncharacterized protein LOC104897211    275   2e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010026596.1|  PREDICTED: uncharacterized protein LOC104416965    273   5e-84    
gb|EYU30606.1|  hypothetical protein MIMGU_mgv1a018920mg                270   3e-83    Erythranthe guttata [common monkey flower]
ref|XP_010528075.1|  PREDICTED: uncharacterized protein LOC104805267    271   7e-83    Tarenaya hassleriana [spider flower]
ref|XP_010249431.1|  PREDICTED: uncharacterized protein LOC104591975    269   3e-82    Nelumbo nucifera [Indian lotus]
ref|XP_008793758.1|  PREDICTED: uncharacterized protein LOC103709981    268   5e-82    
ref|XP_010026600.1|  PREDICTED: uncharacterized protein LOC104416972    268   5e-81    Eucalyptus grandis [rose gum]
emb|CAN62580.1|  hypothetical protein VITISV_036569                     255   5e-81    Vitis vinifera
ref|XP_010249430.1|  PREDICTED: uncharacterized protein LOC104591974    265   7e-81    
emb|CAN72915.1|  hypothetical protein VITISV_020826                     253   3e-80    Vitis vinifera
emb|CAN73208.1|  hypothetical protein VITISV_009079                     253   6e-80    Vitis vinifera
ref|XP_010556349.1|  PREDICTED: uncharacterized protein LOC104825675    263   7e-80    Tarenaya hassleriana [spider flower]
ref|XP_010904544.1|  PREDICTED: uncharacterized protein LOC105031943    263   9e-80    Elaeis guineensis
gb|KFK33555.1|  hypothetical protein AALP_AA5G028800                    262   1e-79    Arabis alpina [alpine rockcress]
ref|XP_004975980.1|  PREDICTED: uncharacterized protein LOC101758857    262   2e-79    Setaria italica
emb|CDX83590.1|  BnaC07g23300D                                          261   5e-79    
gb|ACN33507.1|  unknown                                                 254   9e-79    Zea mays [maize]
ref|XP_002284888.2|  PREDICTED: uncharacterized protein LOC100258876    259   1e-78    Vitis vinifera
ref|XP_010514258.1|  PREDICTED: uncharacterized protein LOC104790245    259   2e-78    Camelina sativa [gold-of-pleasure]
emb|CDY13613.1|  BnaA06g33100D                                          259   3e-78    Brassica napus [oilseed rape]
ref|XP_010556350.1|  PREDICTED: uncharacterized protein LOC104825676    258   6e-78    Tarenaya hassleriana [spider flower]
ref|XP_009152076.1|  PREDICTED: uncharacterized protein LOC103875318    258   8e-78    Brassica rapa
gb|EAY94563.1|  hypothetical protein OsI_16341                          257   1e-77    Oryza sativa Indica Group [Indian rice]
gb|EMT27118.1|  hypothetical protein F775_19072                         257   1e-77    
emb|CAD41089.2|  OSJNBb0011N17.6                                        256   2e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002446674.1|  hypothetical protein SORBIDRAFT_06g020260          256   2e-77    Sorghum bicolor [broomcorn]
emb|CAH67676.1|  H0510A06.1                                             256   2e-77    Oryza sativa [red rice]
ref|XP_010026595.1|  PREDICTED: uncharacterized protein LOC104416964    256   2e-77    Eucalyptus grandis [rose gum]
ref|XP_010502521.1|  PREDICTED: uncharacterized protein LOC104779823    256   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_002284895.1|  PREDICTED: uncharacterized protein LOC100253729    255   3e-77    Vitis vinifera
gb|AAS00040.1|  unknown                                                 245   6e-77    Vitis riparia [frost grape]
ref|NP_001132121.1|  hypothetical protein precursor                     255   7e-77    Zea mays [maize]
dbj|BAK00694.1|  predicted protein                                      254   1e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002876947.1|  predicted protein                                  254   1e-76    
gb|KCW59700.1|  hypothetical protein EUGRSUZ_H02458                     253   2e-76    Eucalyptus grandis [rose gum]
dbj|BAB02432.1|  unnamed protein product                                254   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290844.1|  hypothetical protein CARUB_v10016955mg             254   2e-76    
gb|AIZ06017.1|  hypothetical protein                                    254   3e-76    Zea nicaraguensis
ref|XP_010248706.1|  PREDICTED: uncharacterized protein LOC104591...    253   4e-76    Nelumbo nucifera [Indian lotus]
emb|CAN60394.1|  hypothetical protein VITISV_015741                     241   2e-75    Vitis vinifera
emb|CBI20318.3|  unnamed protein product                                245   3e-75    Vitis vinifera
emb|CAD41090.2|  OSJNBb0011N17.7                                        250   8e-75    Oryza sativa Japonica Group [Japonica rice]
gb|KCW59699.1|  hypothetical protein EUGRSUZ_H02457                     249   8e-75    Eucalyptus grandis [rose gum]
gb|EEE61202.1|  hypothetical protein OsJ_15212                          249   1e-74    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77495.1|  hypothetical protein OsI_16343                          249   1e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_010248705.1|  PREDICTED: uncharacterized protein LOC104591...    249   1e-74    Nelumbo nucifera [Indian lotus]
ref|XP_002889989.1|  glycosyl hydrolase family 5 protein                249   2e-74    Arabidopsis lyrata subsp. lyrata
emb|CAH67677.1|  H0510A06.2                                             249   2e-74    Oryza sativa [red rice]
ref|XP_006652422.1|  PREDICTED: uncharacterized protein LOC102702088    247   5e-74    Oryza brachyantha
ref|XP_002284881.1|  PREDICTED: uncharacterized protein LOC100264047    246   6e-74    Vitis vinifera
gb|AAD31066.1|AC007357_15  F3F19.15                                     246   8e-74    Arabidopsis thaliana [mouse-ear cress]
ref|NP_172772.2|  Cellulase (glycosyl hydrolase family 5) protein       247   9e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395581.1|  hypothetical protein EUTSA_v10003934mg             244   7e-73    
ref|XP_003579979.1|  PREDICTED: uncharacterized protein LOC100845861    244   9e-73    Brachypodium distachyon [annual false brome]
ref|NP_189244.1|  Cellulase (glycosyl hydrolase family 5) protein       244   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417151.1|  hypothetical protein EUTSA_v10007253mg             238   3e-70    Eutrema salsugineum [saltwater cress]
ref|XP_010494994.1|  PREDICTED: uncharacterized protein LOC104772040    229   4e-69    
ref|XP_006307168.1|  hypothetical protein CARUB_v10008758mg             234   9e-69    Capsella rubella
gb|KCW59701.1|  hypothetical protein EUGRSUZ_H02460                     225   1e-68    Eucalyptus grandis [rose gum]
gb|EEC77494.1|  hypothetical protein OsI_16340                          231   7e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_004975985.1|  PREDICTED: uncharacterized protein LOC101760765    231   9e-68    Setaria italica
ref|NP_001053105.1|  Os04g0480900                                       231   1e-67    
ref|XP_010495004.1|  PREDICTED: uncharacterized protein LOC104772051    231   1e-67    Camelina sativa [gold-of-pleasure]
emb|CAH66880.1|  OSIGBa0158F13.11                                       231   1e-67    Oryza sativa [red rice]
ref|XP_010458756.1|  PREDICTED: uncharacterized protein LOC104739...    230   1e-67    
emb|CDY16066.1|  BnaC08g40570D                                          230   2e-67    Brassica napus [oilseed rape]
ref|XP_010458755.1|  PREDICTED: uncharacterized protein LOC104739...    229   4e-67    Camelina sativa [gold-of-pleasure]
ref|NP_189245.1|  Cellulase (glycosyl hydrolase family 5) protein       228   8e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010240029.1|  PREDICTED: uncharacterized protein LOC100839976    228   2e-66    Brachypodium distachyon [annual false brome]
dbj|BAK05121.1|  predicted protein                                      228   2e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010476303.1|  PREDICTED: uncharacterized protein LOC104755594    228   3e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010691763.1|  PREDICTED: uncharacterized protein LOC104905020    226   3e-66    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006292902.1|  hypothetical protein CARUB_v10019167mg             226   4e-66    
ref|XP_010425288.1|  PREDICTED: uncharacterized protein LOC104710406    226   6e-66    Camelina sativa [gold-of-pleasure]
ref|XP_010501449.1|  PREDICTED: uncharacterized protein LOC104778702    218   6e-66    
ref|XP_009381699.1|  PREDICTED: uncharacterized protein LOC103969775    224   6e-66    
ref|XP_002876948.1|  glycosyl hydrolase family 5 protein                225   7e-66    
ref|XP_009148543.1|  PREDICTED: uncharacterized protein LOC103871957    226   1e-65    Brassica rapa
emb|CDY19395.1|  BnaC05g09040D                                          224   2e-65    Brassica napus [oilseed rape]
ref|XP_006400290.1|  hypothetical protein EUTSA_v10015581mg             221   3e-64    Eutrema salsugineum [saltwater cress]
ref|XP_010502524.1|  PREDICTED: uncharacterized protein LOC104779826    221   5e-64    
emb|CBI20316.3|  unnamed protein product                                210   5e-64    Vitis vinifera
emb|CDX98009.1|  BnaA06g07600D                                          219   3e-63    
ref|NP_197252.1|  Glycosyl hydrolase superfamily protein                218   7e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871770.1|  glycosyl hydrolase family 5 protein                218   7e-63    
ref|XP_004955049.1|  PREDICTED: uncharacterized protein LOC101776534    218   7e-63    Setaria italica
emb|CBI20314.3|  unnamed protein product                                206   2e-62    Vitis vinifera
gb|KFK38059.1|  hypothetical protein AALP_AA3G064700                    214   2e-62    Arabis alpina [alpine rockcress]
ref|XP_006289374.1|  hypothetical protein CARUB_v10002868mg             216   3e-62    Capsella rubella
ref|XP_010492706.1|  PREDICTED: uncharacterized protein LOC104770057    215   5e-62    Camelina sativa [gold-of-pleasure]
emb|CDY13614.1|  BnaA06g33090D                                          214   6e-62    Brassica napus [oilseed rape]
ref|XP_010420476.1|  PREDICTED: uncharacterized protein LOC104706046    215   7e-62    Camelina sativa [gold-of-pleasure]
ref|XP_009152075.1|  PREDICTED: uncharacterized protein LOC103875317    215   7e-62    Brassica rapa
emb|CDY38435.1|  BnaA10g17230D                                          215   8e-62    Brassica napus [oilseed rape]
ref|XP_009107523.1|  PREDICTED: uncharacterized protein LOC103833179    214   1e-61    Brassica rapa
emb|CDY16914.1|  BnaC09g40410D                                          214   1e-61    Brassica napus [oilseed rape]
ref|XP_002446675.1|  hypothetical protein SORBIDRAFT_06g020270          213   9e-61    Sorghum bicolor [broomcorn]
emb|CDX83591.1|  BnaC07g23310D                                          210   1e-60    
gb|ACF85134.1|  unknown                                                 211   1e-60    Zea mays [maize]
ref|XP_004975262.1|  PREDICTED: uncharacterized protein LOC101779133    213   2e-60    Setaria italica
ref|NP_001130915.1|  hydrolase, hydrolyzing O-glycosyl compound p...    211   6e-60    Zea mays [maize]
gb|ACF79301.1|  unknown                                                 210   1e-59    Zea mays [maize]
ref|XP_002452393.1|  hypothetical protein SORBIDRAFT_04g024910          209   4e-59    
ref|XP_010549752.1|  PREDICTED: uncharacterized protein LOC104820833    207   5e-59    Tarenaya hassleriana [spider flower]
gb|EAY86525.1|  hypothetical protein OsI_07905                          207   3e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_008678768.1|  PREDICTED: uncharacterized protein LOC100501...    205   6e-58    Zea mays [maize]
ref|XP_008678767.1|  PREDICTED: uncharacterized protein LOC100501...    205   1e-57    Zea mays [maize]
emb|CDY26627.1|  BnaA09g46500D                                          193   2e-55    Brassica napus [oilseed rape]
gb|KFK43579.1|  hypothetical protein AALP_AA1G144700                    198   1e-54    Arabis alpina [alpine rockcress]
ref|XP_006395580.1|  hypothetical protein EUTSA_v10003968mg             193   1e-53    Eutrema salsugineum [saltwater cress]
emb|CBI16819.3|  unnamed protein product                                187   2e-53    Vitis vinifera
ref|XP_010662248.1|  PREDICTED: thylakoid lumenal protein At1g122...    186   5e-53    Vitis vinifera
gb|KFK25904.1|  hypothetical protein AALP_AA8G177600                    187   1e-51    Arabis alpina [alpine rockcress]
gb|EMT10461.1|  Endoglucanase E1                                        187   2e-51    
ref|XP_002272386.2|  PREDICTED: uncharacterized protein LOC100250178    187   2e-51    Vitis vinifera
emb|CBI34407.3|  unnamed protein product                                185   4e-51    Vitis vinifera
ref|XP_002272534.1|  PREDICTED: uncharacterized protein LOC100257079    186   7e-51    Vitis vinifera
emb|CBI34404.3|  unnamed protein product                                186   7e-51    Vitis vinifera
ref|XP_002272422.2|  PREDICTED: uncharacterized protein LOC100245045    185   1e-50    Vitis vinifera
ref|XP_010514260.1|  PREDICTED: uncharacterized protein LOC104790246    184   3e-50    
emb|CDY38093.1|  BnaC02g06800D                                          179   3e-49    Brassica napus [oilseed rape]
emb|CDX89335.1|  BnaA01g15580D                                          179   1e-48    
ref|XP_010266913.1|  PREDICTED: plastocyanin, chloroplastic-like        174   2e-48    Nelumbo nucifera [Indian lotus]
emb|CDY38091.1|  BnaC02g06820D                                          178   4e-48    Brassica napus [oilseed rape]
ref|XP_006378255.1|  hypothetical protein POPTR_0010s05970g             164   8e-47    
ref|XP_009121460.1|  PREDICTED: uncharacterized protein LOC103846306    174   1e-46    Brassica rapa
emb|CDX69429.1|  BnaA10g17780D                                          173   2e-46    
gb|KGN50360.1|  hypothetical protein Csa_5G168960                       168   9e-46    Cucumis sativus [cucumbers]
ref|XP_010437042.1|  PREDICTED: uncharacterized protein LOC104720...    171   2e-45    Camelina sativa [gold-of-pleasure]
ref|XP_010492588.1|  PREDICTED: uncharacterized protein LOC104769...    170   4e-45    Camelina sativa [gold-of-pleasure]
emb|CDX69431.1|  BnaA10g17800D                                          167   7e-45    
gb|ABR17494.1|  unknown                                                 168   2e-44    Picea sitchensis
ref|XP_004143723.1|  PREDICTED: uncharacterized protein LOC101213113    168   3e-44    Cucumis sativus [cucumbers]
emb|CDY16991.1|  BnaC09g41180D                                          166   6e-44    Brassica napus [oilseed rape]
ref|XP_006395579.1|  hypothetical protein EUTSA_v10003968mg             166   1e-43    
ref|XP_003608279.1|  Endoglucanase                                      166   2e-43    Medicago truncatula
ref|XP_008467306.1|  PREDICTED: uncharacterized protein LOC103504686    166   2e-43    Cucumis melo [Oriental melon]
gb|KEH20758.1|  cellulase (glycosyl hydrolase family 5), putative       156   2e-43    Medicago truncatula
ref|XP_011080895.1|  PREDICTED: uncharacterized protein LOC105164045    164   7e-43    Sesamum indicum [beniseed]
ref|XP_010053198.1|  PREDICTED: uncharacterized protein LOC104441706    162   3e-42    Eucalyptus grandis [rose gum]
ref|XP_002272491.1|  PREDICTED: uncharacterized protein LOC100262188    161   7e-42    Vitis vinifera
ref|XP_008810943.1|  PREDICTED: uncharacterized protein LOC103722247    159   4e-41    
emb|CBI34405.3|  unnamed protein product                                161   8e-41    Vitis vinifera
ref|XP_008445780.1|  PREDICTED: uncharacterized protein LOC103488703    157   8e-41    Cucumis melo [Oriental melon]
ref|XP_006439449.1|  hypothetical protein CICLE_v10023534mg             158   1e-40    
ref|XP_010916958.1|  PREDICTED: uncharacterized protein LOC105041671    157   1e-40    
ref|XP_004151386.1|  PREDICTED: uncharacterized protein LOC101207450    154   3e-40    
ref|XP_002272454.2|  PREDICTED: uncharacterized protein LOC100267...    157   3e-40    
gb|KGN45940.1|  hypothetical protein Csa_6G028440                       153   5e-39    Cucumis sativus [cucumbers]
gb|EYU23411.1|  hypothetical protein MIMGU_mgv1a004205mg                152   8e-39    Erythranthe guttata [common monkey flower]
gb|KGN50395.1|  hypothetical protein Csa_5G171770                       152   2e-38    Cucumis sativus [cucumbers]
ref|XP_006584934.1|  PREDICTED: uncharacterized protein LOC100811735    147   4e-38    
ref|XP_004170746.1|  PREDICTED: endoglucanase E1-like                   150   5e-38    
ref|XP_009387704.1|  PREDICTED: uncharacterized protein LOC103974573    143   6e-38    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932263.1|  PREDICTED: uncharacterized protein LOC105052971    143   9e-38    Elaeis guineensis
gb|EYU23409.1|  hypothetical protein MIMGU_mgv1a004243mg                150   9e-38    Erythranthe guttata [common monkey flower]
ref|XP_008467257.1|  PREDICTED: uncharacterized protein LOC103504654    150   9e-38    Cucumis melo [Oriental melon]
ref|XP_004151560.1|  PREDICTED: uncharacterized protein LOC101211788    146   1e-37    
ref|XP_008807477.1|  PREDICTED: uncharacterized protein LOC103719832    142   1e-37    Phoenix dactylifera
ref|XP_004168760.1|  PREDICTED: uncharacterized protein LOC101223816    149   1e-37    
gb|KGN50394.1|  hypothetical protein Csa_5G171760                       149   1e-37    Cucumis sativus [cucumbers]
emb|CDP12092.1|  unnamed protein product                                151   2e-37    Coffea canephora [robusta coffee]
ref|XP_009605826.1|  PREDICTED: uncharacterized protein LOC104100317    148   3e-37    Nicotiana tomentosiformis
gb|KHN45741.1|  Endoglucanase                                           148   4e-37    Glycine soja [wild soybean]
ref|XP_007159232.1|  hypothetical protein PHAVU_002G220300g             147   6e-37    Phaseolus vulgaris [French bean]
gb|KDO82155.1|  hypothetical protein CISIN_1g008330mg                   144   3e-36    Citrus sinensis [apfelsine]
emb|CDY21995.1|  BnaC09g01010D                                          138   5e-36    Brassica napus [oilseed rape]
ref|XP_006378253.1|  hypothetical protein POPTR_0010s059502g            143   6e-36    
ref|XP_009773950.1|  PREDICTED: uncharacterized protein LOC104224082    144   6e-36    Nicotiana sylvestris
gb|EYU23408.1|  hypothetical protein MIMGU_mgv1a020519mg                144   8e-36    Erythranthe guttata [common monkey flower]
ref|XP_004510834.1|  PREDICTED: uncharacterized protein LOC101496378    144   9e-36    
ref|XP_008459280.1|  PREDICTED: uncharacterized protein LOC103498458    144   4e-35    Cucumis melo [Oriental melon]
gb|KEH18775.1|  hydrolyzing O-glycosyl compounds hydrolase              142   4e-35    Medicago truncatula
gb|EYU23410.1|  hypothetical protein MIMGU_mgv1a004297mg                141   7e-35    Erythranthe guttata [common monkey flower]
ref|XP_004170742.1|  PREDICTED: uncharacterized protein LOC101225189    138   1e-34    
ref|XP_002315653.2|  hypothetical protein POPTR_0010s05960g             138   3e-34    
gb|EAZ23667.1|  hypothetical protein OsJ_07369                          139   5e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403630.1|  PREDICTED: uncharacterized protein LOC103987145    132   7e-34    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY34588.1|  BnaC03g56880D                                          136   8e-34    Brassica napus [oilseed rape]
ref|XP_011026965.1|  PREDICTED: uncharacterized protein LOC105127394    138   1e-33    Populus euphratica
gb|KGN50047.1|  hypothetical protein Csa_5G151630                       138   1e-33    Cucumis sativus [cucumbers]
ref|XP_004143963.1|  PREDICTED: uncharacterized protein LOC101211910    138   1e-33    
ref|XP_010026599.1|  PREDICTED: uncharacterized protein LOC104416971    136   2e-33    Eucalyptus grandis [rose gum]
gb|KGN57438.1|  hypothetical protein Csa_3G185670                       136   2e-33    Cucumis sativus [cucumbers]
ref|XP_002298005.2|  hypothetical protein POPTR_0001s10020g             137   3e-33    
gb|KDP25367.1|  hypothetical protein JCGZ_20523                         136   3e-33    Jatropha curcas
ref|XP_004143962.1|  PREDICTED: uncharacterized protein LOC101211675    136   4e-33    Cucumis sativus [cucumbers]
ref|XP_002509877.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    135   8e-33    
ref|XP_008437726.1|  PREDICTED: uncharacterized protein LOC103483073    135   1e-32    Cucumis melo [Oriental melon]
ref|XP_002871731.1|  glycosyl hydrolase family 5 protein                134   2e-32    
ref|NP_197172.1|  glycosyl hydrolase family protein                     134   2e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008437728.1|  PREDICTED: uncharacterized protein LOC103483074    133   4e-32    Cucumis melo [Oriental melon]
ref|XP_004140825.1|  PREDICTED: uncharacterized protein LOC101208873    130   7e-32    
gb|AES77604.2|  hydrolyzing O-glycosyl compounds hydrolase              132   8e-32    Medicago truncatula
gb|KDO76363.1|  hypothetical protein CISIN_1g039248mg                   131   9e-32    Citrus sinensis [apfelsine]
ref|XP_006400209.1|  hypothetical protein EUTSA_v10015466mg             132   1e-31    Eutrema salsugineum [saltwater cress]
gb|KDP25366.1|  hypothetical protein JCGZ_20522                         130   5e-31    Jatropha curcas
emb|CDX85491.1|  BnaA02g03220D                                          129   5e-31    
gb|EPS62091.1|  hypothetical protein M569_12701                         130   6e-31    Genlisea aurea
ref|XP_003621369.1|  Endoglucanase E1                                   130   6e-31    
ref|XP_004168759.1|  PREDICTED: uncharacterized protein LOC101223591    130   9e-31    
ref|XP_009142284.1|  PREDICTED: uncharacterized protein LOC103866155    129   1e-30    Brassica rapa
ref|XP_009142293.1|  PREDICTED: uncharacterized protein LOC103866164    129   1e-30    Brassica rapa
ref|XP_009126137.1|  PREDICTED: uncharacterized protein LOC103851062    129   1e-30    Brassica rapa
ref|XP_002509879.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    128   3e-30    Ricinus communis
ref|XP_006344017.1|  PREDICTED: uncharacterized protein LOC102582487    127   5e-30    Solanum tuberosum [potatoes]
gb|KGN57440.1|  hypothetical protein Csa_3G186670                       125   1e-29    Cucumis sativus [cucumbers]
gb|KCW59703.1|  hypothetical protein EUGRSUZ_H02464                     125   2e-29    Eucalyptus grandis [rose gum]
emb|CDX94332.1|  BnaC01g18520D                                          118   1e-28    
ref|XP_009121461.1|  PREDICTED: uncharacterized protein LOC103846308    123   1e-28    Brassica rapa
gb|EAY94564.1|  hypothetical protein OsI_16342                          121   2e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_006378254.1|  hypothetical protein POPTR_0010s059501g            115   2e-28    
ref|XP_010437048.1|  PREDICTED: uncharacterized protein LOC104720...    122   5e-28    Camelina sativa [gold-of-pleasure]
ref|XP_003621392.1|  Endoglucanase E1                                   121   1e-27    
gb|AES77610.2|  hydrolyzing O-glycosyl compounds hydrolase              121   1e-27    
gb|KHN26287.1|  hypothetical protein glysoja_050239                     115   1e-27    
emb|CDP16213.1|  unnamed protein product                                119   3e-27    
ref|XP_010453833.1|  PREDICTED: uncharacterized protein LOC104735704    117   1e-26    
ref|XP_010492589.1|  PREDICTED: uncharacterized protein LOC104769...    117   2e-26    
ref|XP_010497223.1|  PREDICTED: uncharacterized protein LOC104774279    113   2e-25    
gb|KDP25365.1|  hypothetical protein JCGZ_20521                         115   9e-25    
ref|XP_010420372.1|  PREDICTED: uncharacterized protein LOC104705962    109   1e-23    
gb|EPS64690.1|  hypothetical protein M569_10090                         107   2e-23    
ref|XP_010261410.1|  PREDICTED: uncharacterized protein LOC104600255    106   8e-23    
gb|KEH28356.1|  hydrolyzing O-glycosyl compounds hydrolase              107   8e-23    
gb|KCW77463.1|  hypothetical protein EUGRSUZ_D01801                     105   1e-22    
gb|AFK37776.1|  unknown                                               99.8    2e-22    
ref|XP_003617143.1|  Oligoribonuclease                                  107   3e-22    
gb|AFW62835.1|  hypothetical protein ZEAMMB73_750687                    103   4e-22    
gb|AFW62836.1|  hypothetical protein ZEAMMB73_750687                    104   4e-22    
ref|XP_010325669.1|  PREDICTED: uncharacterized protein LOC101257885    104   8e-22    
ref|XP_002509878.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    101   9e-21    
gb|AFG68326.1|  hypothetical protein 0_4489_01                        93.6    2e-20    
ref|XP_010536239.1|  PREDICTED: uncharacterized protein LOC104811274  97.1    2e-20    
ref|XP_003621368.1|  Endoglucanase                                    99.8    2e-20    
gb|AFG68334.1|  hypothetical protein 0_4489_01                        92.8    3e-20    
ref|XP_006653527.1|  PREDICTED: uncharacterized protein LOC102709173  97.8    4e-20    
gb|AFG68327.1|  hypothetical protein 0_4489_01                        91.7    8e-20    
emb|CDY40992.1|  BnaA02g27820D                                        95.9    4e-19    
ref|XP_006289055.1|  hypothetical protein CARUB_v10002452mg           94.0    6e-19    
ref|XP_004158142.1|  PREDICTED: uncharacterized LOC101213113          93.2    3e-18    
ref|XP_007135020.1|  hypothetical protein PHAVU_010G095100g           94.0    3e-18    
ref|XP_010658499.1|  PREDICTED: uncharacterized protein LOC100267...  91.3    2e-17    
ref|XP_009387346.1|  PREDICTED: uncharacterized protein LOC103974285  89.7    7e-17    
ref|XP_011080894.1|  PREDICTED: uncharacterized protein LOC105164044  89.0    8e-17    
ref|XP_002893942.1|  predicted protein                                88.2    2e-16    
gb|KHN04647.1|  Endoglucanase                                         84.7    3e-15    
ref|XP_010535458.1|  PREDICTED: uncharacterized protein LOC104810759  84.0    4e-15    
gb|AGT16660.1|  hypothetical protein SHCRBa_026_H12_R_120             75.9    7e-13    
emb|CDY16990.1|  BnaC09g41170D                                        66.2    1e-10    
emb|CEJ81391.1|  hypothetical protein VHEMI01518                      70.9    2e-10    
gb|KHN41605.1|  hypothetical protein glysoja_038343                   68.9    2e-10    
ref|XP_001908470.1|  hypothetical protein                             68.9    6e-10    
ref|NP_001173990.1|  Os04g0481050                                     62.0    8e-10    
gb|KEH20763.1|  glycoside hydrolase family 5 protein                  63.9    2e-09    
ref|XP_003621386.1|  Endoglucanase E1                                 67.4    2e-09    
ref|XP_001769398.1|  predicted protein                                67.0    3e-09    
gb|KIY63779.1|  glycoside hydrolase family 5 protein                  67.0    3e-09    
ref|XP_001221670.1|  hypothetical protein CHGG_05575                  65.9    6e-09    
gb|KFH44162.1|  Endoglucanase-like protein                            65.5    1e-08    
gb|KGQ09067.1|  hypothetical protein BBAD15_g5599                     65.5    1e-08    
ref|XP_001767510.1|  predicted protein                                64.3    2e-08    
gb|EKG14335.1|  Glycoside hydrolase family 5                          64.7    2e-08    
ref|XP_007910862.1|  putative cellulase family protein                63.9    3e-08    
gb|KIE00366.1|  cellulase family protein                              63.9    3e-08    
gb|KID89157.1|  cellulase family protein                              63.9    3e-08    
ref|XP_007819785.1|  cellulase family protein                         63.9    3e-08    
ref|XP_007792420.1|  putative cellulase family protein                63.5    4e-08    
gb|KHO00841.1|  cellulase family protein                              63.5    5e-08    
gb|EQK97843.1|  cellulase family protein                              63.5    5e-08    
ref|XP_003662646.1|  glycoside hydrolase family 5 protein             63.2    6e-08    
ref|XP_007357340.1|  glycosyl hydrolase family 5 protein/cellulase    63.2    6e-08    
ref|XP_007814668.1|  cellulase family protein                         62.8    8e-08    
ref|XP_007585086.1|  putative cellulase family protein                62.8    9e-08    
ref|XP_008597845.1|  cellulase-like protein                           62.8    9e-08    
gb|KFG83308.1|  cellulase family protein                              62.4    1e-07    
ref|XP_006671920.1|  cellulase family protein                         62.4    1e-07    
gb|KID73106.1|  cellulase family protein                              62.0    2e-07    
ref|XP_003655929.1|  glycoside hydrolase family 5 protein             61.6    2e-07    
gb|KEY64284.1|  hypothetical protein S7711_06330                      61.2    2e-07    
gb|KFA75266.1|  hypothetical protein S40288_00156                     61.2    2e-07    
gb|KFA63501.1|  hypothetical protein S40285_00384                     60.8    3e-07    
ref|XP_002145195.1|  cellulase family protein                         60.8    4e-07    
ref|NP_001047320.1|  Os02g0596200                                     60.5    5e-07    
ref|XP_001836746.2|  glycosyl hydrolase family 5 protein/cellulase    59.3    1e-06    
ref|XP_007834259.1|  hypothetical protein PFICI_07487                 58.9    1e-06    
dbj|GAD95395.1|  cellulase family protein                             58.9    2e-06    
emb|CCF32701.1|  cellulase                                            58.5    2e-06    
ref|XP_003717168.1|  cellulase                                        58.5    2e-06    
gb|KDN66432.1|  putative cellulase                                    58.2    2e-06    
gb|KHN27305.1|  hypothetical protein glysoja_034658                   56.6    3e-06    
dbj|BAD09277.1|  hypothetical protein                                 56.6    3e-06    
emb|CDY40991.1|  BnaA02g27810D                                        53.5    4e-06    
gb|EFQ33294.1|  cellulase                                             57.0    7e-06    
gb|ENH81172.1|  cellulase family protein                              57.0    7e-06    
ref|XP_009224314.1|  hypothetical protein GGTG_08211                  56.6    1e-05    
ref|XP_007594136.1|  cellulase                                        56.2    1e-05    
ref|XP_006577386.1|  PREDICTED: uncharacterized protein LOC102665018  55.5    1e-05    
dbj|GAM34669.1|  hypothetical protein TCE0_015f02391                  55.1    2e-05    
gb|EMS46776.1|  hypothetical protein TRIUR3_23304                     54.7    3e-05    
gb|EPE03278.1|  cellulase family protein                              54.3    5e-05    
gb|EQB45939.1|  endo-beta-1                                           54.3    5e-05    
gb|ERS96619.1|  hypothetical protein HMPREF1624_06828                 53.9    6e-05    
gb|KIH89233.1|  glycosyl hydrolase family 5 protein/cellulase         53.9    7e-05    
ref|XP_007273044.1|  cellulase family protein                         53.9    8e-05    
gb|EQB46738.1|  cellulase                                             53.5    1e-04    
ref|XP_002514822.1|  hypothetical protein RCOM_1077730                52.8    1e-04    
ref|XP_007590702.1|  beta-1,6-galactanase                             53.1    1e-04    
gb|EFW98553.1|  cellulase family protein                              52.0    3e-04    
ref|XP_002340189.1|  cellulase family protein                         52.0    3e-04    
gb|KIN05076.1|  glycoside hydrolase family 5 protein                  51.6    4e-04    
gb|KIY64332.1|  glycoside hydrolase family 5 protein                  50.8    6e-04    
ref|XP_007283182.1|  cellulase family protein                         50.8    8e-04    



>ref|XP_006341815.1| PREDICTED: uncharacterized protein LOC102587665, partial [Solanum 
tuberosum]
Length=425

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/251 (73%), Positives = 213/251 (85%), Gaps = 3/251 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRYFNCFLGLAAELDFDWALWTL GSYYLR+G VGL E+YG+L 
Sbjct  175  FVSEFGVDQRGTNVNDNRYFNCFLGLAAELDFDWALWTLVGSYYLRDGIVGLNEYYGILD  234

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW + RN SFLQRIS++++PF+GPGY E+R HK+IFHPMTGLCV+R SL QPLELGPCS
Sbjct  235  WNWFDIRNSSFLQRISVIRTPFQGPGYAETRSHKVIFHPMTGLCVQRTSLLQPLELGPCS  294

Query  474  ESDPWGYTAGKALTVEGTYFCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            E++ W Y   KAL V GTYFCLQA+ KLG+PAKL + C+DDSSKW+IISDS+MHLSSKL+
Sbjct  295  EAEAWSYAPAKALIVLGTYFCLQADNKLGQPAKLSMICSDDSSKWDIISDSKMHLSSKLQ  354

Query  297  DGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLY  124
            D ++VCLDVD NNVI+T TCKCL+ ND++CDP SQWFKIIDSTR T TTKS  Q    ++
Sbjct  355  DATSVCLDVDPNNVIVTQTCKCLSTNDTTCDPGSQWFKIIDSTRATKTTKSFLQIKPIIH  414

Query  123  FLAKKLFASYI  91
            FLA+  F SYI
Sbjct  415  FLARNFFGSYI  425



>ref|XP_006367511.1| PREDICTED: uncharacterized protein LOC102589547 [Solanum tuberosum]
Length=560

 Score =   394 bits (1011),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/249 (75%), Positives = 207/249 (83%), Gaps = 3/249 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRYFNCFLGLAAELDFDWALWTL GSYYLREG VGL E YGV+ 
Sbjct  313  FVSEFGADQRGTNVNDNRYFNCFLGLAAELDFDWALWTLVGSYYLREGVVGLNEVYGVMD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL+RIS +QSPF+GPGY ESR HKLIFHPMTGLCVRR+S FQPLELGPCS
Sbjct  373  WNWCDIRNSSFLKRISTVQSPFQGPGYNESRSHKLIFHPMTGLCVRRISFFQPLELGPCS  432

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ESD W YT  K LT+ GTYFCLQA+K G+PAKLG+ CT+ +SKW+ ISDS+MHLSSKL+D
Sbjct  433  ESDAWDYTPTKTLTLTGTYFCLQADKSGQPAKLGIMCTNSNSKWQAISDSKMHLSSKLQD  492

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG-TTTKSDFQSTSFLYFL  118
            G+N+CLDVDS NV+ TNTCKCL+ D +CDPASQWFKIIDSTR   TTKS FQS     FL
Sbjct  493  GTNLCLDVDSKNVVFTNTCKCLSKDKTCDPASQWFKIIDSTRKQNTTKSFFQSKQIAQFL  552

Query  117  AKKLFASYI  91
                  SYI
Sbjct  553  GNTF--SYI  559



>ref|XP_004239150.1| PREDICTED: uncharacterized protein LOC101248575 [Solanum lycopersicum]
Length=572

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/251 (73%), Positives = 211/251 (84%), Gaps = 3/251 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDN YFNCFLGLAAELDFDWALWTL GSYYLR+G VGL E+YG+L 
Sbjct  322  FVSEFGVDQRGTNVNDNMYFNCFLGLAAELDFDWALWTLVGSYYLRDGIVGLNEYYGILD  381

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW + RN SFLQRIS++++PF+GPGY E+R HK+IFHPMTGLCV+R SL QPLELGPCS
Sbjct  382  WNWFDIRNSSFLQRISVIRTPFQGPGYAETRPHKVIFHPMTGLCVQRTSLLQPLELGPCS  441

Query  474  ESDPWGYTAGKALTVEGTYFCLQA-EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            E++ W Y   KAL V GTYFCLQA +KLG+PAKLG+ C+DDSSKW+IISDS+MHLSSKL+
Sbjct  442  EAEAWSYAPAKALIVLGTYFCLQADDKLGQPAKLGMICSDDSSKWDIISDSKMHLSSKLQ  501

Query  297  DGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLY  124
            D ++VCLDVD NNVI+T TCKCLN ND++CDP SQWFKIIDSTR T  TKS  Q    + 
Sbjct  502  DATSVCLDVDPNNVIVTQTCKCLNTNDTTCDPGSQWFKIIDSTRTTKITKSFLQIKPIIQ  561

Query  123  FLAKKLFASYI  91
            FLA+  F SYI
Sbjct  562  FLARNFFGSYI  572



>ref|XP_004245178.1| PREDICTED: uncharacterized protein LOC101258288 [Solanum lycopersicum]
Length=561

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 204/249 (82%), Gaps = 3/249 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRYFNCFLGLAAELDFDWALWTL GSYYLREG VGL E YGV+ 
Sbjct  314  FVSEFGADQRGTNVNDNRYFNCFLGLAAELDFDWALWTLVGSYYLREGVVGLNEVYGVMD  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL RIS +QSPF+GPGY ESR HKLIFHPMTGLCVRR+S  QPLELGPCS
Sbjct  374  WNWCDIRNSSFLNRISAVQSPFQGPGYNESRSHKLIFHPMTGLCVRRISFLQPLELGPCS  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ESD W YT  K+LT+ GTYFCLQA+K G+PAKLG+ CT+ +SKW+ ISDS+MHLSSKL+D
Sbjct  434  ESDAWDYTTTKSLTLTGTYFCLQADKSGQPAKLGIMCTNSNSKWQAISDSKMHLSSKLQD  493

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR-GTTTKSDFQSTSFLYFL  118
            G+++CLDVDS N I TN CKCL+ D +C+P SQWFKIIDSTR   +TKS FQS   + FL
Sbjct  494  GTSLCLDVDSKNAIFTNPCKCLSKDKTCEPESQWFKIIDSTRQQNSTKSFFQSEHIVQFL  553

Query  117  AKKLFASYI  91
                  SYI
Sbjct  554  GNTF--SYI  560



>ref|XP_009765489.1| PREDICTED: uncharacterized protein LOC104217035 [Nicotiana sylvestris]
Length=562

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 209/250 (84%), Gaps = 2/250 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRYFNCFLGLAA+LDFDWALWTL GSYYLR+G VGL E+YGVL 
Sbjct  313  FVSEFGVDQRGTNVNDNRYFNCFLGLAAQLDFDWALWTLVGSYYLRDGVVGLNEYYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + RN SFL+RIS ++SPF+GPGYTE+RLHK+IFHP TGLCVRR S  QPLELG CS
Sbjct  373  CNWRDIRNSSFLERISAIRSPFQGPGYTETRLHKVIFHPKTGLCVRRTSFLQPLELGSCS  432

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            E+  W Y   K LTV GTYFCLQA+KLG+PAKLG+ C+DDSSKWE ISDS+MHLSSKL+D
Sbjct  433  EAAAWRYAPQKTLTVIGTYFCLQADKLGEPAKLGITCSDDSSKWETISDSKMHLSSKLQD  492

Query  294  GSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYF  121
             ++VCLDVDSNNVI+T TCKCL+ ND++CDP SQWFKIIDSTR T TTKS  Q    + F
Sbjct  493  ATSVCLDVDSNNVIVTQTCKCLSTNDTTCDPGSQWFKIIDSTRVTKTTKSFLQIKPIIRF  552

Query  120  LAKKLFASYI  91
            LA+  F SYI
Sbjct  553  LARSFFGSYI  562



>emb|CDP13254.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 204/249 (82%), Gaps = 3/249 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRGTNVNDNR+ NCFLG AAELD DWALWTL GSYYLREG  G +E YG+  
Sbjct  285  FVSEFGVDLRGTNVNDNRFLNCFLGWAAELDLDWALWTLVGSYYLREGVAGKDESYGIYN  344

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWCE RN SF+QRIS +QSPFRGPG +ESR HK+IFHP TGLCV+R SL +PLELGPCS
Sbjct  345  WNWCETRNSSFIQRISALQSPFRGPGVSESRPHKIIFHPATGLCVQRKSLLKPLELGPCS  404

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            E++ WGY+  K LT++GTY+CLQA+ LG+PAKLG+ CTD SSKWE ISDS+MHLSSKL D
Sbjct  405  EAEAWGYSPQKTLTIKGTYYCLQADALGQPAKLGIICTDKSSKWEAISDSKMHLSSKLCD  464

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR-GTTTKSDFQST--SFLY  124
            GS VCLDVDSNNV++TN CKCL+ DSSCDP SQWFK++DS+R GT++   F     S L+
Sbjct  465  GSEVCLDVDSNNVVVTNNCKCLSRDSSCDPGSQWFKLVDSSRHGTSSTKSFSQMDDSILF  524

Query  123  FLAKKLFAS  97
             LAK L  S
Sbjct  525  NLAKTLAES  533



>gb|KDP26669.1| hypothetical protein JCGZ_17827 [Jatropha curcas]
Length=563

 Score =   361 bits (927),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 163/244 (67%), Positives = 201/244 (82%), Gaps = 1/244 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RGTNVNDNRY  CFLG AAELD DWALWTL GSYYLREG +GL E+YGVL 
Sbjct  313  FVSEFGIDQRGTNVNDNRYLGCFLGWAAELDLDWALWTLVGSYYLREGVLGLNEYYGVLN  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFLQ+IS +QSPF+GPG +ES LHK+IFHP+TGLCV+R S+ +PL+LGPC+
Sbjct  373  WNWCDIRNSSFLQQISALQSPFQGPGVSESNLHKVIFHPLTGLCVQRKSMLEPLKLGPCT  432

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W YT  K L+++GTYFCLQA++LGKPAKLG+ CTD  SKW++ISDS MHLSSK+ +
Sbjct  433  DSEAWRYTPQKILSLKGTYFCLQADELGKPAKLGVICTDSDSKWDVISDSNMHLSSKISN  492

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFL  118
            G+ +CLDVDSNN I+ NTCKCL+ D++CDP SQWFK+++STR +T  K  F   S L + 
Sbjct  493  GTTICLDVDSNNTIVINTCKCLSRDNTCDPGSQWFKLVNSTRSSTMAKPSFGINSILDYT  552

Query  117  AKKL  106
             +KL
Sbjct  553  KQKL  556



>gb|KHG05074.1| Endoglucanase [Gossypium arboreum]
Length=563

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G+D RGTNVNDNRY NCFLG+AAELD DWALWTL GSYYLREG +GL E+YGVL 
Sbjct  311  FVSEYGVDQRGTNVNDNRYLNCFLGVAAELDLDWALWTLVGSYYLREGVIGLNEYYGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NWCE RN SF++RIS +QSPFRGPG +E++LHK+IFHP TGLCV R S   PL LGPC+
Sbjct  371  YNWCETRNSSFIKRISALQSPFRGPGLSETKLHKVIFHPSTGLCVIRKSFLDPLLLGPCA  430

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             S+ W Y++ K L V+GTYFCLQA++ G  AKLG+FC+D +SKWE+I+DS+MHLSSKL++
Sbjct  431  NSESWSYSSDKTLVVKGTYFCLQADESGTLAKLGIFCSDSNSKWEMIADSKMHLSSKLRN  490

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLA  115
            G ++CLDVDS+N I+TN+CKC++ D++CDPASQWFK++DSTR  + +  F     ++ L 
Sbjct  491  GKSICLDVDSSNAIVTNSCKCISKDNTCDPASQWFKLVDSTRSRSEEQSFLHFDSIFDLP  550

Query  114  KKLFAS  97
             K F S
Sbjct  551  GKGFPS  556



>gb|KJB15656.1| hypothetical protein B456_002G188600 [Gossypium raimondii]
Length=563

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 200/246 (81%), Gaps = 0/246 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G+D RGTNVNDNRY NCFLG+AAELD DWALWTL GSYYLREG +GL E+YGVL 
Sbjct  311  FVSEYGVDQRGTNVNDNRYLNCFLGVAAELDLDWALWTLVGSYYLREGVIGLNEYYGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NWCE RN SF++RIS +QSPFRGPG +E++LHK+IFHP TGLCV R S   PL LGPC+
Sbjct  371  YNWCETRNSSFIERISALQSPFRGPGLSETKLHKVIFHPSTGLCVIRKSFLDPLCLGPCA  430

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W Y++ K L V+GTYFCLQA++ G   KLG+FC+D +SKWE+I+DS+MHLSSKL++
Sbjct  431  DSESWSYSSDKTLVVKGTYFCLQADESGTLVKLGIFCSDSNSKWEMIADSKMHLSSKLRN  490

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLA  115
            G ++CLDVDS+N I+TN+CKC++ D++CDPASQWFK++DSTR  + +  F     ++ L 
Sbjct  491  GKSICLDVDSSNAIVTNSCKCISKDNTCDPASQWFKLVDSTRSRSEERSFLHFDSIFDLP  550

Query  114  KKLFAS  97
             K F S
Sbjct  551  GKGFLS  556



>ref|XP_007044872.1| Cellulase protein [Theobroma cacao]
 gb|EOY00704.1| Cellulase protein [Theobroma cacao]
Length=563

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 198/238 (83%), Gaps = 5/238 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCFLG+AAELD DWALWTL GSYYLREG VGL E+YG+L 
Sbjct  311  FVSEFGVDQRGTNVNDNRYLNCFLGVAAELDLDWALWTLVGSYYLREGVVGLNEYYGILN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWCE RN SFL+RIS +QSPFRGPG +E++LHK+IFHP TGLCV R SL  PL LGPC+
Sbjct  371  WNWCEIRNSSFLERISALQSPFRGPGLSETKLHKVIFHPSTGLCVLRKSLLDPLRLGPCT  430

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W Y+    L V+GTYFCLQA++ G  A+LG+ C++ +SKWE+ISDS+MHLSSKL++
Sbjct  431  DSEAWSYSPQNTLVVKGTYFCLQADESGTLARLGIICSESNSKWEMISDSKMHLSSKLRN  490

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYF  121
            G+++CLDVDS N I+TN+CKCL+ND+ CDP SQWFK++DSTR   ++S  +  SFL+F
Sbjct  491  GTSICLDVDSTNTIVTNSCKCLSNDNMCDPESQWFKLVDSTR---SRSGVK--SFLHF  543



>ref|XP_011086688.1| PREDICTED: uncharacterized protein LOC105168334 [Sesamum indicum]
Length=574

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 196/249 (79%), Gaps = 2/249 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D+RG NVNDNRY NCF+G AAELD DWALW L GSYY+REG VG +E YGV  
Sbjct  324  FVSEFGVDMRGANVNDNRYLNCFMGWAAELDVDWALWALTGSYYIREGVVGHDETYGVYN  383

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN + L +IS +Q PFRGPGY+E R HK++FHPMTGLCV+R+S  +PL LGPCS
Sbjct  384  WNWCDVRNQTTLHKISALQYPFRGPGYSERRPHKILFHPMTGLCVKRMSFVEPLVLGPCS  443

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            E++ W YT    LT++GTYFCLQA+ LG PAKLG+ CTD +SKWE +SDS+MHLSSKL+D
Sbjct  444  EAEAWSYTPQHTLTIKGTYFCLQADALGHPAKLGIICTDSTSKWEAVSDSKMHLSSKLED  503

Query  294  GSNVCLDVDSNNVIITNTCKCLNN-DSSCDPASQWFKIIDSTRGTTTKSDF-QSTSFLYF  121
            G+NVCLDVDS+N ++ N CKCL+N ++ CDPASQWFK+IDSTR    KS F +  S L  
Sbjct  504  GTNVCLDVDSDNNVVMNNCKCLDNKNNKCDPASQWFKLIDSTRCGADKSFFLEINSVLKL  563

Query  120  LAKKLFASY  94
            +A    +S+
Sbjct  564  VANNFLSSF  572



>ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=566

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 199/245 (81%), Gaps = 1/245 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY  CF+G+AAELD+DWALWTL GSYYLR+G +GL E+YGVL 
Sbjct  314  FVSEFGVDQRGTNVNDNRYLGCFIGVAAELDWDWALWTLVGSYYLRQGVIGLNEYYGVLN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFLQ+IS +QSPF+GPG +E+  HK+IFHP TGLCV+R S+ +PL LG C+
Sbjct  374  WNWCDVRNSSFLQQISALQSPFQGPGLSETNPHKVIFHPSTGLCVQRKSMLEPLRLGSCT  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W YT+   LT+ GTYFCLQA++LGKPAKLG+ CTD +SKW++ISDS+MHLSSK+ +
Sbjct  434  DSEAWRYTSENTLTLRGTYFCLQADELGKPAKLGIICTDSTSKWDVISDSKMHLSSKITN  493

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT-TTKSDFQSTSFLYFL  118
            G+ VCLDVDSNN I+ +TCKCL+ D++CDP SQWFK+++STR + T K   +  S L  L
Sbjct  494  GTAVCLDVDSNNTIVISTCKCLSRDNTCDPESQWFKLVNSTRSSATAKPSLRINSILLDL  553

Query  117  AKKLF  103
              K F
Sbjct  554  PAKEF  558



>ref|XP_011042367.1| PREDICTED: uncharacterized protein LOC105138074 [Populus euphratica]
Length=561

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 195/247 (79%), Gaps = 1/247 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY  CFL +AAELD DWALWTL GSYYLR+G VG+ E+YGVL 
Sbjct  314  FVSEFGVDQRGTNVNDNRYLGCFLSVAAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWCE RN +FLQ+IS +QSPFRGPG +E+  HK+IFHP TGLCV R S+F+PL LG C+
Sbjct  374  WNWCEARNSTFLQQISALQSPFRGPGLSEANPHKVIFHPSTGLCVLRKSMFEPLRLGRCT  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT+ K L+V+GTYFCLQ + L KPAKLG+ CTD +SKW+ ISDS+MH SS   +
Sbjct  434  ESEAWTYTSQKILSVKGTYFCLQTDDLAKPAKLGIICTDSNSKWQTISDSKMHFSSTASN  493

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFL  118
            G+ VCLDVDS+N I+TNTCKCL+ D++CDP SQWFK+++STR +T TK   +  S L F 
Sbjct  494  GTTVCLDVDSDNTIVTNTCKCLSKDNACDPESQWFKLVNSTRSSTMTKPLSRMNSILNFP  553

Query  117  AKKLFAS  97
            AK    S
Sbjct  554  AKGFHGS  560



>ref|XP_010248702.1| PREDICTED: uncharacterized protein LOC104591536 [Nelumbo nucifera]
Length=555

 Score =   349 bits (895),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RGTN+NDNR+ NCF G+AAELDFDWALWTLAGSYYLREG +G++E YGVL+
Sbjct  313  FLSEFGVDQRGTNINDNRFLNCFFGVAAELDFDWALWTLAGSYYLREGKIGMDETYGVLS  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SF++RIS++QSPF+GPG ++ R +K+IFHP TGLCV R SLF+PL+LGPC+
Sbjct  373  WNWCKTRNSSFMERISVLQSPFQGPGLSDVRPYKVIFHPSTGLCVLRKSLFEPLKLGPCT  432

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K L ++GTYFC+QA++LGKP KLG+FC+D SSKW++ISDS+MHLSS L D
Sbjct  433  ESEAWSYTPPKNLLLKGTYFCIQADELGKPVKLGIFCSDPSSKWDMISDSKMHLSSTLSD  492

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLDVDS N IIT  CKC++ D  CDPASQWFKI+ STR
Sbjct  493  GSTVCLDVDSTNTIITTPCKCVSRDDKCDPASQWFKIVTSTR  534



>gb|KDO82153.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
 gb|KDO82154.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=341

 Score =   337 bits (864),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRG NVNDNRY NCF G+AAELD+DWALWTL GSYYLREG +GL E+YG+  
Sbjct  90   FVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFD  149

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL+RIS +QSPFRGPG  E+ LHK+I+HP TGLCV+R S   PL LGPC+
Sbjct  150  WNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT  209

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K ++++G YFCLQA+ +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +
Sbjct  210  ESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADN  269

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G+ VCLDVDS+N I+TNTCKCL+ D +CDPASQWFK++D
Sbjct  270  GTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVD  308



>ref|XP_002312657.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
 gb|EEE90024.2| hypothetical protein POPTR_0008s18380g [Populus trichocarpa]
Length=566

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/250 (63%), Positives = 195/250 (78%), Gaps = 2/250 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RGTNVNDNRY  CFLG+AAELDFDWALWTL GSYY R+G +G+ E+YGVL 
Sbjct  314  FMSEFGVDQRGTNVNDNRYLGCFLGVAAELDFDWALWTLVGSYYFRQGVIGMNEYYGVLN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW E RN +FLQ+IS +QSPFRGPG +E  LHK+IFHP TGLCV R S+F+PL LGPC+
Sbjct  374  SNWRETRNSTFLQQISALQSPFRGPGVSEVHLHKVIFHPSTGLCVLRKSMFEPLRLGPCT  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W YT  K L+V+GTYFCLQ ++L KPAKLG+ CTD +SKWE ISDS+MHLSSK  +
Sbjct  434  QSEAWNYTPQKILSVKGTYFCLQTDELAKPAKLGIICTDSNSKWEAISDSKMHLSSKAPN  493

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR--GTTTKSDFQSTSFLYF  121
            G+ VCLD+  NN I+T+TCKCL+ D++CDP SQWFK+++STR   T TK     +S L F
Sbjct  494  GTAVCLDIGYNNTIVTSTCKCLSKDNTCDPESQWFKLVNSTRRSSTMTKPSSLISSILNF  553

Query  120  LAKKLFASYI  91
             AK     ++
Sbjct  554  PAKDFLWKFL  563



>gb|KDO82152.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=414

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRG NVNDNRY NCF G+AAELD+DWALWTL GSYYLREG +GL E+YG+  
Sbjct  163  FVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFD  222

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL+RIS +QSPFRGPG  E+ LHK+I+HP TGLCV+R S   PL LGPC+
Sbjct  223  WNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT  282

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K ++++G YFCLQA+ +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +
Sbjct  283  ESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADN  342

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G+ VCLDVDS+N I+TNTCKCL+ D +CDPASQWFK++D
Sbjct  343  GTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVD  381



>ref|XP_011034023.1| PREDICTED: uncharacterized protein LOC105132312 [Populus euphratica]
Length=566

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 195/250 (78%), Gaps = 2/250 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RGTNVNDNRY  CFLG+AAELD DWALWTL GSYYLR+G +G+ E+YGVL 
Sbjct  314  FMSEFGVDQRGTNVNDNRYLGCFLGVAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVLN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW E RN +FLQ+IS +QSPFRGPG +E  LHK+IFHP TGLCV R S+ +PL LGPC+
Sbjct  374  SNWRETRNSTFLQQISALQSPFRGPGVSEVHLHKVIFHPSTGLCVLRKSMLEPLRLGPCT  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W YT  K L+V+GTYFCLQ ++L KPAKLG+ CTD +SKWE ISDS+MHLSSK  +
Sbjct  434  KSEAWNYTPQKILSVKGTYFCLQTDELAKPAKLGIMCTDSNSKWETISDSKMHLSSKAPN  493

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT--TKSDFQSTSFLYF  121
            G+ VCLD+ SNN I+TNTCKCL+ D++CDP SQWFK+++ST  ++  TK     +S L F
Sbjct  494  GTPVCLDIGSNNTIVTNTCKCLSKDNTCDPESQWFKLVNSTTRSSIMTKPSSLISSILNF  553

Query  120  LAKKLFASYI  91
             AK     ++
Sbjct  554  PAKDFLWKFL  563



>gb|KHN06535.1| Endoglucanase [Glycine soja]
Length=474

 Score =   337 bits (863),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 188/240 (78%), Gaps = 3/240 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRGTNVNDNRY NCFL +AAELD DWALWTL GSYY R+G +G+EEFYG+L+
Sbjct  232  FISEFGGDLRGTNVNDNRYLNCFLAVAAELDLDWALWTLVGSYYFRQGVIGMEEFYGILS  291

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN +FL RIS +Q PFRGPG T    +KLIFHP+TGLCV R SL  PL LGPC 
Sbjct  292  WDWTQVRNTTFLNRISALQLPFRGPGITRGNPYKLIFHPLTGLCVIRKSLLDPLTLGPCY  351

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L+++GTYFC+QAE  G PAKLG+ C+D +S+WE+ISDS++HLSSKL D
Sbjct  352  LSDGWKYTPQKILSIKGTYFCIQAENEGMPAKLGIICSDPNSRWEMISDSKLHLSSKLSD  411

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG---TTTKSDFQSTSFLY  124
             SNVCLDVD NN I+TN CKCL+ D +CDP+SQWFK+IDS R    TT+ S   ++S LY
Sbjct  412  DSNVCLDVDDNNNIVTNACKCLSRDRTCDPSSQWFKLIDSGRRSMLTTSTSSMLNSSDLY  471



>ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera]
Length=552

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCF GLAAELDFDWALWTL GSYY REG +GLEEFYG+L 
Sbjct  309  FVSEFGVDQRGTNVNDNRYLNCFFGLAAELDFDWALWTLVGSYYTREGVIGLEEFYGLLN  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWCE RN SFLQRIS +QSPF+GP  +++R HK+IFHP TGLC+   S+F+PL LGPC 
Sbjct  369  WNWCEVRNSSFLQRISALQSPFQGPDLSDARPHKVIFHPATGLCIVWKSVFEPLTLGPCP  428

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ESD W YT  K L ++ TYFCLQA+  G P KLG+ CT+  SKWE ISDS+MHLS+KL D
Sbjct  429  ESDAWSYTPQKTLIMKETYFCLQADGPGNPGKLGIICTEPGSKWESISDSKMHLSTKLGD  488

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            G+ VCLD+DS+N I+TN CKCL+ D+ CDP SQWFKI+++T  +T
Sbjct  489  GTTVCLDIDSSNNIVTNACKCLSGDNKCDPGSQWFKIVNATNIST  533



>ref|XP_006483983.1| PREDICTED: uncharacterized protein LOC102624331 [Citrus sinensis]
Length=588

 Score =   339 bits (869),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRG NVNDNRY NCF G+AAELD+DWALWTL GSYYLREG +GL E+YG+  
Sbjct  337  FVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFD  396

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL+RIS +QSPFRGPG  E+ LHK+I+HP TGLCV+R S   PL LGPC+
Sbjct  397  WNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT  456

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K ++++G YFCLQA+ +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +
Sbjct  457  ESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADN  516

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G+ VCLDVDS+N I+TNTCKCL+ D +CDPASQWFK++D
Sbjct  517  GTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVD  555



>gb|KDO82151.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=570

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRG NVNDNRY NCF G+AAELD+DWALWTL GSYYLREG +GL E+YG+  
Sbjct  319  FVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFD  378

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL+RIS +QSPFRGPG  E+ LHK+I+HP TGLCV+R S   PL LGPC+
Sbjct  379  WNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT  438

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K ++++G YFCLQA+ +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +
Sbjct  439  ESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADN  498

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G+ VCLDVDS+N I+TNTCKCL+ D +CDPASQWFK++D
Sbjct  499  GTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVD  537



>ref|XP_006438205.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
 gb|ESR51445.1| hypothetical protein CICLE_v10031098mg [Citrus clementina]
Length=570

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRG NVNDNRY NCF G+AAELD+DWALWTL GSYYLREG +GL E+YG+  
Sbjct  319  FVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFD  378

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC+ RN SFL+RIS +QSPFRGPG  E+ LHK+I+HP TGLCV+R S   PL LGPC+
Sbjct  379  WNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCT  438

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K ++++G YFCLQA+ +GKPAKLG+ CTD  S WEIISDS+MHLSSK  +
Sbjct  439  ESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADN  498

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G+ VCLDVDS+N I+TNTCKCL+ D +CDPASQWFK++D
Sbjct  499  GTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVD  537



>ref|XP_004504142.1| PREDICTED: uncharacterized protein LOC101503968 [Cicer arietinum]
Length=554

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 189/244 (77%), Gaps = 1/244 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRGTNVNDNR+ NCF+  AA+LD DWALWTL GSYY R+G +G+EEFYG+L 
Sbjct  311  FVSEFGSDLRGTNVNDNRFLNCFIAYAADLDLDWALWTLVGSYYFRQGVIGMEEFYGILN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN+SF+QRI+ +Q PF+GPG TE   HKLIFHP+TGLCV R SL +PL LGPCS
Sbjct  371  WDWTQLRNISFIQRIASLQLPFQGPGITEGSPHKLIFHPLTGLCVIRKSLVEPLMLGPCS  430

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W Y+  K L+++GTYFC+QA+K G PA L + C+D +S W++ISDS++HLSS + +
Sbjct  431  LSDGWNYSPQKTLSIKGTYFCIQAQKQGVPAILSIMCSDPNSIWDMISDSKLHLSSNINN  490

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG-TTTKSDFQSTSFLYFL  118
            G+ VCLDVD NNVI+TN CKCL+ND +CDPASQWFK+IDS R   +T S     + L   
Sbjct  491  GTKVCLDVDDNNVIVTNACKCLSNDHTCDPASQWFKLIDSGRRLISTTSTLSELNLLELF  550

Query  117  AKKL  106
             K+L
Sbjct  551  MKRL  554



>ref|XP_011042368.1| PREDICTED: uncharacterized protein LOC105138075 [Populus euphratica]
Length=542

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY  CFL +AAELD DWALWTL GSYYLR+G VG+ E+YGVL 
Sbjct  314  FVSEFGVDQRGTNVNDNRYLGCFLSVAAELDLDWALWTLVGSYYLRQGVVGMNEYYGVLN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W E RN +FLQ IS +QSPFRGPG +E+  HK+IFHP TGLCV R S+  PL LG C+
Sbjct  374  LDWREVRNSTFLQLISAIQSPFRGPGLSEANPHKVIFHPSTGLCVLRKSMLAPLRLGRCA  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K L+V+GTYFCLQ + + KPAKLG+ CTD +SKWE ISDS+MHLSS    
Sbjct  434  ESEAWSYTPQKILSVKGTYFCLQTDDVAKPAKLGIICTDSNSKWETISDSKMHLSSNASS  493

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            G+ VCLD+DSNN I+TNTCKCL+ D++CDP SQWFK+++STR +T
Sbjct  494  GTTVCLDIDSNNTIVTNTCKCLSKDNACDPESQWFKLVNSTRSST  538



>ref|XP_010100346.1| hypothetical protein L484_027655 [Morus notabilis]
 gb|EXB82480.1| hypothetical protein L484_027655 [Morus notabilis]
Length=559

 Score =   331 bits (848),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 181/236 (77%), Gaps = 0/236 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCFL +AAELD DWALWTL GSYY R+G VG+ E+YGVL 
Sbjct  318  FVSEFGVDQRGTNVNDNRYLNCFLAVAAELDLDWALWTLVGSYYFRQGVVGMNEYYGVLN  377

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W E RN S LQ+IS +Q PF+GPG  E+R HK+IFHP TGLCV R S    L LGPCS
Sbjct  378  WDWNEIRNASVLQKISAIQYPFQGPGLAETRKHKIIFHPSTGLCVVRKSFTDALTLGPCS  437

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +SD W YT  K L ++GTYFCLQ + +GKPA+LG+ C +  SKWEIISDS++HL++K   
Sbjct  438  KSDGWYYTPQKILEIKGTYFCLQVDDVGKPARLGIICMESDSKWEIISDSKLHLAAKTSS  497

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  127
            G+ VCLDVDSNNV++TN CKCL+ DSSCDP SQWF+++D+TR     S  +  S L
Sbjct  498  GTTVCLDVDSNNVVVTNLCKCLSRDSSCDPGSQWFQLVDTTRRPRLDSSTKIKSVL  553



>ref|XP_008389746.1| PREDICTED: uncharacterized protein LOC103452050 [Malus domestica]
Length=552

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCF+  AAE D D+ALWTL GSYYLR+G VG+EE+YG+L 
Sbjct  309  FVSEFGVDHRGTNVNDNRYLNCFMAAAAEFDVDFALWTLVGSYYLRQGVVGMEEYYGILN  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN S  QR+S++QSP +GPG  +SR+HK+IFHP TGLC+ +V    PL+LGPCS
Sbjct  369  WDWSDIRNSSLTQRLSVLQSPLQGPGLAQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCS  428

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S  W Y++ K LT++GTYFC+QA+KL KPA +G+ CT  +S+W+IISDS++HL SK  D
Sbjct  429  QSGAWAYSSRKVLTLKGTYFCIQADKLNKPAAVGIJCTTRNSQWDIISDSKLHLQSKTMD  488

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKS  151
            G+ VCLDVDS+N ++TN+C CL+ DSSCDP +QWFK++DST  ++ KS
Sbjct  489  GTEVCLDVDSSNTVVTNSCNCLSRDSSCDPGNQWFKLVDSTINSSPKS  536



>ref|XP_007159685.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
 gb|ESW31679.1| hypothetical protein PHAVU_002G258500g [Phaseolus vulgaris]
Length=565

 Score =   328 bits (841),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 180/222 (81%), Gaps = 0/222 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+DLRGTNVNDNRY +CFL +AAE D DWALWTL GSYY R+G VG+EEFYG+L 
Sbjct  318  FISEFGVDLRGTNVNDNRYLSCFLSVAAEHDLDWALWTLVGSYYFRQGVVGMEEFYGILN  377

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN SFL RIS +Q PFRGPG T+   +KLI+HP+TGLCV R +L +PL LGPC+
Sbjct  378  WDWNQVRNASFLNRISSLQLPFRGPGITKGNPYKLIYHPLTGLCVIRKTLLEPLTLGPCN  437

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L+V+GTYFC+ AE  G  A LG+ C+D +S+WE++SDS++HLSSKL D
Sbjct  438  LSDGWKYTPQKILSVKGTYFCIHAENEGMAATLGIICSDSNSRWEMVSDSKLHLSSKLSD  497

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS+VCLDVD NN+I+TN CKCL+ D +CDP+SQWFK+IDS R
Sbjct  498  GSDVCLDVDDNNIIVTNACKCLSRDHTCDPSSQWFKLIDSGR  539



>ref|XP_009359244.1| PREDICTED: uncharacterized protein LOC103949843 [Pyrus x bretschneideri]
Length=552

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 190/240 (79%), Gaps = 1/240 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRY NCF+  AAELD D++LWTL GSYY REG VG EE+YG+L 
Sbjct  309  FVSEFGADQRGTNVNDNRYLNCFMAAAAELDVDFSLWTLVGSYYFREGVVGTEEYYGILN  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN S  QR+S++QSP +GPG ++SR+HK+IFHP TGLC+ +V    PL+LGPCS
Sbjct  369  WDWSDIRNSSLTQRLSVLQSPLQGPGLSQSRMHKIIFHPATGLCLLKVGFLGPLKLGPCS  428

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S  W Y++ K LT++GTYFC+QA++L KPA +G+ CT  +S+W+IISDS++HL SK  D
Sbjct  429  QSGAWTYSSRKVLTLKGTYFCIQADELNKPAAVGILCTTTNSQWDIISDSKLHLQSKTTD  488

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT-TKSDFQSTSFLYFL  118
            G+ VCLDVDS+N ++T++CKCL+ D+SCDPASQWFK++DST  TT T    + TS ++ +
Sbjct  489  GTEVCLDVDSSNTVVTSSCKCLSRDNSCDPASQWFKLVDSTINTTPTSPILEITSVVHMI  548



>gb|KHN29014.1| Endoglucanase [Glycine soja]
Length=533

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 177/241 (73%), Gaps = 4/241 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRGTNVNDNRY NCFL L AELD DWA WTL GSYY REG +G+EEFYG+LT
Sbjct  287  FVSEFGGDLRGTNVNDNRYLNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLT  346

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + R+ SFL RIS +Q PFRGPG  E   +KLIFHP+TGLCV   S    L LGPCS
Sbjct  347  WDWTQVRSTSFLNRISALQIPFRGPGIIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCS  406

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L +  T FC+ AE+ GKPA L + C+D +SKWE+ISDS MHLSSKL D
Sbjct  407  SSDAWTYTPQKTLLINNTNFCIHAEQEGKPATLSITCSDANSKWEMISDSNMHLSSKLSD  466

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR----GTTTKSDFQSTSFL  127
            GSN+CLDVD NN+I+T  CKCLN D +CDPASQWFK+IDS R     T+T S   S   L
Sbjct  467  GSNLCLDVDDNNIIVTTACKCLNQDKTCDPASQWFKLIDSGRRSISTTSTLSMLNSPDIL  526

Query  126  Y  124
            +
Sbjct  527  W  527



>ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max]
Length=574

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/241 (64%), Positives = 177/241 (73%), Gaps = 4/241 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRGTNVNDNRY NCFL L AELD DWA WTL GSYY REG +G+EEFYG+LT
Sbjct  328  FVSEFGGDLRGTNVNDNRYLNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLT  387

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + R+ SFL RIS +Q PFRGPG  E   +KLIFHP+TGLCV   S    L LGPCS
Sbjct  388  WDWTQVRSTSFLNRISALQIPFRGPGIIEGSAYKLIFHPLTGLCVISKSQLTSLTLGPCS  447

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L +  T FC+ AE+ GKPA L + C+D +SKWE+ISDS MHLSSKL D
Sbjct  448  SSDAWTYTPQKTLLINNTNFCIHAEQEGKPATLSITCSDANSKWEMISDSNMHLSSKLSD  507

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR----GTTTKSDFQSTSFL  127
            GSN+CLDVD NN+I+T  CKCLN D +CDPASQWFK+IDS R     T+T S   S   L
Sbjct  508  GSNLCLDVDDNNIIVTTACKCLNQDKTCDPASQWFKLIDSGRRSISTTSTLSMLNSPDIL  567

Query  126  Y  124
            +
Sbjct  568  W  568



>ref|XP_004309996.1| PREDICTED: uncharacterized protein LOC101307271 [Fragaria vesca 
subsp. vesca]
Length=550

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 186/245 (76%), Gaps = 1/245 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RGTNVNDNRY NCFL  AA+LD ++ALWTL GSYYLR G +G+ E+YG+L 
Sbjct  306  FVSEFGIDQRGTNVNDNRYLNCFLAAAAQLDVEYALWTLVGSYYLRSGVLGMNEYYGLLN  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW E RN S LQR+S++QSPF+GPG +E R HK+I HP TGLC+ +V    PL+LGPCS
Sbjct  366  WNWGEIRNSSLLQRLSVLQSPFQGPGLSEVRKHKIILHPSTGLCLLKVGFMGPLKLGPCS  425

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S  W Y++ K L ++GTYFC+QA++LGKPA +G+ CTD +S+W+ ISDS++HL SK  D
Sbjct  426  QSGAWSYSSRKVLALKGTYFCIQADQLGKPAAVGIICTDTNSQWDTISDSKLHLQSKTPD  485

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSD-FQSTSFLYFL  118
            G+ VCLDVDS+N I+TN+CKCL+ D SCDP SQWF ++DST  + + S   Q  S L  L
Sbjct  486  GTEVCLDVDSSNTIVTNSCKCLSKDKSCDPGSQWFSLVDSTLTSKSTSPILQVNSVLDML  545

Query  117  AKKLF  103
               + 
Sbjct  546  GMNVL  550



>gb|KEH20742.1| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=558

 Score =   323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 176/220 (80%), Gaps = 1/220 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRGTNVNDNRY NCF+  AAELD DWALWTL GSYY R+G +G+EEFYG+  
Sbjct  310  FVSEFGVDLRGTNVNDNRYLNCFIAYAAELDLDWALWTLVGSYYFRQGVIGMEEFYGIFN  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN SFLQRI+ +Q PF+GPG T    HKL+FHP TGLCV R SL +PL+L PCS
Sbjct  370  WDWTQVRNASFLQRIASLQLPFQGPGITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCS  429

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L+V+GTYFC+QA K G PA L + C++ +SKW++ISDS++HLSSK+  
Sbjct  430  LSDGWNYTPQKILSVKGTYFCIQAVKEGMPATLSILCSNPNSKWDMISDSKLHLSSKINS  489

Query  294  GS-NVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            GS NVCLDV+ NN+I+TN CKCL+ND SCDP SQWFK+ID
Sbjct  490  GSTNVCLDVNDNNIIVTNACKCLSNDHSCDPGSQWFKLID  529



>gb|KHN29015.1| E3 ubiquitin-protein ligase RGLG2 [Glycine soja]
Length=826

 Score =   327 bits (839),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 183/237 (77%), Gaps = 2/237 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRGTNVN NRY NCFL LAAELD DWALWTL GSYY R+G +G+EEFYG+L+
Sbjct  582  FISEFGGDLRGTNVNHNRYLNCFLALAAELDLDWALWTLVGSYYFRQGVIGMEEFYGILS  641

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN +FL RIS +Q PFRGPG T    +KLIFHP+TGLCV R SL   L LGPC 
Sbjct  642  WDWIQVRNTTFLNRISALQLPFRGPGITRGNPYKLIFHPLTGLCVIRKSLLDRLTLGPCY  701

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L+++GTYFC+QAE  G PA LG+ C+D +S+WE+ISDS++HLSSKL D
Sbjct  702  LSDGWKYTPQKILSIKGTYFCMQAESEGMPATLGIMCSDPNSRWEMISDSKLHLSSKLSD  761

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY  124
             SNVCLDVD NN I+TN CKCL+ D +CDP+SQWFK+IDS  G+ +     ++S LY
Sbjct  762  DSNVCLDVDDNNNIVTNACKCLSKDRTCDPSSQWFKLIDS--GSRSMLTTSTSSMLY  816



>ref|XP_010044528.1| PREDICTED: uncharacterized protein LOC104433472 [Eucalyptus grandis]
 gb|KCW86615.1| hypothetical protein EUGRSUZ_B03243 [Eucalyptus grandis]
Length=560

 Score =   320 bits (819),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 186/248 (75%), Gaps = 0/248 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             VSEFG+D RGTN NDNRY +CF G+AA+LDFDWALWTL GSYYLREG VG+ E+YG L 
Sbjct  311  LVSEFGVDQRGTNANDNRYLSCFAGVAADLDFDWALWTLVGSYYLREGVVGMIEYYGALD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW E RN S  QR   +Q P +GPG +E+  HK+IFHP TGLCV R SL +P++LGPC+
Sbjct  371  ENWAELRNSSLFQRFRALQPPLKGPGLSETTPHKVIFHPATGLCVLRKSLLEPMKLGPCT  430

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W YT  K L+++ TYFC+QA ++GKPAKLG+ CT  +SKW+IIS+S+MHLSS   +
Sbjct  431  ESEAWNYTPQKVLSLKATYFCIQAVEVGKPAKLGIICTGSNSKWDIISESKMHLSSNTSN  490

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLA  115
            G++VCLDVDS+N I+T++CKCL+ DS CDP+SQWFK+++STR       F   + +  L 
Sbjct  491  GASVCLDVDSDNTIVTSSCKCLSRDSKCDPSSQWFKLVESTRSLCATRTFDLLNSILDLP  550

Query  114  KKLFASYI  91
            +K    ++
Sbjct  551  RKGLVGFL  558



>gb|KHN19917.1| hypothetical protein glysoja_032397 [Glycine soja]
Length=464

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRGT+VNDNRY NCF+ L A+LD DWALWTL G+YY+R+G VG+EE++G+L 
Sbjct  232  FVSEFGVDLRGTSVNDNRYLNCFMALVAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILN  291

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPL-ELGPC  478
             +W + RN SFLQRIS +Q PF+GPG +E++ +K+IFHP+TGLC+ R S  +PL  LGPC
Sbjct  292  SDWIQVRNTSFLQRISAIQLPFKGPGLSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPC  351

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            S SD W YT  K L+++GTYFCLQAE+ GK AKLG  C+  +S+WE+ISDS+MHLS++  
Sbjct  352  SNSDAWEYTDQKILSIKGTYFCLQAEEEGKQAKLGNACSGSNSRWEMISDSKMHLSTQTN  411

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            + S VCLDVD+NN+I+TN C+CL+ D++CDPA+QWFK++DSTR
Sbjct  412  NASGVCLDVDTNNIIVTNICQCLSKDNTCDPATQWFKLVDSTR  454



>ref|XP_003539156.1| PREDICTED: uncharacterized protein LOC100816102 [Glycine max]
Length=544

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRGT+VNDNRY NCF+ L A+LD DWALWTL G+YY+R+G VG+EE++G+L 
Sbjct  312  FVSEFGVDLRGTSVNDNRYLNCFMALVAQLDLDWALWTLGGNYYIRQGDVGMEEYFGILN  371

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPL-ELGPC  478
             +W + RN SFLQRIS +Q PF+GPG +E++ +K+IFHP+TGLC+ R S  +PL  LGPC
Sbjct  372  SDWIQVRNTSFLQRISAIQLPFKGPGLSEAKPYKVIFHPLTGLCILRNSPVEPLMRLGPC  431

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            S SD W YT  K L+++GTYFCLQAE+ GK AKLG  C+  +S+WE+ISDS+MHLS++  
Sbjct  432  SNSDAWEYTDQKILSIKGTYFCLQAEEEGKQAKLGNACSGSNSRWEMISDSKMHLSTQTN  491

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            + S VCLDVD+NN+I+TN C+CL+ D++CDPA+QWFK++DSTR
Sbjct  492  NASGVCLDVDTNNIIVTNICQCLSKDNTCDPATQWFKLVDSTR  534



>ref|XP_004170960.1| PREDICTED: uncharacterized LOC101217177, partial [Cucumis sativus]
Length=421

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTNVNDNRY +CFL +AAELD DWA+WTL GSYYLREG VGL EFYG+L 
Sbjct  173  FISEFGIDQRGTNVNDNRYLSCFLAVAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILD  232

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC  RN +FLQRIS +QSPF+GPG  E R + +IFHP++GLCV R SL  PL LGPC 
Sbjct  233  WNWCNLRNSTFLQRISALQSPFQGPGLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCV  292

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ++D W YT  K LT++GTYFC+QA+++GK AKLG+ CT +++KW++ISDS++HLSSK  +
Sbjct  293  DTDAWYYTPQKFLTLKGTYFCIQADEIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSN  352

Query  294  GSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLDVDS+ N I+TN+CKCL+ DSSCDP+SQWFK+++STR
Sbjct  353  GSLVCLDVDSSTNEIVTNSCKCLSRDSSCDPSSQWFKLVNSTR  395



>ref|XP_003524249.1| PREDICTED: uncharacterized protein LOC100789885 [Glycine max]
Length=571

 Score =   317 bits (812),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 174/241 (72%), Gaps = 4/241 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRGTNVNDNRY NCFL L AELD DWA WTL GSYY REG +G+EEFYG+LT
Sbjct  325  FVSEFGGDLRGTNVNDNRYLNCFLALVAELDLDWAYWTLVGSYYFREGVIGMEEFYGLLT  384

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + R+ SFL RIS +Q PFRGPG  E   HKLIFHP+TGLCV   S    L L  CS
Sbjct  385  WDWNQVRSTSFLNRISALQIPFRGPGIIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACS  444

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L V  T FC+ AE+  KPA L + C+D +SKWE+ISDS MHLSSKL D
Sbjct  445  SSDAWTYTPQKTLLVNNTDFCIHAEEERKPATLSMTCSDPNSKWEMISDSNMHLSSKLSD  504

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR----GTTTKSDFQSTSFL  127
            GSN+CLDVD NN+I+TN CKCL+ D +CDP SQWFK+IDS R     T+T S   S   L
Sbjct  505  GSNLCLDVDDNNIIVTNACKCLSKDKTCDPGSQWFKLIDSGRRSISTTSTLSMLNSPDLL  564

Query  126  Y  124
            +
Sbjct  565  W  565



>ref|XP_008446127.1| PREDICTED: uncharacterized protein LOC103488945 [Cucumis melo]
Length=554

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 185/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTNVNDNRY +CFL +AAE D DWALWTL GSYYLREG VGL EFYG+L 
Sbjct  304  FISEFGIDQRGTNVNDNRYLSCFLAVAAEFDLDWALWTLVGSYYLREGVVGLNEFYGILD  363

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC  RN +FLQRIS++Q+P +GPG  E R + LIFHP++GLCV R SL  PL LGPC 
Sbjct  364  WNWCNLRNSTFLQRISVLQTPLQGPGLAERREYNLIFHPLSGLCVVRKSLLDPLRLGPCV  423

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +SD W YT  K LT++GTYFC+QA+++GK AKLG+ CT +++KW++ISDS++HLSSK  +
Sbjct  424  DSDAWYYTPQKFLTLKGTYFCIQADEIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSN  483

Query  294  GSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLDVD+N N I+TN+CKCL+ DSSCDP+SQWFK+++STR
Sbjct  484  GSLVCLDVDANTNEIVTNSCKCLSRDSSCDPSSQWFKLVNSTR  526



>gb|KHN06534.1| Endoglucanase [Glycine soja]
Length=566

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 174/241 (72%), Gaps = 4/241 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRGTNVNDNRY NCFL L AELD DWA WTL GS+Y REG +G+EEFYG+L+
Sbjct  320  FVSEFGGDLRGTNVNDNRYLNCFLALVAELDLDWAYWTLVGSHYFREGVIGMEEFYGLLS  379

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + R+ SFL RIS +Q PFRGPG  E   HKLIFHP+TGLCV   S    L L  CS
Sbjct  380  WDWNQVRSTSFLNRISALQIPFRGPGIIEGNPHKLIFHPLTGLCVISKSQLTSLTLAACS  439

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT  K L V  T FC+ AE+  KPA L + C+D +SKWE+ISDS MHLSSKL D
Sbjct  440  SSDAWTYTPQKTLLVNNTDFCIHAEEERKPATLSMTCSDPNSKWEMISDSNMHLSSKLSD  499

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR----GTTTKSDFQSTSFL  127
            GSN+CLDVD NN+I+TN CKCL+ D +CDP SQWFK+IDS R     T+T S   S   L
Sbjct  500  GSNLCLDVDDNNIIVTNACKCLSKDKTCDPGSQWFKLIDSGRRSISTTSTLSMLNSPDLL  559

Query  126  Y  124
            +
Sbjct  560  W  560



>ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus]
Length=549

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTNVNDNRY +CFL +AAELD DWA+WTL GSYYLREG VGL EFYG+L 
Sbjct  301  FISEFGIDQRGTNVNDNRYLSCFLAVAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILD  360

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC  RN +FLQRIS +QSPF+GPG  E R + +IFHP++GLCV R SL  PL LGPC 
Sbjct  361  WNWCNLRNSTFLQRISALQSPFQGPGLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCV  420

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ++D W YT  K LT++GTYFC+QA+++GK AKLG+ CT +++KW++ISDS++HLSSK  +
Sbjct  421  DTDAWYYTPQKFLTLKGTYFCIQADEIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSN  480

Query  294  GSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLDVDS+ N I+TN+CKCL+ DSSCDP+SQWFK+++STR
Sbjct  481  GSLVCLDVDSSTNEIVTNSCKCLSRDSSCDPSSQWFKLVNSTR  523



>gb|KGN51727.1| hypothetical protein Csa_5G593400 [Cucumis sativus]
Length=550

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 186/223 (83%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTNVNDNRY +CFL +AAELD DWA+WTL GSYYLREG VGL EFYG+L 
Sbjct  302  FISEFGIDQRGTNVNDNRYLSCFLAVAAELDLDWAVWTLVGSYYLREGVVGLNEFYGILD  361

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNWC  RN +FLQRIS +QSPF+GPG  E R + +IFHP++GLCV R SL  PL LGPC 
Sbjct  362  WNWCNLRNSTFLQRISALQSPFQGPGLAERREYNVIFHPLSGLCVVRKSLLDPLTLGPCV  421

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ++D W YT  K LT++GTYFC+QA+++GK AKLG+ CT +++KW++ISDS++HLSSK  +
Sbjct  422  DTDAWYYTPQKFLTLKGTYFCIQADEIGKQAKLGIICTVNNAKWDMISDSKLHLSSKSSN  481

Query  294  GSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLDVDS+ N I+TN+CKCL+ DSSCDP+SQWFK+++STR
Sbjct  482  GSLVCLDVDSSTNEIVTNSCKCLSRDSSCDPSSQWFKLVNSTR  524



>ref|XP_008221942.1| PREDICTED: uncharacterized protein LOC103321869 [Prunus mume]
Length=584

 Score =   313 bits (802),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 179/219 (82%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCF+  AAELD D+ALWTL GSYYL++G +G+ E+YGVL 
Sbjct  354  FVSEFGVDQRGTNVNDNRYLNCFMATAAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLN  413

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN S  QR+S++QSPF+GPG ++SRLHK+IFHP TGLC+ +V    PL+LG CS
Sbjct  414  WDWSDVRNSSLSQRLSVLQSPFQGPGLSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCS  473

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S  W Y++ K LT++GTYFC+Q ++L KPA++G+ CT  +S+W+ ISDS +HLSSK  D
Sbjct  474  QSGAWSYSSKKILTLKGTYFCIQVDELEKPAQVGIICTTPNSQWDTISDSGLHLSSKTLD  533

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G++VCLDVDS+N I+T++CKCL  DSSCDP SQWFK++D
Sbjct  534  GTDVCLDVDSSNTIVTSSCKCLGRDSSCDPESQWFKLVD  572



>gb|KHG22500.1| Endoglucanase E1 [Gossypium arboreum]
Length=524

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 178/237 (75%), Gaps = 3/237 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRGTNVNDNRY NCFLG  AELD DWALWTL GSYYLREG +GL E+YG++ 
Sbjct  251  FVSEFGVDLRGTNVNDNRYLNCFLGTVAELDLDWALWTLVGSYYLREGVIGLNEYYGIMD  310

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW + RN SF++RIS +QSPFRG G +E+ LHK+IFHP+TGLCV R      L LGPC+
Sbjct  311  WNWIDMRNSSFVERISALQSPFRGLGLSETELHKVIFHPLTGLCVLRKQSGSSLSLGPCT  370

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W Y+  K L ++GT  CLQA++ G   KLG  C   +S+WE ISDS+MHLS KL +
Sbjct  371  DSEAWNYSPQKTLELKGTQLCLQADEPGTMVKLGTICGGSNSRWETISDSKMHLSLKLGN  430

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR---GTTTKSDFQSTS  133
             ++VC+D+DSNN ++   CKCLN+DS CDP SQWFK+++STR   G  +  DF S +
Sbjct  431  VTSVCMDIDSNNNVVVADCKCLNDDSQCDPKSQWFKLVNSTRSGNGGNSFVDFDSIT  487



>ref|XP_007223308.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
 gb|EMJ24507.1| hypothetical protein PRUPE_ppa003807mg [Prunus persica]
Length=547

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 179/219 (82%), Gaps = 0/219 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCF+  AAELD D+ALWTL GSYYL++G +G+ E+YGVL 
Sbjct  317  FVSEFGVDQRGTNVNDNRYLNCFMATAAELDVDFALWTLDGSYYLKDGVLGMNEYYGVLN  376

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + RN S  QR+S++QSPF+GPG ++SRLHK+IFHP TGLC+ +V    PL+LG CS
Sbjct  377  WDWSDIRNSSLSQRLSVLQSPFQGPGLSQSRLHKIIFHPATGLCLLKVGWLGPLKLGSCS  436

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S  W Y++ K L+++GTYFC+QA++L KPA++G+ CT  +S+W+ ISDS +HLSSK  +
Sbjct  437  QSGAWSYSSKKILSLKGTYFCIQADELEKPAQVGIICTTPNSQWDTISDSGLHLSSKTLN  496

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            G++VCLDVDS+N I+ ++CKCL  DSSCDP SQWFK++D
Sbjct  497  GTDVCLDVDSSNTIVASSCKCLGRDSSCDPESQWFKLVD  535



>ref|XP_007132485.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
 gb|ESW04479.1| hypothetical protein PHAVU_011G098000g [Phaseolus vulgaris]
Length=530

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 176/222 (79%), Gaps = 0/222 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRG++ NDNRY NCF+  AA+LD DWALWTL GSYY+R+G VG+ E YG+L 
Sbjct  307  FVSEFGLDLRGSDANDNRYINCFMAFAAQLDLDWALWTLGGSYYIRKGVVGMNESYGILN  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W E  N SFLQRIS +Q PFRGPG +E++  K+IFHP+TG C+ R SL + L LGPCS
Sbjct  367  SDWSEVSNPSFLQRISAIQIPFRGPGLSEAKPFKVIFHPLTGFCIIRKSLVEALRLGPCS  426

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT    L+++GT FCLQAE  GK AK+G  C   +S+WE+ISDS+MHLS+++ +
Sbjct  427  NSDGWEYTEQNILSIKGTNFCLQAEGEGKQAKIGNICLAPNSRWEMISDSKMHLSTQINN  486

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             S +CLDVD+NN+I+TNTCKCL+ D++C+PASQWFK++DSTR
Sbjct  487  SSGLCLDVDNNNIIVTNTCKCLSKDNTCEPASQWFKVVDSTR  528



>gb|KJB78033.1| hypothetical protein B456_012G173600 [Gossypium raimondii]
Length=579

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 178/244 (73%), Gaps = 0/244 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRGTNVNDNRY NCFLG+ AELD DWALWTL GSYYLREG +G  E+YG+L 
Sbjct  306  FVSEFGVDLRGTNVNDNRYLNCFLGMVAELDLDWALWTLVGSYYLREGVIGFNEYYGILD  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW + RN SF++RIS +QSPFRG G  E+ LHK+IFHP+TGLCV R      L LGPC+
Sbjct  366  WNWIDMRNSSFVERISALQSPFRGLGLLETELHKVIFHPLTGLCVLRKPSGSSLSLGPCT  425

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ W Y+  K L ++GT  CLQA++ G   KLG  C   +S+WE ISDS+MHLS KL +
Sbjct  426  DSEAWNYSPQKTLELKGTQLCLQADEPGTMVKLGTICGGSNSRWETISDSKMHLSLKLGN  485

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLYFLA  115
             ++VC+D+DSNN I+   CKCLN+DS CDP SQWFK+++STR     + F     +    
Sbjct  486  VTSVCMDIDSNNDIVVAGCKCLNDDSQCDPKSQWFKLVNSTRSGNGGNSFVDFDSITDFG  545

Query  114  KKLF  103
            K++F
Sbjct  546  KRVF  549



>gb|EPS61076.1| hypothetical protein M569_13724, partial [Genlisea aurea]
Length=411

 Score =   301 bits (772),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 176/223 (79%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+++ GTNVNDNRY NCF+G AAE D DWALWTLAGSYYLREG VG  E YGV +
Sbjct  175  FLSEFGVEMSGTNVNDNRYLNCFMGWAAEQDLDWALWTLAGSYYLREGVVGYNETYGVYS  234

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            ++W + RN + L +I+ +Q PFRGPGY E  +HK++FHP TGLCV+R SL   L LGPC 
Sbjct  235  FDWNQIRNGTILSKIASLQYPFRGPGYEEVPVHKVLFHPSTGLCVKRASLLDALALGPCV  294

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            E++ W  T  K LTV+GT FCL+A++ GKPAKL + C   ++KWE ISDS+MHLS+ L+D
Sbjct  295  EAEAWSNTTEKTLTVDGTPFCLEADESGKPAKLSVICDGQNTKWETISDSKMHLSATLED  354

Query  294  GSNVCLDVDSNNVIITNTCKCLNN-DSSCDPASQWFKIIDSTR  169
            GS VCL +DS+N IIT++CKCL++ +S+CDP +QWFKIIDSTR
Sbjct  355  GSKVCLSIDSDNNIITDSCKCLDDTNSTCDPGNQWFKIIDSTR  397



>ref|XP_010904543.1| PREDICTED: uncharacterized protein LOC105031942 [Elaeis guineensis]
Length=563

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 180/230 (78%), Gaps = 2/230 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RGTNVNDNRY  C LG+AAELD DWALW L GSYY+REG  GL+E YGVL 
Sbjct  310  FLSEFGVDQRGTNVNDNRYLGCMLGVAAELDLDWALWALQGSYYIREGIRGLDEVYGVLA  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+WC+ RN S LQRI  +Q+PF+GPG ++ + + +IFHP TGLCV + SLF+PLELGPC+
Sbjct  370  WDWCKTRNSSMLQRIQAIQAPFQGPGLSDIQPYTIIFHPSTGLCVLKKSLFEPLELGPCN  429

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-K  298
            ES+ W ++A + + ++ T  CL+A+  GKPAKLG+ C+D  SKWE+ISDS+MH+S+ +  
Sbjct  430  ESEAWTFSAEQTIALKDTLLCLKADGAGKPAKLGIICSDTQSKWELISDSKMHVSTNISS  489

Query  297  DGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKS  151
            + S++CLDVDS+   I+TN CKCL+ D SCDP SQWFK++DSTR T  K+
Sbjct  490  NASSLCLDVDSDGKSIVTNPCKCLSKDQSCDPESQWFKMVDSTRPTIYKN  539



>ref|XP_007159684.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
 gb|ESW31678.1| hypothetical protein PHAVU_002G258400g [Phaseolus vulgaris]
Length=573

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/241 (63%), Positives = 180/241 (75%), Gaps = 4/241 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRGTNVNDNRY  CFL L AELD DWA WTL GSYY+REG VG+EE YGVLT
Sbjct  327  FVSEFGGDLRGTNVNDNRYLTCFLALLAELDLDWAYWTLVGSYYIREGVVGMEEVYGVLT  386

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W + R++SFL RIS +Q PFRGPG  E   +KL+FHP+TGLCV R S    L LGPCS
Sbjct  387  WDWNQVRSISFLNRISALQHPFRGPGIIEGNSYKLMFHPVTGLCVIRKSQVNTLTLGPCS  446

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT+ K+L V  T  C+  E+  KPA L   C+D SSKWE+ISDS MHLSSKL D
Sbjct  447  SSDGWKYTSQKSLLVNDTNLCIHGERERKPATLSTACSDSSSKWEVISDSNMHLSSKLSD  506

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR----GTTTKSDFQSTSFL  127
            GSNVCLDVD++N+I+TNTCKCL+ D+ CDP +QWFK+IDS R     T+T S   S++ L
Sbjct  507  GSNVCLDVDADNIIVTNTCKCLSKDNKCDPGTQWFKLIDSGRRSISTTSTMSILDSSNLL  566

Query  126  Y  124
            +
Sbjct  567  W  567



>ref|XP_008236799.1| PREDICTED: uncharacterized protein LOC103335561 [Prunus mume]
Length=544

 Score =   302 bits (773),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 178/224 (79%), Gaps = 2/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             VSEFG+D RGTNVNDNRY +CF+  AAELD D+ALWTL GSYYLR+G +G+ E+YGVL 
Sbjct  315  LVSEFGVDQRGTNVNDNRYLSCFMAAAAELDLDFALWTLVGSYYLRDGVLGMNEYYGVLN  374

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W + RN S  QR+S++QSPF+GP  ++S  HK+IFHP TGLC+ +V    PL+LGPCS
Sbjct  375  SDWSDIRNSSLSQRLSVLQSPFQGPDISQSSWHKIIFHPATGLCLVQVGQLAPLKLGPCS  434

Query  474  ESDPWGYTA--GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            +S PW Y++   K LT++G+Y CLQ ++L KPAKLG+ C   +S+W+ ISDS +HLSSK 
Sbjct  435  QSGPWIYSSQTQKFLTLQGSYLCLQVDELEKPAKLGVICRPPNSQWDTISDSGLHLSSKT  494

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +G+NVCLDVDS+N I+TN+CKCL+ DSSC+P SQWFK++DSTR
Sbjct  495  LNGTNVCLDVDSSNTIVTNSCKCLSRDSSCNPESQWFKLVDSTR  538



>ref|XP_010250986.1| PREDICTED: uncharacterized protein LOC104593039 [Nelumbo nucifera]
Length=583

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RGTNVNDNR+ NCFLG+AA+LD+DWALWTL G YYLR+G VG++E YGVL+
Sbjct  306  FISEFGVDQRGTNVNDNRFLNCFLGVAAQLDWDWALWTLVGRYYLRQGVVGMDETYGVLS  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGY-TESRLHKLIFHPMTGLCVRRVSL-FQPLELGP  481
            W+W   RN +F+Q+IS +QSPF+GPG  +E   HK+IFHP TGLCV R SL  + L+LG 
Sbjct  366  WDWNNIRNSTFVQQISALQSPFQGPGLSSEVTPHKVIFHPSTGLCVVRKSLMMELLKLGS  425

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            C+ES+ W YT  K L+++ T  CLQA++LG+ AKLG+ C+D SS+W++ISDS+MH+SS L
Sbjct  426  CTESEAWSYTPEKTLSLKDTNLCLQADELGEAAKLGIICSDLSSRWDMISDSKMHISSNL  485

Query  300  KDGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
             +GS VC+DVDSN N IIT+ CKCL  D +CDP+ QWF I++STR TT
Sbjct  486  TNGSTVCIDVDSNTNTIITSQCKCLTKDHTCDPSGQWFIIVNSTRSTT  533



>ref|XP_008793719.1| PREDICTED: uncharacterized protein LOC103709945 [Phoenix dactylifera]
Length=530

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 176/237 (74%), Gaps = 2/237 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RGTNVNDNRY  C LG+AAELD DWALW L G+YY+REG +GL+E YGVL 
Sbjct  286  FLSEFGVDQRGTNVNDNRYLGCMLGVAAELDLDWALWALQGNYYVREGNLGLDEVYGVLA  345

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+WC+ RN S LQRI  +Q+PF+GPG +  + + +IFHP TGLCV + SLF+PL LGPC+
Sbjct  346  WDWCKIRNSSMLQRIQSIQAPFQGPGLSSMQPYTIIFHPSTGLCVLKKSLFEPLGLGPCN  405

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHL-SSKLK  298
            ES+ W +TA + + ++ T  CL+A+   KPAKLG+ C+D  SKWE+ISDS+MH+ +    
Sbjct  406  ESEAWTFTADQTIALKDTLICLKADGESKPAKLGIICSDTRSKWELISDSKMHVSTKSSS  465

Query  297  DGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSF  130
            + S++CLDV S+   I+TN C+CL+ D SCDP SQWFK+++STR T  K+      F
Sbjct  466  NSSSLCLDVGSDGRSIVTNPCRCLSKDQSCDPESQWFKMVNSTRPTINKNSLMELQF  522



>ref|XP_004504189.1| PREDICTED: uncharacterized protein LOC101490831 [Cicer arietinum]
Length=527

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 169/222 (76%), Gaps = 4/222 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG DLRGTNVNDNR+ NCF+  AA+ D DWALWTLAGSYY+ +G  G+EE YG+L 
Sbjct  309  IMSEFGGDLRGTNVNDNRFLNCFIAYAADQDLDWALWTLAGSYYINQGVFGVEEVYGILN  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W +PRN +FLQR++ +Q PFRGPG T+ + +KLI+HP+TGLCV R S  QPL+L  CS
Sbjct  369  SDWTKPRNPTFLQRLASLQLPFRGPGITQGKPYKLIYHPLTGLCVARKSKLQPLKLNACS  428

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             S+ W Y   K L++  +++C+QA   GKPA +   C    S W++ISDS +HLS+ + +
Sbjct  429  YSNGWNYKPQKTLSIYRSHYCIQAMNQGKPAIISKSC----STWDMISDSTLHLSTNINN  484

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            G+NVCLDVD NNVI+TN CKCL+NDS+CDPASQWFK+IDS +
Sbjct  485  GTNVCLDVDHNNVIVTNACKCLSNDSTCDPASQWFKLIDSGK  526



>gb|AES72136.2| cellulase (glycosyl hydrolase family 5) [Medicago truncatula]
Length=608

 Score =   288 bits (737),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 174/232 (75%), Gaps = 6/232 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRG N+N NR+FNCF+ +AAELD DWA WTL+GSYY+R+G V ++E +G+L 
Sbjct  312  FVSEFGLDLRGKNMNQNRFFNCFMAVAAELDLDWAYWTLSGSYYIRQGVVDVDETFGILN  371

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + RN SFLQRIS +Q PF+GPG  ES  +K+IFHP+ GLCV   SL +PL++GPCS
Sbjct  372  GNWSQVRNTSFLQRISAIQHPFQGPGLLESEPYKVIFHPLRGLCVLSKSLHEPLKMGPCS  431

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT    L ++GT FCLQ E  GK  KLG  C+   S WE+ISDS+MHLS  + +
Sbjct  432  NSDGWEYTPQNILLLKGTKFCLQGEGEGKQVKLGTTCSGPESTWEMISDSKMHLSYNVNN  491

Query  294  G---SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSD  148
                S+VCLDVD+NN+++TN+CKC++  ++CDPASQWFK++D    +TT SD
Sbjct  492  NGSTSSVCLDVDANNIVVTNSCKCISKVNTCDPASQWFKLVDR---STTSSD  540



>ref|XP_008389747.1| PREDICTED: uncharacterized protein LOC103452051 [Malus domestica]
Length=545

 Score =   285 bits (728),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 164/220 (75%), Gaps = 0/220 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNV DNRY NCF+  A ELD D+A W+L GSYYLR+G  G++E+YG+L 
Sbjct  305  FVSEFGVDQRGTNVIDNRYLNCFMAAAVELDVDFAQWSLVGSYYLRQGVKGMKEYYGILN  364

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   RN S  Q+IS++Q+  +G G    RLHK+IFHP TGLC+ +V    PL+LGPCS
Sbjct  365  SDWSGIRNSSLTQKISVLQTSIKGAGLHTPRLHKIIFHPATGLCLLKVGTRGPLKLGPCS  424

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ++  W Y++ K L +    FC+QA++L KPA LG+ CT  +S+WE ISDS+MHL SK  D
Sbjct  425  QTQGWTYSSTKVLLLNKNEFCIQADQLNKPAVLGIPCTTPNSRWETISDSQMHLQSKTTD  484

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDS  175
            G+ VCLDVDS+  I+TN CKCL+ DSSCDPASQWFK++DS
Sbjct  485  GTEVCLDVDSDKTIVTNACKCLSGDSSCDPASQWFKVVDS  524



>ref|XP_003601885.1| Endoglucanase [Medicago truncatula]
Length=655

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 170/225 (76%), Gaps = 3/225 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+DLRG N+N NR+FNCF+ +AAELD DWA WTL+GSYY+R+G V ++E +G+L 
Sbjct  302  FVSEFGLDLRGKNMNQNRFFNCFMAVAAELDLDWAYWTLSGSYYIRQGVVDVDETFGILN  361

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + RN SFLQRIS +Q PF+GPG  ES  +K+IFHP+ GLCV   SL +PL++GPCS
Sbjct  362  GNWSQVRNTSFLQRISAIQHPFQGPGLLESEPYKVIFHPLRGLCVLSKSLHEPLKMGPCS  421

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             SD W YT    L ++GT FCLQ E  GK  KLG  C+   S WE+ISDS+MHLS  + +
Sbjct  422  NSDGWEYTPQNILLLKGTKFCLQGEGEGKQVKLGTTCSGPESTWEMISDSKMHLSYNVNN  481

Query  294  G---SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
                S+VCLDVD+NN+++TN+CKC++  ++CDPASQWFK++ ++ 
Sbjct  482  NGSTSSVCLDVDANNIVVTNSCKCISKVNTCDPASQWFKLLGASE  526



>gb|KHN43979.1| Endoglucanase E1 [Glycine soja]
Length=471

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 170/225 (76%), Gaps = 7/225 (3%)
 Frame = -2

Query  831  VSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTW  652
            +SEFG DLRGTN NDN YFNC L LAA+LDFDWA WTLAGSYYLREGTVGL E YG+LT 
Sbjct  253  LSEFGWDLRGTNQNDNSYFNCLLPLAAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQ  312

Query  651  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  472
            N   P     LQRIS +Q P+RGPG +E   HK+IFHP+TGLC+      +PL+LGPCS 
Sbjct  313  NTTLPTTTFLLQRISAIQLPYRGPGLSEVEAHKVIFHPLTGLCIS--GKLEPLKLGPCSN  370

Query  471  SDPWGYTAGKALTVEG-TYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            S+ W YTA K L+V+G    CLQAE  GK AKLG  C    S WEI+SDS++HLSSK+ +
Sbjct  371  SEGWEYTAQKVLSVKGRNSTCLQAEGEGKEAKLGNEC----SVWEIVSDSKLHLSSKINN  426

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
             S+VCLDVDSNN I+TN CKCL+ D +CDPASQWFK++DSTR +T
Sbjct  427  ASDVCLDVDSNNNIVTNACKCLSGDKTCDPASQWFKLVDSTRKST  471



>ref|XP_010026597.1| PREDICTED: uncharacterized protein LOC104416968 [Eucalyptus grandis]
 gb|KCW59702.1| hypothetical protein EUGRSUZ_H02462 [Eucalyptus grandis]
Length=514

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 167/222 (75%), Gaps = 0/222 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRY NCF+ +AAE D+D+ALWTL G+YYLR+G VG EEFYG+  
Sbjct  292  FVSEFGADERGTNVNDNRYMNCFMAMAAEFDWDFALWTLQGNYYLRQGVVGKEEFYGLFN  351

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            ++W   RN S+L+RIS++Q PF+GPG  ++  HK+IFHP+TGLC+ R      L LGPC 
Sbjct  352  YDWSGIRNSSYLRRISVLQLPFQGPGGLQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCI  411

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
             S+PW YT   AL V G    L+A  LG+PA+LG   T+  +KWE+IS S MHLSSK +D
Sbjct  412  YSEPWSYTPQNALWVMGLPLYLRAIGLGRPARLGTSPTEPGTKWEMISASEMHLSSKAED  471

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLDV+++N ++   CKCL+++SSCDPASQWF+++D TR
Sbjct  472  GSTVCLDVNTHNTVMVEACKCLSSESSCDPASQWFRLVDRTR  513



>ref|XP_003552802.1| PREDICTED: uncharacterized protein LOC100805196 [Glycine max]
Length=533

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 170/225 (76%), Gaps = 7/225 (3%)
 Frame = -2

Query  831  VSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTW  652
            +SEFG DLRGTN NDN YFNC L LAA+LDFDWA WTLAGSYYLREGTVGL E YG+LT 
Sbjct  315  LSEFGWDLRGTNQNDNSYFNCLLPLAAQLDFDWAYWTLAGSYYLREGTVGLIEVYGILTQ  374

Query  651  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  472
            N   P     LQRIS +Q P+RGPG +E   HK+IFHP+TGLC+      +PL+LGPCS 
Sbjct  375  NTTLPTTTFLLQRISAIQLPYRGPGLSEVEAHKVIFHPLTGLCIS--GKLEPLKLGPCSN  432

Query  471  SDPWGYTAGKALTVEG-TYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            S+ W YTA K L+V+G    CLQAE  GK AKLG  C    S WEI+SDS++HLSSK+ +
Sbjct  433  SEGWEYTAQKVLSVKGRNSTCLQAEGEGKEAKLGNEC----SVWEIVSDSKLHLSSKINN  488

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
             S+VCLDVDSNN I+TN CKCL+ D +CDPASQWFK++DSTR +T
Sbjct  489  ASDVCLDVDSNNNIVTNACKCLSGDKTCDPASQWFKLVDSTRKST  533



>ref|XP_009385963.1| PREDICTED: uncharacterized protein LOC103973176 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=556

 Score =   278 bits (712),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 164/223 (74%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N  DN + +CFL  AAE D DWALW L GSYY+REG +GL+E YG L+
Sbjct  314  FLSEFGIDQRGVNEADNHFLSCFLSFAAEKDIDWALWALQGSYYIREGQLGLDETYGALS  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+WC+ RN SF+QR+S +QSPF+GPG ++S  + +IFHP TGLC+   S  + L+LG C+
Sbjct  374  WDWCKARNSSFIQRLSAIQSPFQGPGLSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCA  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-K  298
            ES  W YT  K L ++GT +CLQ E + KPAKLG  C   S+KW +IS S+MH+SS L  
Sbjct  434  ESTAWRYTRQKKLMLKGTKYCLQPEGVSKPAKLGFGCKVSSAKWHLISSSKMHISSNLTN  493

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            +G+NVCLD+D N  I+TN CKCL+ D +C+P SQWFKII S+R
Sbjct  494  NGNNVCLDIDDNGTIMTNQCKCLSLDGTCNPGSQWFKIIRSSR  536



>ref|XP_009385956.1| PREDICTED: uncharacterized protein LOC103973176 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   278 bits (712),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 164/223 (74%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N  DN + +CFL  AAE D DWALW L GSYY+REG +GL+E YG L+
Sbjct  314  FLSEFGIDQRGVNEADNHFLSCFLSFAAEKDIDWALWALQGSYYIREGQLGLDETYGALS  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+WC+ RN SF+QR+S +QSPF+GPG ++S  + +IFHP TGLC+   S  + L+LG C+
Sbjct  374  WDWCKARNSSFIQRLSAIQSPFQGPGLSKSSPYNMIFHPSTGLCIVTNSQLKQLQLGQCA  433

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-K  298
            ES  W YT  K L ++GT +CLQ E + KPAKLG  C   S+KW +IS S+MH+SS L  
Sbjct  434  ESTAWRYTRQKKLMLKGTKYCLQPEGVSKPAKLGFGCKVSSAKWHLISSSKMHISSNLTN  493

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            +G+NVCLD+D N  I+TN CKCL+ D +C+P SQWFKII S+R
Sbjct  494  NGNNVCLDIDDNGTIMTNQCKCLSLDGTCNPGSQWFKIIRSSR  536



>ref|XP_010250979.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010250981.1| PREDICTED: uncharacterized protein LOC104593037 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 163/222 (73%), Gaps = 1/222 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGIDLRGTNV DNRY +C  G+AAELDFDWALWTL GSYYLREG +GLEE YGV+ 
Sbjct  311  FVSEFGIDLRGTNVKDNRYSSCIFGVAAELDFDWALWTLMGSYYLREGVLGLEEVYGVMN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W  PRN +FL+R+S ++S FRGPG  E   +++++HP+TGLCV+R S  + L+LG C 
Sbjct  371  WDWSGPRNSTFLRRLSSIRSAFRGPGLDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCD  430

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            E   W YT    + V+GT  CL  ++LG+ A L   C    S W  I+DS+MHL+SKL  
Sbjct  431  EPASWIYTPEMTIKVKGTGLCLHGDRLGERANLQ-DCNSPGSIWMPITDSKMHLASKLAG  489

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLD+DS N IIT+ C+CL  D +CDP SQWFKII+STR
Sbjct  490  GSTVCLDIDSKNKIITSPCQCLLGDPTCDPGSQWFKIINSTR  531



>ref|XP_010250982.1| PREDICTED: uncharacterized protein LOC104593037 isoform X2 [Nelumbo 
nucifera]
Length=531

 Score =   276 bits (705),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 163/222 (73%), Gaps = 1/222 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGIDLRGTNV DNRY +C  G+AAELDFDWALWTL GSYYLREG +GLEE YGV+ 
Sbjct  309  FVSEFGIDLRGTNVKDNRYSSCIFGVAAELDFDWALWTLMGSYYLREGVLGLEEVYGVMN  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W  PRN +FL+R+S ++S FRGPG  E   +++++HP+TGLCV+R S  + L+LG C 
Sbjct  369  WDWSGPRNSTFLRRLSSIRSAFRGPGLDEVTPYQILYHPLTGLCVQRASQKKQLKLGSCD  428

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            E   W YT    + V+GT  CL  ++LG+ A L   C    S W  I+DS+MHL+SKL  
Sbjct  429  EPASWIYTPEMTIKVKGTGLCLHGDRLGERANLQ-DCNSPGSIWMPITDSKMHLASKLAG  487

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            GS VCLD+DS N IIT+ C+CL  D +CDP SQWFKII+STR
Sbjct  488  GSTVCLDIDSKNKIITSPCQCLLGDPTCDPGSQWFKIINSTR  529



>ref|XP_010682344.1| PREDICTED: uncharacterized protein LOC104897211 [Beta vulgaris 
subsp. vulgaris]
Length=549

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 166/227 (73%), Gaps = 1/227 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G+DLRGTN NDNRY NCFL   AE D DWALWTLAG+YYLREG VG+ E+YG+L 
Sbjct  313  FVSEWGVDLRGTNTNDNRYLNCFLAWIAEHDLDWALWTLAGNYYLREGVVGMVEYYGLLN  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLF-QPLELGPC  478
             +W + RN SFL+RIS++Q+P +GPG ++   H +I+HP TGLCV +  +    ++LG C
Sbjct  373  SDWTQVRNTSFLERISVIQAPLQGPGMSQRTEHNIIYHPSTGLCVVKKPMTPMGVQLGNC  432

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            +ES+ W YT  + LT++G+Y CL A+ +  PA+L L+C    ++W  ISDS++HLS+ L 
Sbjct  433  AESNRWTYTPSQTLTIKGSYLCLHAQGMNLPARLSLYCPGVGTRWTPISDSKLHLSASLS  492

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  157
                VCLDVDS+N +IT TCKCL+ND+ CDP SQWFKI++     TT
Sbjct  493  RRVTVCLDVDSDNNLITTTCKCLSNDNKCDPGSQWFKIVEVADTITT  539



>ref|XP_010026596.1| PREDICTED: uncharacterized protein LOC104416965 [Eucalyptus grandis]
Length=515

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 164/223 (74%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRY NCF+ +AAE D+D+ALWTL GSYYLR+G VG EEFYG+  
Sbjct  292  FVSEFGADERGTNVNDNRYMNCFMAMAAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFN  351

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            ++W   RN S+L+RIS++Q PF+GPG  ++  HK+IFHP+TGLC+ R      L LGPC 
Sbjct  352  YDWSGIRNSSYLRRISVLQLPFQGPGGRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCI  411

Query  474  ESDPWGYTAGKAL-TVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S+PW +T   AL  + G    L+A  LG+PA LG   T+  +KWE+IS S MHLSS  +
Sbjct  412  YSEPWSHTPQNALGLMAGKPLYLRAVGLGRPATLGTSPTEPGTKWEMISASEMHLSSMAE  471

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            DGS VCLDV +NN ++   CKCL+++SSCDPASQWF+++D TR
Sbjct  472  DGSTVCLDVIANNTVMVEACKCLSSESSCDPASQWFRLVDRTR  514



>gb|EYU30606.1| hypothetical protein MIMGU_mgv1a018920mg, partial [Erythranthe 
guttata]
Length=504

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 167/251 (67%), Gaps = 37/251 (15%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D+RG+NVNDNR+ NCF+G AAE D DWALW L GSYY+REG VGL+E YGV  
Sbjct  285  LLSEFGVDMRGSNVNDNRFLNCFMGWAAEQDVDWALWALTGSYYIREGVVGLDETYGVYN  344

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW E RN + LQ+IS +Q PFRGP                                 CS
Sbjct  345  WNWGEIRNQTTLQKISALQYPFRGP---------------------------------CS  371

Query  474  ESDPWGY-TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            E++ W Y T  K LT+ GTYFCL+A++LG+PAKLG+FC+D ++KWE IS+S+ HLSSKL 
Sbjct  372  EAEAWSYSTPQKTLTIVGTYFCLEADELGQPAKLGIFCSDATTKWEAISESKNHLSSKLG  431

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQST---SFL  127
            DG+ VCLD+DS+N I+TN CKCLN +S CDP SQWFKIIDSTR  TT ++       S +
Sbjct  432  DGTKVCLDIDSDNNIVTNNCKCLNRNSKCDPGSQWFKIIDSTRSATTDNNLLHRVIGSIV  491

Query  126  YFLAKKLFASY  94
              +AK    S+
Sbjct  492  KLIAKIFLGSF  502



>ref|XP_010528075.1| PREDICTED: uncharacterized protein LOC104805267 [Tarenaya hassleriana]
Length=575

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 170/231 (74%), Gaps = 3/231 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RG N NDNR+ NCF+ +AAELD DWALWTLAGSYY RE  +G +E++GVL 
Sbjct  305  FVSEFGVDQRGNNRNDNRFLNCFMAVAAELDLDWALWTLAGSYYTREKAIGADEYFGVLD  364

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
            W+W   RN +F QRIS +Q PFRGPG  E+  HK+IFHP TGLCV R S   P  L+LGP
Sbjct  365  WSWIGIRNSTFFQRISAIQRPFRGPGLMETYPHKVIFHPSTGLCVVRESWPNPFRLKLGP  424

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSK  304
            C+ESD W +T  + L+V+    C++ ++ G+PAKL +F ++ S SKW++ S+S+M L+S 
Sbjct  425  CNESDSWRHTPHRILSVKEQLLCIKVDERGQPAKLRIFFSEASCSKWKVTSESKMQLASL  484

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKS  151
               G++VCLDVDS++ I+T +CKCL+ +  CDP SQWFK++ STR   TK+
Sbjct  485  TWSGASVCLDVDSDSNIVTTSCKCLHGNEPCDPGSQWFKLVTSTRRRRTKA  535



>ref|XP_010249431.1| PREDICTED: uncharacterized protein LOC104591975 [Nelumbo nucifera]
Length=541

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGIDLRG ++ DNRY NC  G+AAELDFDWALW   GSYYLREG +GL+E Y V+ 
Sbjct  314  FVSEFGIDLRGGSLADNRYSNCIFGVAAELDFDWALWAFMGSYYLREGVMGLDEVYAVMN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLE--LGP  481
            W W  PRN +FL+R+S +QSPFRG G  E   +++++HP+TGLCV+R S  +PL+  LG 
Sbjct  374  WGWSGPRNSTFLRRLSALQSPFRGAGLDEVAPYQILYHPLTGLCVQRGSFKKPLDLKLGS  433

Query  480  CSESDPWGYTAGKALTVEG-TYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C+ES  W YT    L V G T  CLQA+ LG+ AKL   C+  ++KW+ ISDSRMHLS+ 
Sbjct  434  CAESAQWMYTPEMTLAVNGTTVLCLQADGLGRRAKLRGDCSSPATKWKPISDSRMHLSTT  493

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
            L   S  CLD+DS N II + C+CL  D+SCDPASQWFKII ST
Sbjct  494  LPTNSTACLDIDSKNNIIASRCQCLWGDASCDPASQWFKIIYST  537



>ref|XP_008793758.1| PREDICTED: uncharacterized protein LOC103709981 [Phoenix dactylifera]
Length=549

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 170/230 (74%), Gaps = 2/230 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D  G N+ DNR+ +CFL +AAELD DWALW L GSYY+REG +G +E YGVL 
Sbjct  311  FLSEFGVDQSGRNMADNRFLSCFLSVAAELDLDWALWALQGSYYIREGQLGYDETYGVLG  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
            W+WC+ RN SF+ RI+ +Q+PF+GPG + +  + +IFHP+TGLC V++ S    LELG C
Sbjct  371  WDWCKARNSSFVNRIAALQAPFQGPGLSNNSPYDIIFHPLTGLCVVKKSSSKNLLELGLC  430

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
            + S+ W YTA + + +EGT +C+ A+  G+ A+LG  C   +S WE+ISDSRMH+SSKL 
Sbjct  431  ANSEAWNYTAEQNVMLEGTKYCMLAKGAGRRARLGTGCGGSNSIWELISDSRMHVSSKLP  490

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKS  151
            K+GS VCLD+  +  IITN CKCL+ D +C+P SQWFKII STR   +++
Sbjct  491  KNGSTVCLDISQDGTIITNLCKCLSQDGTCNPDSQWFKIIRSTRERESQT  540



>ref|XP_010026600.1| PREDICTED: uncharacterized protein LOC104416972 [Eucalyptus grandis]
Length=647

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 164/223 (74%), Gaps = 1/223 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRY NCF+ +AAE D+D+ALWTL GSYYLREG VG+EEFYG+  
Sbjct  424  FVSEFGADERGTNVNDNRYMNCFMAMAAEFDWDFALWTLQGSYYLREGVVGVEEFYGLFN  483

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   RN S+L+R+S++Q PF+GPG  ++   K+IFHP+TGLC+ R +    L LGPC 
Sbjct  484  NDWSGIRNSSYLRRLSVLQLPFQGPGGRQTVAQKVIFHPLTGLCILRRTRPTRLVLGPCI  543

Query  474  ESDPWGYTAGKAL-TVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S+PW +T   AL  + G    L+A  LG+PA LG   T+  +KWE+IS S MHLSS  +
Sbjct  544  YSEPWSHTPQNALGLMAGKPLYLRAVGLGRPATLGTSPTEPGTKWEMISASEMHLSSMAE  603

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            DGS VCLD+ +NN ++   CKCL+++SSCDPASQWF+++D TR
Sbjct  604  DGSTVCLDMIANNTVMVEACKCLSSESSCDPASQWFRLVDRTR  646


 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  327  SRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            S +HLSSK KD S VCLD+ +NN ++   CKCL  ++SCD ASQWFK+ D+ R
Sbjct  3    SELHLSSKAKDRSAVCLDMGANNTVVVEACKCLGGNNSCDLASQWFKLADTNR  55



>emb|CAN62580.1| hypothetical protein VITISV_036569 [Vitis vinifera]
Length=221

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 154/224 (69%), Gaps = 26/224 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR+ NCF GLAAELDFDWALWTL             EE  G++ 
Sbjct  16   FVSELGVD-------DNRHLNCFFGLAAELDFDWALWTL-------------EETNGLMN  55

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       SF QRIS +QSP +GP  +  R HK+IFHP TGLC+ R S  +PL+LGPC+
Sbjct  56   WN------SSFFQRISALQSPLQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCT  109

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ WGYT  K LTV+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL D
Sbjct  110  KSEAWGYTPQKLLTVKGTYFCLQAVGLGKPAKLSIICTKPGSNWEIISDSKMYLSTKLGD  169

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  163
            G+ VCLDVDS++ I+T+ CKCL     CDP SQWFK++DST  T
Sbjct  170  GTRVCLDVDSSSTIVTDACKCLGRGDMCDPGSQWFKVVDSTNIT  213



>ref|XP_010249430.1| PREDICTED: uncharacterized protein LOC104591974 [Nelumbo nucifera]
Length=538

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG + N +R+ NCF G+AA+LDFDWALW   GSYYLREG   L E Y VL 
Sbjct  313  FLSEFGIDLRGGDPNGDRFSNCFFGVAADLDFDWALWAFMGSYYLREGYYALNEVYAVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W +PRN +FL+R++ +QSPFRGPG+++ R + +++HP+TGLCV++VS  +P++LG C+
Sbjct  373  WDWAKPRNTTFLKRVAGIQSPFRGPGFSDVRPYNILYHPLTGLCVQKVSPMEPVKLGSCA  432

Query  474  ES-DPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
             + + W YT  K L +  G  +CLQA+ +G    LG  C+   S W  IS S++HLSSKL
Sbjct  433  AAPEAWIYTPQKTLMLNNGMRYCLQADGVGNGVMLGNACSGPGSNWYQISASKLHLSSKL  492

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +G++VCLD+D +  I+TNTC+CL  D +CDPA QWFKII STR
Sbjct  493  ANGTSVCLDIDPSYNIVTNTCQCLTGDKTCDPAGQWFKIITSTR  536



>emb|CAN72915.1| hypothetical protein VITISV_020826 [Vitis vinifera]
Length=221

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 152/224 (68%), Gaps = 26/224 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR+ NCF GLAAELDFDWALWTL             EE  G++ 
Sbjct  16   FVSELGVD-------DNRHLNCFFGLAAELDFDWALWTL-------------EETNGLMN  55

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       +F QRIS  QSP +GP  +  R HK+I HP TGLC+ R SL +PL+LGPC+
Sbjct  56   WN------SNFFQRISAXQSPLQGPDVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCT  109

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ WGYT  K L V+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL D
Sbjct  110  ESEAWGYTPQKILIVKGTYFCLQAVGLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGD  169

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  163
            G+ VCLDVDS++ I+T+ CKCL  D  CDP SQWF ++DST  T
Sbjct  170  GTTVCLDVDSSSNIVTDACKCLGRDDMCDPGSQWFNVVDSTNIT  213



>emb|CAN73208.1| hypothetical protein VITISV_009079 [Vitis vinifera]
Length=221

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 151/221 (68%), Gaps = 26/221 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR+ NCF GLAA LDFDWALWTL             EE  G++ 
Sbjct  16   FVSELGVD-------DNRHLNCFFGLAAXLDFDWALWTL-------------EETNGLMN  55

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       +F QRIS  QSP +GP  +  R HK+I HP TGLC+ R SL +PL+LGPC+
Sbjct  56   WN------SNFFQRISAXQSPLQGPDVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCT  109

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ WGYT  K L V+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL D
Sbjct  110  ESEAWGYTPQKILIVKGTYFCLQAVGLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGD  169

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
            G+ VCLDVDS++ I+T+ CKCL  D  CDP SQWFK++DST
Sbjct  170  GTTVCLDVDSSSNIVTDACKCLGRDDXCDPGSQWFKVVDST  210



>ref|XP_010556349.1| PREDICTED: uncharacterized protein LOC104825675 [Tarenaya hassleriana]
Length=555

 Score =   263 bits (672),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 159/225 (71%), Gaps = 5/225 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N+NDNR+F CFLG AAE D DWALW L+GSYY+REG  G+ EFYG L 
Sbjct  313  FLSEFGIDERGGNINDNRFFGCFLGWAAENDIDWALWVLSGSYYIREGVAGMVEFYGALD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W + RN SFLQRIS++QSP +GPG  ++  + LIFHP+TGLC+ + S   P  L LGP
Sbjct  373  ADWNDARNSSFLQRISLLQSPLQGPG-PQTGDYNLIFHPLTGLCMVQ-SQINPTKLALGP  430

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            C ES+PW YT+   L ++G  FCLQ    GKP KLG+ C    SKW  IS S MHL+S  
Sbjct  431  CYESEPWSYTSENNLKIQGLPFCLQNTGTGKPVKLGISCWSPVSKWHTISASEMHLASTT  490

Query  300  KDGSNVCLDVD-SNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +  ++CLDVD SNNV+I N CKC+  DS C P SQWFKII +TR
Sbjct  491  SEQISLCLDVDGSNNVVIANDCKCMAEDSRCQPMSQWFKIIKATR  535



>ref|XP_010904544.1| PREDICTED: uncharacterized protein LOC105031943 [Elaeis guineensis]
Length=554

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 171/232 (74%), Gaps = 2/232 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D  G N+ DNR+ +CFL +AAELD DWALW L GSYY+REG +G +E YG+L 
Sbjct  316  FLSEFGVDQSGRNMADNRFLSCFLSVAAELDLDWALWALQGSYYIREGQLGYDETYGLLG  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
            W+WC+ RN SF+ RIS +Q+PF+GPG + +  + +IFHP+TGLC V++ S    LELG C
Sbjct  376  WDWCKARNSSFVNRISALQAPFQGPGLSNNSPYNIIFHPLTGLCVVKKFSSKNLLELGQC  435

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            ++S+ W YTA + + +E T +C+ A+ +G+ A+LG  C   +S WE+ISDS+MH+S+KL 
Sbjct  436  ADSEAWNYTAEQHVMLEDTKYCMLAKGVGRRARLGTSCGGSNSIWELISDSKMHVSTKLP  495

Query  297  -DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDF  145
             +GS VCLD+  +  +ITN CKCL+ D +C+P SQWFKII STR   +++ +
Sbjct  496  INGSTVCLDISQDGTVITNLCKCLSLDGTCNPDSQWFKIIRSTRERESQTAY  547



>gb|KFK33555.1| hypothetical protein AALP_AA5G028800 [Arabis alpina]
Length=552

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 175/255 (69%), Gaps = 17/255 (7%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RG N NDN + +CF+ LAA+LD DWALWT+ GSYY+RE T+  +E YGVL 
Sbjct  307  FVSEFGVDQRGNNANDNMFLSCFMALAADLDLDWALWTVVGSYYVREKTIEYDETYGVLD  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW   RN + LQ IS +QSPFRGPG  E+   K++FHP TGLCV R SLFQ L+LG C 
Sbjct  367  WNWSSIRNSTMLQMISSIQSPFRGPGLMETHPKKIMFHPSTGLCVVRKSLFQ-LKLGSCD  425

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKL-----GLFCTDDSSKWEIISDSRMHL  313
            + + W  T+ + L++ E   FCL+A + GK  KL     GL+C    SKW++ S+S+M +
Sbjct  426  KPESWRLTSHRVLSLREEEIFCLKAYEKGKSVKLRVFFFGLYC----SKWKLKSESKMQI  481

Query  312  SSKLKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQST  136
            SS  + G++VCLDVDS NN I+TN+CKCL  +SSCDP SQWFK++ STR     S F+  
Sbjct  482  SSVSRSGNSVCLDVDSENNNIVTNSCKCLKGNSSCDPRSQWFKLVTSTR-----SRFKPK  536

Query  135  SFLYFLAKKLFASYI  91
             FL F  KK F S I
Sbjct  537  PFLQFSPKKTFLSLI  551



>ref|XP_004975980.1| PREDICTED: uncharacterized protein LOC101758857 [Setaria italica]
Length=557

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 165/232 (71%), Gaps = 3/232 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT++ DNRY  CFL +AAE+D DWA+W L GSYY+REG +  +E YG+L+
Sbjct  311  FFSEFGFDMSGTHIGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLS  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   SR  + LIFHP TGLCV   S  + LELGPC
Sbjct  371  WDWCTARNPSFIKRINSLQSPFQGPGLPNSREPYNLIFHPQTGLCVLATS-SKSLELGPC  429

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
              S+ W YT+   L V+ T  CLQA+ +G+ AKLG  C+  SSKW++IS+SRMH+S++L 
Sbjct  430  DRSNAWNYTSAYELVVKSTGQCLQAKSVGENAKLGTDCSKPSSKWQLISNSRMHVSAELT  489

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDF  145
            K+G+ VCLD   +  IITN CKCL  D +C+P SQWFK+I S+R T   S  
Sbjct  490  KNGTRVCLDAGPDGAIITNQCKCLIIDPACNPESQWFKVILSSRDTPGGSSI  541



>emb|CDX83590.1| BnaC07g23300D [Brassica napus]
Length=557

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 174/244 (71%), Gaps = 9/244 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG NVNDNR+ +CF+ LAA+LD DWALWTLAGSYY+RE T+G +E YGVL 
Sbjct  308  FVSEFGIDQRGNNVNDNRFLSCFMALAADLDLDWALWTLAGSYYIREKTIGYDETYGVLD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W   RN + LQ IS +QSPFRGPG  E+   K+IFHP TGLC+ R SLFQ L+LG C 
Sbjct  368  WSWSSIRNSTILQMISAIQSPFRGPGLMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCD  426

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKL  301
             S+ +  ++ + L++ E    CL+A + GK  KL L+ ++   S+W+++S+S+M LSS  
Sbjct  427  RSESFRLSSQRVLSLAEEKILCLKAYEKGKSVKLRLYFSESYCSRWKLLSESKMQLSSIT  486

Query  300  KDGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDF-----QS  139
            K+G +VCLDVDS+ N I+T +CKCL  D+SCDP SQWFK++ STR     + F     QS
Sbjct  487  KNGESVCLDVDSDSNNIVTKSCKCLEEDASCDPKSQWFKVVTSTRSRFRANPFLRVSPQS  546

Query  138  TSFL  127
             +FL
Sbjct  547  KTFL  550



>gb|ACN33507.1| unknown [Zea mays]
Length=369

 Score =   254 bits (650),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT++ DNRY  CFL +AAE+D DWA+W L GSYY+REG +  +E YG+LT
Sbjct  123  FFSEFGFDMSGTHIGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLT  182

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QS F+GPG   ++  + +IFHP +GLCV   S  + LELGPC
Sbjct  183  WDWCTARNPSFIKRINSLQSAFQGPGLPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPC  241

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L V+ T  CLQA+ +GK AKLG  C+  SSKW +ISDS+MH+S++L 
Sbjct  242  DESNAWNYTSAYELVVKSTGQCLQAQSVGKNAKLGTDCSKPSSKWHLISDSKMHVSAELA  301

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            K+G+ VCL+   +  I TN CKCL+ D +CDP SQWFK+I S+R
Sbjct  302  KNGTRVCLEASPDGAIRTNQCKCLSVDPTCDPESQWFKVILSSR  345



>ref|XP_002284888.2| PREDICTED: uncharacterized protein LOC100258876 [Vitis vinifera]
Length=518

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 154/224 (69%), Gaps = 26/224 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR+ NCF GLAAELDFDWALWTL             EE  G++ 
Sbjct  313  FVSELGVD-------DNRHLNCFFGLAAELDFDWALWTL-------------EETNGLMN  352

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       +F QRIS +QSP +GP  +  R HK+I HP TGLC+ R SL +PL+LGPC+
Sbjct  353  WNS------NFFQRISALQSPLQGPDVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCT  406

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ WGYT  K L V+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL D
Sbjct  407  ESEAWGYTPQKILIVKGTYFCLQAVGLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGD  466

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  163
            G+ VCLDVDS++ I+T+ CKCL  D  CDP SQWFK++DST  T
Sbjct  467  GTTVCLDVDSSSNIVTDACKCLGRDDMCDPGSQWFKVVDSTNIT  510



>ref|XP_010514258.1| PREDICTED: uncharacterized protein LOC104790245 [Camelina sativa]
Length=562

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/237 (54%), Positives = 169/237 (71%), Gaps = 4/237 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RG NVNDN++ +CF+ LAA+LD DWALWTLAGSYY+R  T+G +E YGVL 
Sbjct  311  FVSEFGVDQRGNNVNDNKFLSCFMALAADLDLDWALWTLAGSYYIRGRTIGSDETYGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW   RN + LQ +S +Q+PFRGPG  E++  K++FHP++GLCV R SLFQ L+LG C+
Sbjct  371  WNWLSIRNSTILQMVSTIQTPFRGPGLMETQPKKIMFHPLSGLCVVRKSLFQ-LKLGSCN  429

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKL  301
             S+ W  ++ + L++ E    CL+A + G   KL LF T+   SKW ++SDS+M LSS  
Sbjct  430  RSESWRLSSHRVLSLAEERILCLKAYEKGNSVKLRLFFTEFHCSKWRLLSDSKMQLSSVT  489

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  133
            K+G+ VCLDVDS +N I+T  CKCL  +SSCDP SQWFK++ STR  +    F   S
Sbjct  490  KNGAFVCLDVDSRSNKIVTRRCKCLQGNSSCDPRSQWFKLVTSTRRRSISKPFLQIS  546



>emb|CDY13613.1| BnaA06g33100D [Brassica napus]
Length=559

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 174/239 (73%), Gaps = 9/239 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG NVNDNR+ +CF+ +AA+LD DWALWTLAGSYY+RE T+G +E YGVL 
Sbjct  310  FVSEFGIDQRGNNVNDNRFLSCFMAVAADLDLDWALWTLAGSYYVREKTIGYDETYGVLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W   RN + LQ IS +QSPFRGPG  E+   K+IFHP TGLC+ R SLFQ L+LG C 
Sbjct  370  WSWSSIRNSTILQMISSIQSPFRGPGLMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCD  428

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKL  301
             S+ +  ++ + L++ E    CL+A + GK  KL L+ ++   S+W+++S+S+M LSS  
Sbjct  429  RSESFRLSSQRVLSLAEEKILCLKAYERGKSVKLRLYFSESYCSRWKLLSESKMQLSSIT  488

Query  300  KDGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  127
            K+G +VCLDVDS+ N I+T +CKCL  D+SCDP SQWFK++     T+T+S F++  FL
Sbjct  489  KNGESVCLDVDSDSNNIVTKSCKCLEGDASCDPKSQWFKVV-----TSTRSRFRANPFL  542



>ref|XP_010556350.1| PREDICTED: uncharacterized protein LOC104825676 [Tarenaya hassleriana]
Length=560

 Score =   258 bits (659),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 162/226 (72%), Gaps = 5/226 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFGID RG N NDNRYF CFLG AAE D DWALWTL GSYY+R+G VG+ E+YG L 
Sbjct  313  FFSEFGIDERGGNANDNRYFGCFLGWAAENDVDWALWTLTGSYYIRQGVVGMIEYYGALD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W + RN SFLQR+S++QS  +GPG   +  + LIFHP+TGLCV +  L  P  L LGP
Sbjct  373  SDWNDVRNSSFLQRLSLLQSQLQGPG-PRTDFYDLIFHPLTGLCVVQSEL-DPTLLTLGP  430

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            C ES+PW YT+   L ++G  FC+Q+    KP +LGL C   +SKW+ IS S+MHL+S  
Sbjct  431  CKESEPWSYTSKNNLKIQGMPFCIQSTGTQKPVRLGLSCWSPNSKWQTISASKMHLASTT  490

Query  300  KDG-SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG  166
             +  S++CLDVD+N+ ++ N CKCL+ DSSC+P SQWFKI+ +T G
Sbjct  491  SNKTSSLCLDVDTNSNVVANPCKCLSKDSSCEPMSQWFKIVRATTG  536



>ref|XP_009152076.1| PREDICTED: uncharacterized protein LOC103875318 [Brassica rapa]
Length=559

 Score =   258 bits (658),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 173/239 (72%), Gaps = 9/239 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             VSEFGID RG NVNDNR+ +CF+ LAA+LD DWALWTLAGSYY+RE T+G +E YGVL 
Sbjct  310  LVSEFGIDQRGNNVNDNRFLSCFMALAADLDLDWALWTLAGSYYVREKTIGYDETYGVLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W   RN + LQ IS +QSPFRGPG  E+   K+IFHP TGLC+ R SLFQ L+LG C 
Sbjct  370  WSWSSIRNSTILQMISSIQSPFRGPGLMETHPKKIIFHPSTGLCIVRKSLFQ-LKLGSCD  428

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDDS-SKWEIISDSRMHLSSKL  301
             S+ +  ++ + L++ E    CL+A + GK  KL L+ ++   S+W+++S+S+M LSS  
Sbjct  429  RSESFRLSSQRVLSLAEEKILCLKAYEKGKSVKLRLYFSESYCSRWKLLSESKMQLSSIT  488

Query  300  KDGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  127
            K+G +VCLDVDS+ N I+T +CKCL  D+SCDP SQWFK++     T+T+S F++  FL
Sbjct  489  KNGESVCLDVDSDSNNIVTKSCKCLEGDASCDPKSQWFKVV-----TSTRSRFRANPFL  542



>gb|EAY94563.1| hypothetical protein OsI_16341 [Oryza sativa Indica Group]
Length=552

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 165/228 (72%), Gaps = 3/228 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT+  DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  309  FFSEFGFDMSGTHTGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S+  + +IFHP++GLCV  V   + LELGPC
Sbjct  369  WDWCTARNPSFIKRINSLQSPFQGPGLPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPC  427

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L ++ T  CLQA+ +G+ A+LG  C+  SSKW++IS+S MH+S++L 
Sbjct  428  DESNAWNYTSTHELVLQHTGQCLQAKSVGENAQLGTDCSKSSSKWQLISNSGMHVSTELT  487

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  157
            K+G+ VCLD   + +I TN CKCL  D  C+P SQWFKII S+R T T
Sbjct  488  KNGTGVCLDATPDGIITTNPCKCLTGDPICNPESQWFKIILSSRHTGT  535



>gb|EMT27118.1| hypothetical protein F775_19072 [Aegilops tauschii]
Length=571

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 162/225 (72%), Gaps = 3/225 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SE G D+ GT++ DNRY  CFL +AAE+D DWA+W L GSYY+REG +  +E YG+LT
Sbjct  324  FFSEIGFDMSGTHIADNRYLTCFLSVAAEMDLDWAVWALEGSYYIREGILAYDETYGLLT  383

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+W   RN SF++RI+ +QSPF+GPG   S + +K+IFHP+TGLCV  V     L+LGPC
Sbjct  384  WDWYTARNPSFIERINSLQSPFQGPGLPSSHQPYKVIFHPLTGLCV-LVESANVLKLGPC  442

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ESD W YT+   L ++ T  CL+A+ +G  AKLG  C+   SKW++ISDSRMH+S++L 
Sbjct  443  DESDAWNYTSAYELVLKHTGQCLEAKSVGDTAKLGTGCSKSCSKWQLISDSRMHVSAELT  502

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG  166
            K+G+ VCL+   + VI T+ CKCL  D +CDP SQWFK+I S+RG
Sbjct  503  KNGTRVCLEAGPDGVITTDQCKCLTEDPTCDPESQWFKVISSSRG  547



>emb|CAD41089.2| OSJNBb0011N17.6 [Oryza sativa Japonica Group]
 gb|EAZ31113.1| hypothetical protein OsJ_15211 [Oryza sativa Japonica Group]
Length=550

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 165/228 (72%), Gaps = 3/228 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT+  DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  307  FFSEFGFDMSGTHTGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S+  + +IFHP++GLCV  V   + LELGPC
Sbjct  367  WDWCTARNPSFIKRINSLQSPFQGPGLPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPC  425

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L ++ T  CLQ + +G+ A+LG  C+  SSKW++IS+S MH+S++L 
Sbjct  426  DESNAWNYTSTHELVLQHTGQCLQVKSVGENAQLGTDCSKSSSKWQLISNSGMHVSTELT  485

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  157
            K+G+ VCLD   + +I TN CKCL  D +C+P SQWFKII S+R T T
Sbjct  486  KNGTRVCLDATPDGIITTNPCKCLTGDPNCNPESQWFKIILSSRHTGT  533



>ref|XP_002446674.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
 gb|EES11002.1| hypothetical protein SORBIDRAFT_06g020260 [Sorghum bicolor]
Length=556

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT++ DNRY  CFL +AAE+D DW++W L GSYY+REG +  +E YG+L+
Sbjct  310  FFSEFGFDMSGTHIGDNRYLTCFLSVAAEMDLDWSIWALQGSYYIREGILAYDESYGLLS  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S+  + +IFHP +GLCV   S  + LELGPC
Sbjct  370  WDWCTARNPSFIKRINSLQSPFQGPGLPNSQEPYNIIFHPQSGLCVLARS-SKLLELGPC  428

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L V+ T  CLQ + +GK AKLG  C+  SSKW +IS+S+MH+S++L 
Sbjct  429  DESNAWNYTSAYNLVVKNTGQCLQVKSVGKNAKLGTDCSKPSSKWNLISNSKMHVSAELT  488

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            K+G+ VCLD      IITN CKCL+ D +CDP SQWFK+I S+R
Sbjct  489  KNGTRVCLDASPAGAIITNQCKCLSVDPTCDPESQWFKVIVSSR  532



>emb|CAH67676.1| H0510A06.1 [Oryza sativa Indica Group]
 emb|CAH66881.1| OSIGBa0158F13.12 [Oryza sativa Indica Group]
Length=553

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 165/228 (72%), Gaps = 3/228 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT+  DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  310  FFSEFGFDMSGTHTGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S+  + +IFHP++GLCV  V   + LELGPC
Sbjct  370  WDWCTARNPSFIKRINSLQSPFQGPGLPNSQEPYNVIFHPLSGLCV-VVKSSEALELGPC  428

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L ++ T  CLQ + +G+ A+LG  C+  SSKW++IS+S MH+S++L 
Sbjct  429  DESNAWNYTSTHELVLQHTGQCLQVKSVGENAQLGTDCSKSSSKWQLISNSGMHVSTELT  488

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTT  157
            K+G+ VCLD   + +I TN CKCL  D +C+P SQWFKII S+R T T
Sbjct  489  KNGTRVCLDATPDGIITTNPCKCLTGDPNCNPESQWFKIILSSRHTGT  536



>ref|XP_010026595.1| PREDICTED: uncharacterized protein LOC104416964 [Eucalyptus grandis]
Length=535

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 166/227 (73%), Gaps = 5/227 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG +L G NVND+RYFNCF G+AA+LDFDWALWT+ GSYYLR+G VG+EE +GVL 
Sbjct  311  FVSEFGGELSGQNVNDDRYFNCFFGVAAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             ++  PRN SFLQRIS +Q+PF+G   + S   +++FHP+TGLC++R    + L+LG C+
Sbjct  371  KDFSGPRNASFLQRISALQAPFQG-ATSSSPTRRILFHPLTGLCIQRKREQEQLQLGACN  429

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W +T    + + GT  C+QA++L KP KL   C D  S+W+ IS+S+MH SS +  
Sbjct  430  ESEAWTHTRHHTIRMRGTDLCMQADRLEKPVKLSTDCADHGSRWKTISESKMHFSSNIV-  488

Query  294  GSN--VCLDVD-SNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  163
            GSN  VCLD+D S   +I + CKCL  D++C+PASQWF++++ TR T
Sbjct  489  GSNVTVCLDIDFSTKTVIASPCKCLREDATCNPASQWFELVNMTRST  535



>ref|XP_010502521.1| PREDICTED: uncharacterized protein LOC104779823 [Camelina sativa]
Length=558

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/237 (53%), Positives = 167/237 (70%), Gaps = 4/237 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RG NVNDN++ +CF+ LAA+LD DWALWTLAGSYY+R  T+G +E YGVL 
Sbjct  310  FVSEFGVDQRGNNVNDNKFLSCFMALAADLDLDWALWTLAGSYYIRGKTIGSDETYGVLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW   RN + LQ +S +Q+PF GPG  E++  K++FHP++GLC+ R  LF+ L+LG C 
Sbjct  370  WNWLNVRNSTILQMVSAIQTPFTGPGLMETQPKKIMFHPLSGLCIVRKPLFR-LKLGSCK  428

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKL  301
             S+ W  ++ + L++ E    CL+A + G P KL LF T+   SKW ++SDS+M LSS  
Sbjct  429  RSESWRLSSHRVLSLAEERILCLKAYEKGNPVKLRLFFTEFQCSKWRLLSDSKMQLSSIT  488

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  133
            K+G+ VCLDVDS +N I+T  CKCL  +SSCDP SQWFK++ STR  +    F   S
Sbjct  489  KNGAFVCLDVDSRSNKIVTRRCKCLQGNSSCDPRSQWFKLVTSTRRRSISKPFLQIS  545



>ref|XP_002284895.1| PREDICTED: uncharacterized protein LOC100253729 [Vitis vinifera]
Length=512

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 153/224 (68%), Gaps = 26/224 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR+ NCF GLAAELDFDWALWTL             EE  G++ 
Sbjct  307  FVSELGVD-------DNRHLNCFFGLAAELDFDWALWTL-------------EETNGLMN  346

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       SF QRIS +QSP +GP  +  R HK+IFHP TGLC+ R S  +PL+LGPC+
Sbjct  347  WN------SSFFQRISALQSPLQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCT  400

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +S+ WGYT  K LTV+GTYFCLQA  LGKPAKL + CT   S WE ISDS+M+LS+KL D
Sbjct  401  KSEAWGYTPQKLLTVKGTYFCLQAVGLGKPAKLSIICTKPGSNWENISDSKMYLSTKLGD  460

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  163
            G+ VCLDVDS++ I+T+ CKCL     CDP SQWFK++DST  T
Sbjct  461  GTRVCLDVDSSSTIVTDACKCLGRGDMCDPGSQWFKVVDSTNIT  504



>gb|AAS00040.1| unknown [Vitis riparia]
Length=221

 Score =   245 bits (625),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 26/221 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR  NCF GLAAELDFDWALWT+             EE  G++ 
Sbjct  16   FVSELGVD-------DNRNLNCFFGLAAELDFDWALWTV-------------EETNGLMN  55

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       S  QRIS +QSP +GP  +  R HK+I HP TGLC+   S  +PL+LGPC+
Sbjct  56   WN------SSVFQRISALQSPLQGPDVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCT  109

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +SD WGYT  K L V+G+YFCLQA +LGKPAKL + CT   S W+IISDS+M+LS+KL D
Sbjct  110  KSDAWGYTPQKLLIVKGSYFCLQAVELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLAD  169

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
             + VCLDVDS++ I+T+ CKCL  D +CDP SQWFK++DST
Sbjct  170  STTVCLDVDSSSTIVTDACKCLGRDDTCDPGSQWFKVVDST  210



>ref|NP_001132121.1| hypothetical protein precursor [Zea mays]
 gb|ACF80825.1| unknown [Zea mays]
 gb|AFW58604.1| hypothetical protein ZEAMMB73_652830 [Zea mays]
Length=555

 Score =   255 bits (651),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT++ DNRY  CFL +AAE+D DWA+W L GSYY+REG +  +E YG+LT
Sbjct  309  FFSEFGFDMSGTHIGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLT  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QS F+GPG   ++  + +IFHP +GLCV   S  + LELGPC
Sbjct  369  WDWCTARNPSFIKRINSLQSAFQGPGLPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPC  427

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L V+ T  CLQA+ +GK AKLG  C+  SSKW +ISDS+MH+S++L 
Sbjct  428  DESNAWNYTSAYELVVKSTGQCLQAQSVGKNAKLGTDCSKPSSKWHLISDSKMHVSAELA  487

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            K+G+ VCL+   +  I TN CKCL+ D +CDP SQWFK+I S+R
Sbjct  488  KNGTRVCLEASPDGAIRTNQCKCLSVDPTCDPESQWFKVILSSR  531



>dbj|BAK00694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=561

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 162/225 (72%), Gaps = 3/225 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SE G D+ GT++ DNRY  CFL +AAE+D DWA+W L GSYY+REG +  +E YG+LT
Sbjct  314  FFSEIGFDMSGTHIADNRYLTCFLSVAAEMDLDWAVWALEGSYYIREGILAYDETYGLLT  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+W   RN SF++RI+ +QSPF+GPG + S + +K+IFHP+TGLCV  V     L+LGPC
Sbjct  374  WDWYTARNPSFIERINSLQSPFQGPGLSSSHKSYKVIFHPLTGLCV-LVESANVLKLGPC  432

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L ++ T  CL+A+ +G  AKLG  C+   SKW++ISDS MH+S++L 
Sbjct  433  DESNAWNYTSTYELVLKQTGQCLEAKSVGDTAKLGTGCSKSCSKWQLISDSGMHVSAELT  492

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG  166
            K+G+ VCLD   + VI T+ CKCL  D +CDP SQWFK+I S+RG
Sbjct  493  KNGTRVCLDAGPDGVITTDQCKCLTEDPTCDPESQWFKVISSSRG  537



>ref|XP_002876947.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53206.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 170/237 (72%), Gaps = 6/237 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG N NDN++ +CF+ LAA+LD DW+LWTLAGSYY+RE T+G +E YGVL 
Sbjct  305  FVSEFGIDQRGNNANDNKFLSCFMALAADLDLDWSLWTLAGSYYIREKTIGTDETYGVLD  364

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WNW   RN + LQ IS +QSPF+  G  E++  K++FHP TGLC+ R SLFQ L+LG C+
Sbjct  365  WNWSSIRNSTILQMISAIQSPFQ--GLMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCN  421

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKL  301
             S+ W  ++ + L++ E    CL+A + GK  KL LF +D   SKW+++SDS+M LSS  
Sbjct  422  RSESWKLSSHRVLSLTEEKILCLKAYEDGKSVKLRLFFSDSYCSKWKLLSDSKMQLSSIT  481

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  133
            K+G ++CLDVDS NN I+TN+CKCL  +SSCDP SQWFK++ STR  +    F   S
Sbjct  482  KNGVSICLDVDSNNNNIVTNSCKCLLGNSSCDPRSQWFKLVTSTRRRSKPKPFLQIS  538



>gb|KCW59700.1| hypothetical protein EUGRSUZ_H02458, partial [Eucalyptus grandis]
Length=516

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 153/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG D RGTNVNDNRY NCF+ +AAE D+D+ALWTL GSYYLR+G VG EEFYG+  
Sbjct  306  FVSEFGADERGTNVNDNRYMNCFMAMAAEFDWDFALWTLQGSYYLRQGVVGKEEFYGLFN  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            ++W   RN S+L+RIS++Q PF+GPG  ++  HK+IFHP+TGLC+ R      L LGPC 
Sbjct  366  YDWSGIRNSSYLRRISVLQLPFQGPGGRQTVAHKVIFHPLTGLCILRRRRPTRLVLGPCI  425

Query  474  ESDPWGYTAGKAL-TVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S+PW +T   AL  + G    L+A  LG+PA LG   T+  +KWE+IS S MHLSS  +
Sbjct  426  YSEPWSHTPQNALGLMAGKPLYLRAVGLGRPATLGTSPTEPGTKWEMISASEMHLSSMAE  485

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDP  205
            DGS VCLDV +NN ++   CKCL+++SSCDP
Sbjct  486  DGSTVCLDVIANNTVMVEACKCLSSESSCDP  516



>dbj|BAB02432.1| unnamed protein product [Arabidopsis thaliana]
Length=561

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 175/249 (70%), Gaps = 8/249 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG N NDN++ +CF+ LAA+ D DW+LWTLAGSYY+RE ++G +E YGVL 
Sbjct  313  FVSEFGIDQRGNNANDNKFLSCFMALAADRDLDWSLWTLAGSYYIREKSIGSDESYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW   RN + LQ IS +Q+PF GPG  E++  K++FHP TGLC+ R SLFQ L+LG C+
Sbjct  373  FNWSSIRNSTILQMISAIQTPFIGPGLMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCN  431

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKL  301
             S+ W  ++ + L++ E    CL+A + GK  KL LF ++   SKW++ SDS+M LSS  
Sbjct  432  RSESWRLSSHRVLSLAEEQILCLKAYEKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSIT  491

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY  124
            K+G +VCLDVD+ NN I+TN+CKCL  +SSCDP SQWFK++ STR  +    F   S LY
Sbjct  492  KNGFSVCLDVDTENNNIVTNSCKCLRGNSSCDPRSQWFKLVTSTRRRSRPKPFLQIS-LY  550

Query  123  ---FLAKKL  106
               FL K L
Sbjct  551  SKTFLQKSL  559



>ref|XP_006290844.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
 gb|EOA23742.1| hypothetical protein CARUB_v10016955mg [Capsella rubella]
Length=554

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 168/236 (71%), Gaps = 3/236 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG+N NDN++ +CF+ LAA+LD DWALWTLAGSYY+R+ T+G +E YGVL 
Sbjct  307  FVSEFGIDQRGSNANDNKFLSCFMALAADLDVDWALWTLAGSYYIRDKTIGSDETYGVLD  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W   RN + LQ IS +Q+PF GPG  E++  K++FHP +GLC+ R SLFQ L+LG C+
Sbjct  367  WDWSSIRNSTILQMISAIQTPFTGPGLMETQPKKIMFHPSSGLCIVRKSLFQ-LKLGSCN  425

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKL  301
             S+ W  ++ + L++ E    CL+A + GK  KL LF +D   SKW+++SDS+M L S  
Sbjct  426  RSESWKLSSHQVLSLTEERILCLKAYEKGKAVKLRLFFSDFHCSKWKLLSDSKMQLLSVT  485

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  133
            K+G+ VCLDVDS + I+  +CKCL  +SSCDP SQWFK++ S+R  +    F   S
Sbjct  486  KNGTIVCLDVDSYSKIVMRSCKCLQGNSSCDPRSQWFKLVTSSRRRSKSKPFIQIS  541



>gb|AIZ06017.1| hypothetical protein [Zea nicaraguensis]
Length=555

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT++ DNRY  CFL +AAE+D DWA+W L GSYY+REG +  +E YG+L+
Sbjct  309  FFSEFGFDMSGTHIGDNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLS  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN  F++RI+ +QS F+GPG   ++  + +IFHP +GLCV   S  + LELGPC
Sbjct  369  WDWCTARNPGFIKRINSLQSVFQGPGLPNTQQPYYIIFHPQSGLCVLARS-SKLLELGPC  427

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L V+ T  CLQA+ +GK AKLG  C++ SSKW +ISDS+MHLS++L 
Sbjct  428  GESNAWNYTSAYELVVKSTGQCLQAQSVGKNAKLGTDCSEPSSKWHLISDSKMHLSAELA  487

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            K+G+ VCL+   +  I TN CKCL+ D +CDP SQWFK+I S+R
Sbjct  488  KNGTRVCLEASPDGAIRTNQCKCLSVDPTCDPESQWFKVILSSR  531



>ref|XP_010248706.1| PREDICTED: uncharacterized protein LOC104591538 isoform X2 [Nelumbo 
nucifera]
Length=538

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 155/219 (71%), Gaps = 13/219 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+S+F  DLRG NVND R+ NC LG+AAE D DWAL T            G++E YG+L 
Sbjct  307  FLSDFRPDLRGGNVNDIRFLNCLLGVAAEKDLDWALGT------------GIDEAYGLLN  354

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPG-YTESRLHKLIFHPMTGLCVRRVSLFQPLELGPC  478
              W    N S ++R+S++QSPF GP      R H++IFHP TGLCV R S+ +PL+LG C
Sbjct  355  SEWFGTGNASPMKRVSLLQSPFLGPDDLLNVRPHEMIFHPSTGLCVLRKSVIEPLKLGSC  414

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             ES+ W YT  K L V+GTYFCLQA+ +GKPAKLG+ C D  SKW++ISD++MHLSSKL 
Sbjct  415  VESESWAYTPQKTLVVKGTYFCLQADGVGKPAKLGIICNDPGSKWDLISDTKMHLSSKLA  474

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKII  181
            DGS+VCLDVDS+N IITN CKC +   +CDP SQWFKI+
Sbjct  475  DGSSVCLDVDSSNSIITNPCKCSSGAPNCDPTSQWFKIV  513



>emb|CAN60394.1| hypothetical protein VITISV_015741 [Vitis vinifera]
Length=221

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 148/221 (67%), Gaps = 26/221 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR  NCF GLAAELDFDWALWT              EE  G++ 
Sbjct  16   FVSELGVD-------DNRNLNCFFGLAAELDFDWALWTX-------------EETNGLMN  55

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN          QRIS +QSP +GP  +  R HK+I HP TGLC+   S  +PL+LGPC+
Sbjct  56   WN------SXXFQRISALQSPLQGPXVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCT  109

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +SD WGYT  K L V+G+YFCLQA +LGKPAKL + CT   S W+IISDS+M+LS+KL D
Sbjct  110  KSDAWGYTPQKLLIVKGSYFCLQAVELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGD  169

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
             + VCLDVDS++ I+T+ CKCL  D +CDP SQWFK++DST
Sbjct  170  STTVCLDVDSSSTIVTDACKCLGRDDTCDPGSQWFKVVDST  210



>emb|CBI20318.3| unnamed protein product [Vitis vinifera]
Length=364

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 26/221 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR  NCF GLAAELDFDWALWT+             EE  G++ 
Sbjct  159  FVSELGVD-------DNRNLNCFFGLAAELDFDWALWTV-------------EETNGLMN  198

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       S  QRIS +QSP +GP  +  R HK+I HP TGLC+   S  +PL+LGPC+
Sbjct  199  WN------SSVFQRISALQSPLQGPDVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCT  252

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +SD WGYT  K L V+G+YFCLQA +LGKPAKL + CT   S W+IISDS+M+LS+KL D
Sbjct  253  KSDAWGYTPQKLLIVKGSYFCLQAVELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGD  312

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
             + VCLDVDS++ I+T+ CKCL  D +CDP SQWFK++DST
Sbjct  313  STTVCLDVDSSSTIVTDACKCLGRDDTCDPGSQWFKVVDST  353



>emb|CAD41090.2| OSJNBb0011N17.7 [Oryza sativa Japonica Group]
Length=555

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 159/241 (66%), Gaps = 15/241 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RG NVNDNRY+ C   +AA+LD DWALWTL GSYYLREG +GL+E YGVL 
Sbjct  295  FLSEFGVDNRGGNVNDNRYYGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLD  354

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVS---LFQPLELG  484
            W WC+PRN + L R+  +Q PFRGPG  E+  + ++FHP TG CV R S   +   LELG
Sbjct  355  WAWCKPRNDTALTRLHALQRPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELG  414

Query  483  PCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS  310
             C E++ W YTA +      +    CL+AE  G+PA+LGL C D+ ++W + SDS++HL+
Sbjct  415  SCGEAEAWAYTASQQRLSPRDSPLLCLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLA  474

Query  309  ---------SKLKDGSNVCLDV-DSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
                      +  +G  +CLDV D    ++TN C+CL+ D+SCDP SQWFK++ STR   
Sbjct  475  VNASSSSSSPETSNGGMLCLDVGDDGRSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVA  534

Query  159  T  157
             
Sbjct  535  A  535



>gb|KCW59699.1| hypothetical protein EUGRSUZ_H02457, partial [Eucalyptus grandis]
Length=528

 Score =   249 bits (636),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/220 (54%), Positives = 161/220 (73%), Gaps = 5/220 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG +L G NVND+RYFNCF G+AA+LDFDWALWT+ GSYYLR+G VG+EE +GVL 
Sbjct  311  FVSEFGGELSGQNVNDDRYFNCFFGVAAKLDFDWALWTIVGSYYLRKGIVGMEETFGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             ++  PRN SFLQRIS +Q+PF+G   + S   +++FHP+TGLC++R    + L+LG C+
Sbjct  371  KDFSGPRNASFLQRISALQAPFQG-ATSSSPTRRILFHPLTGLCIQRKREQEQLQLGACN  429

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W +T    + + GT  C+QA++L KP KL   C D  S+W+ IS+S+MH SS +  
Sbjct  430  ESEAWTHTRHHTIRMRGTDLCMQADRLEKPVKLSTDCADHGSRWKTISESKMHFSSNIV-  488

Query  294  GSN--VCLDVD-SNNVIITNTCKCLNNDSSCDPASQWFKI  184
            GSN  VCLD+D S   +I + CKCL  D++C+PASQWF++
Sbjct  489  GSNVTVCLDIDFSTKTVIASPCKCLREDATCNPASQWFEL  528



>gb|EEE61202.1| hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
Length=571

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 159/241 (66%), Gaps = 15/241 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RG NVNDNRY+ C   +AA+LD DWALWTL GSYYLREG +GL+E YGVL 
Sbjct  311  FLSEFGVDNRGGNVNDNRYYGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVS---LFQPLELG  484
            W WC+PRN + L R+  +Q PFRGPG  E+  + ++FHP TG CV R S   +   LELG
Sbjct  371  WAWCKPRNDTALTRLHALQRPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELG  430

Query  483  PCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS  310
             C E++ W YTA +      +    CL+AE  G+PA+LGL C D+ ++W + SDS++HL+
Sbjct  431  SCGEAEAWAYTASQQRLSPRDSPLLCLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLA  490

Query  309  ---------SKLKDGSNVCLDV-DSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
                      +  +G  +CLDV D    ++TN C+CL+ D+SCDP SQWFK++ STR   
Sbjct  491  VNASSSSSSPETSNGGMLCLDVGDDGRSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVA  550

Query  159  T  157
             
Sbjct  551  A  551



>gb|EEC77495.1| hypothetical protein OsI_16343 [Oryza sativa Indica Group]
Length=571

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 159/241 (66%), Gaps = 15/241 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RG NVNDNRY+ C   +AA+LD DWALWTL GSYYLREG +GL+E YGVL 
Sbjct  311  FLSEFGVDNRGGNVNDNRYYGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVS---LFQPLELG  484
            W WC+PRN + L R+  +Q PFRGPG  E+  + ++FHP TG CV R S   +   LELG
Sbjct  371  WAWCKPRNDTALTRLHALQRPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELG  430

Query  483  PCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS  310
             C E++ W YTA +      +    CL+AE  G+PA+LGL C D+ ++W + SDS++HL+
Sbjct  431  SCGEAEAWAYTASQQRLSPRDSPLLCLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLA  490

Query  309  ---------SKLKDGSNVCLDV-DSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
                      +  +G  +CLDV D    ++TN C+CL+ D+SCDP SQWFK++ STR   
Sbjct  491  VNASSSSSSPETSNGGMLCLDVGDDGRSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVA  550

Query  159  T  157
             
Sbjct  551  A  551



>ref|XP_010248705.1| PREDICTED: uncharacterized protein LOC104591538 isoform X1 [Nelumbo 
nucifera]
Length=540

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 155/221 (70%), Gaps = 15/221 (7%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+S+F  DLRG NVND R+ NC LG+AAE D DWAL T            G++E YG+L 
Sbjct  307  FLSDFRPDLRGGNVNDIRFLNCLLGVAAEKDLDWALGT------------GIDEAYGLLN  354

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTE---SRLHKLIFHPMTGLCVRRVSLFQPLELG  484
              W    N S ++R+S++QSPF   G  +    R H++IFHP TGLCV R S+ +PL+LG
Sbjct  355  SEWFGTGNASPMKRVSLLQSPFLDAGPDDLLNVRPHEMIFHPSTGLCVLRKSVIEPLKLG  414

Query  483  PCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
             C ES+ W YT  K L V+GTYFCLQA+ +GKPAKLG+ C D  SKW++ISD++MHLSSK
Sbjct  415  SCVESESWAYTPQKTLVVKGTYFCLQADGVGKPAKLGIICNDPGSKWDLISDTKMHLSSK  474

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKII  181
            L DGS+VCLDVDS+N IITN CKC +   +CDP SQWFKI+
Sbjct  475  LADGSSVCLDVDSSNSIITNPCKCSSGAPNCDPTSQWFKIV  515



>ref|XP_002889989.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66248.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=552

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 155/225 (69%), Gaps = 6/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N NDNRYF C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  316  FLSEFGIDERGVNTNDNRYFGCVTGWAAENDVDWSLWALTGSYYLRQGVVGMIEYYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   RN SFLQ+IS +QSP +GPG      + L+FHP+TGLC+ R SL  P  L LGP
Sbjct  376  SDWISVRNSSFLQKISFLQSPLQGPG-PRIDAYNLVFHPLTGLCIVR-SLDDPKMLTLGP  433

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSK  304
            C+ S+PW YT  KAL ++  + CLQ+     P  +    C+   SKW+ IS SRMHLSS 
Sbjct  434  CNSSEPWSYTK-KALRIKDQHLCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLSST  492

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
              + +++CLDVD+ N I+ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  493  TSNKTSLCLDVDTANNIVANACKCLSKDSSCEPMSQWFKIIKATR  537



>emb|CAH67677.1| H0510A06.2 [Oryza sativa Indica Group]
 emb|CAH66882.1| OSIGBa0158F13.13 [Oryza sativa Indica Group]
Length=555

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 160/241 (66%), Gaps = 15/241 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+S+FG+D RG NVNDNRY+ C   +AA+LD DWALWTL GSYYLREG +GL+E YGVL 
Sbjct  295  FLSDFGVDNRGGNVNDNRYYGCVAAVAADLDLDWALWTLQGSYYLREGVLGLDEVYGVLD  354

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVS---LFQPLELG  484
            W WC+PRN + L R+  +Q PFRGPG  E+  + ++FHP TG CV R S   +   LELG
Sbjct  355  WAWCKPRNDTALTRLHALQRPFRGPGLAEAAPYTVMFHPTTGRCVVRRSSSVVQTTLELG  414

Query  483  PCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS  310
             C E++ W YTA +      +    CL+AE  G+PA+LGL C D+ ++W + SDS++HL+
Sbjct  415  SCGEAEAWAYTASQQRLSPRDSPLLCLRAEGAGRPARLGLSCGDELARWSLTSDSKLHLA  474

Query  309  ---------SKLKDGSNVCLDV-DSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
                      +  +G  +CLDV D    ++TN C+CL+ D+SCDP SQWFK++ STR   
Sbjct  475  VNASSSSSSPETSNGGMLCLDVGDDGRSLVTNPCRCLSADNSCDPESQWFKLVTSTRSVA  534

Query  159  T  157
            +
Sbjct  535  S  535



>ref|XP_006652422.1| PREDICTED: uncharacterized protein LOC102702088, partial [Oryza 
brachyantha]
Length=529

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 162/225 (72%), Gaps = 3/225 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ G +V DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  284  FFSEFGFDMSGAHVADNRYLTCFLSVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  343

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESR-LHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+W   RN SF++RI+ +QSPF+GPG   S+  + +IFHP+TGLC+  V   + LELGPC
Sbjct  344  WDWSATRNPSFIKRINSLQSPFQGPGLPNSKEPYNVIFHPLTGLCL-VVKSSEALELGPC  402

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L ++ T  CLQA+ +G+ AKLG  C+  S+KW++IS S MH+S++L 
Sbjct  403  DESNAWSYTSTNQLVLKHTGQCLQAKSVGENAKLGTDCSKSSAKWQLISYSGMHVSAELT  462

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG  166
            K+G+ VCLD   +  I TN C+CL  D +C+P SQWFKII S++G
Sbjct  463  KNGTRVCLDATPDGTIETNLCECLTLDPNCNPESQWFKIILSSKG  507



>ref|XP_002284881.1| PREDICTED: uncharacterized protein LOC100264047 [Vitis vinifera]
Length=509

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 150/221 (68%), Gaps = 26/221 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE G+D       DNR  NCF GLAAELDFDWALWT+             EE  G++ 
Sbjct  304  FVSELGVD-------DNRNLNCFFGLAAELDFDWALWTV-------------EETNGLMN  343

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            WN       S  QRIS +QSP +GP  +  R HK+I HP TGLC+   S  +PL+LGPC+
Sbjct  344  WN------SSVFQRISALQSPLQGPDVSRVRPHKIILHPPTGLCILWESWTEPLKLGPCT  397

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            +SD WGYT  K L V+G+YFCLQA +LGKPAKL + CT   S W+IISDS+M+LS+KL D
Sbjct  398  KSDAWGYTPQKLLIVKGSYFCLQAVELGKPAKLSIICTKPGSNWDIISDSKMYLSTKLGD  457

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
             + VCLDVDS++ I+T+ CKCL  D +CDP SQWFK++DST
Sbjct  458  STTVCLDVDSSSTIVTDACKCLGRDDTCDPGSQWFKVVDST  498



>gb|AAD31066.1|AC007357_15 F3F19.15 [Arabidopsis thaliana]
Length=522

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 154/225 (68%), Gaps = 6/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N NDNRYF C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  286  FLSEFGIDERGVNTNDNRYFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLD  345

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   RN SFLQ+IS +QSP +GPG   +  + L+FHP+TGLC+ R SL  P  L LGP
Sbjct  346  SDWISVRNSSFLQKISFLQSPLQGPG-PRTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGP  403

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSK  304
            C+ S+PW YT  KAL ++    CLQ+     P  +    C+   SKW+ IS SRMHL+S 
Sbjct  404  CNSSEPWSYTK-KALRIKDQQLCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLAST  462

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
              + +++CLDVD+ N ++ N CKCL+ D SC+P SQWFKII +TR
Sbjct  463  TSNKTSLCLDVDTANNVVANACKCLSKDKSCEPMSQWFKIIKATR  507



>ref|NP_172772.2| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AAU05478.1| At1g13130 [Arabidopsis thaliana]
 gb|AEE28973.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=552

 Score =   247 bits (630),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 154/225 (68%), Gaps = 6/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N NDNRYF C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  316  FLSEFGIDERGVNTNDNRYFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   RN SFLQ+IS +QSP +GPG   +  + L+FHP+TGLC+ R SL  P  L LGP
Sbjct  376  SDWISVRNSSFLQKISFLQSPLQGPG-PRTDAYNLVFHPLTGLCIVR-SLDDPKMLTLGP  433

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDSSKWEIISDSRMHLSSK  304
            C+ S+PW YT  KAL ++    CLQ+     P  +    C+   SKW+ IS SRMHL+S 
Sbjct  434  CNSSEPWSYTK-KALRIKDQQLCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLAST  492

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
              + +++CLDVD+ N ++ N CKCL+ D SC+P SQWFKII +TR
Sbjct  493  TSNKTSLCLDVDTANNVVANACKCLSKDKSCEPMSQWFKIIKATR  537



>ref|XP_006395581.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
 gb|ESQ32867.1| hypothetical protein EUTSA_v10003934mg [Eutrema salsugineum]
Length=557

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 168/237 (71%), Gaps = 6/237 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG NVNDNR+ +CF+ LAA+LD DWALWTLAGSYY+RE T+G +E +GVL 
Sbjct  311  FVSEFGIDQRGNNVNDNRFLSCFMALAADLDLDWALWTLAGSYYVREKTIGSDESFGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW   RN   LQ IS +QSPFR  G  E++  K+IFHP +GLC+ R SLFQ L+LG C+
Sbjct  371  LNWSSIRNSIILQMISAIQSPFR--GLMETQPKKIIFHPSSGLCIVRKSLFQ-LKLGSCN  427

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKL  301
             S+ +  ++ + L++ E   FCL+A ++G P KL LF ++   SKW+ +S+S+M LSS  
Sbjct  428  RSESFKLSSHRVLSLTEEQIFCLKAYEIGDPVKLRLFFSESYCSKWKFLSESKMQLSSFT  487

Query  300  KDGSNVCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTS  133
            K+G +VCLDVDS+ N I+T +CKCL  ++SC+P SQWFK++ STR       F   S
Sbjct  488  KNGESVCLDVDSDSNNIVTKSCKCLEGNASCNPKSQWFKLVTSTRSRCKTKPFLRIS  544



>ref|XP_003579979.1| PREDICTED: uncharacterized protein LOC100845861 [Brachypodium 
distachyon]
Length=558

 Score =   244 bits (624),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/225 (52%), Positives = 159/225 (71%), Gaps = 3/225 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SE G D+ GT++ DNRY  CF+ +AAE+D DWA+W L GSYY+REG +  +E YG+L+
Sbjct  313  FFSEIGFDMSGTHIPDNRYLTCFISVAAEMDLDWAIWALQGSYYIREGILAYDESYGLLS  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+W   RN SF++RI+ +QSPF+GPG   S+  +  IFHP+TGLCV  V     LELGPC
Sbjct  373  WDWYTARNPSFIKRINYLQSPFQGPGLPNSKKPYNAIFHPLTGLCV-LVKSPNSLELGPC  431

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             ES+ W YT+   L ++ +  CL+A+ +G  AKLG   +   SKW++ISDSRMH+S++L 
Sbjct  432  DESNAWNYTSTCELVLKHSGQCLEAKSVGDIAKLGTVSSKSCSKWQLISDSRMHVSTELT  491

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG  166
            K+G+ VCLD   + VI TN CKCL  D +C+P SQWFK+I S++G
Sbjct  492  KNGTRVCLDASPDGVISTNQCKCLIEDPTCNPESQWFKVILSSKG  536



>ref|NP_189244.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 gb|AEE77124.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=551

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 173/249 (69%), Gaps = 10/249 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG N NDN++ +CF+ LAA+ D DW+LWTLAGSYY+RE ++G +E YGVL 
Sbjct  305  FVSEFGIDQRGNNANDNKFLSCFMALAADRDLDWSLWTLAGSYYIREKSIGSDESYGVLD  364

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW   RN + LQ IS +Q+PF   G  E++  K++FHP TGLC+ R SLFQ L+LG C+
Sbjct  365  FNWSSIRNSTILQMISAIQTPF--IGLMETQPKKIMFHPSTGLCIVRKSLFQ-LKLGSCN  421

Query  474  ESDPWGYTAGKALTV-EGTYFCLQAEKLGKPAKLGLFCTDD-SSKWEIISDSRMHLSSKL  301
             S+ W  ++ + L++ E    CL+A + GK  KL LF ++   SKW++ SDS+M LSS  
Sbjct  422  RSESWRLSSHRVLSLAEEQILCLKAYEKGKSVKLRLFFSESYCSKWKLFSDSKMQLSSIT  481

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFLY  124
            K+G +VCLDVD+ NN I+TN+CKCL  +SSCDP SQWFK++ STR  +    F   S LY
Sbjct  482  KNGFSVCLDVDTENNNIVTNSCKCLRGNSSCDPRSQWFKLVTSTRRRSRPKPFLQIS-LY  540

Query  123  ---FLAKKL  106
               FL K L
Sbjct  541  SKTFLQKSL  549



>ref|XP_006417151.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
 gb|ESQ35504.1| hypothetical protein EUTSA_v10007253mg [Eutrema salsugineum]
Length=561

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 161/246 (65%), Gaps = 8/246 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RG N ND+RYF C  G AAE D DW+LW L GSYYLR+G VG+ E+YG L 
Sbjct  316  FLSEFGVDERGQNANDDRYFGCLSGWAAENDVDWSLWALTGSYYLRQGVVGMIEYYGALD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+IS++QSP +GPG   +  + L+FHP+TGLC VR +     L LGPC
Sbjct  376  SDWISVRNSSFLQKISLLQSPLQGPG-PRTDAYNLVFHPLTGLCVVRSLKDTTMLTLGPC  434

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLF---CTDDSSKWEIISDSRMHLSS  307
            + S PW YT  K L ++    CLQ+   G   ++ +    C+   S W+ IS SRMHL++
Sbjct  435  NSSQPWSYTK-KTLRIKDQLLCLQSN--GPKNRVTMTRTSCSKPGSIWQTISASRMHLAA  491

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKSDFQSTSFL  127
               + +++CLDVD+ N ++ N CKCL+NDSSC+P SQWFKII +TR   +   ++  S L
Sbjct  492  TTSNKTSICLDVDATNNVVANACKCLSNDSSCEPMSQWFKIIKATRPLKSLGLYKQISSL  551

Query  126  YFLAKK  109
              L+ K
Sbjct  552  DNLSPK  557



>ref|XP_010494994.1| PREDICTED: uncharacterized protein LOC104772040 [Camelina sativa]
Length=363

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 155/225 (69%), Gaps = 5/225 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N ND+RY  C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  129  FLSEFGIDERGGNANDDRYIECLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLD  188

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPC  478
             +W   RN SFLQ+IS++QSP +GPG   +  + L+FHP+TGLC+ +  + +  L LGPC
Sbjct  189  SDWISVRNSSFLQKISLLQSPLQGPG-PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPC  247

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  KAL ++    CLQ+     P       C+  SSKW+ +S SRMHLSS  
Sbjct  248  NSSEPWSYTK-KALRIKDRPLCLQSNGPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAA  306

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + +++CLDVD+ NN ++ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  307  SNNTSLCLDVDATNNNVVANACKCLSKDSSCEPMSQWFKIIKATR  351



>ref|XP_006307168.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
 gb|EOA40066.1| hypothetical protein CARUB_v10008758mg [Capsella rubella]
Length=552

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 116/224 (52%), Positives = 153/224 (68%), Gaps = 4/224 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N ND+RYF C  G AAE D DW+LW L GSYYLR+G VGL E+YGVL 
Sbjct  316  FLSEFGIDERGGNANDDRYFGCLTGWAAEHDLDWSLWALTGSYYLRQGVVGLNEYYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ++S++QSP +GP + ++  + L+FHP+TGLC VR +     L LGPC
Sbjct  376  KDWISVRNSSFLQKLSLLQSPLQGP-HPQTDAYNLVFHPLTGLCIVRSLKDTTMLTLGPC  434

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSK-WEIISDSRMHLSSKL  301
            + S+PW YT  KA+ ++    CLQ+     P  L       SS  W+ +S SRMHLSS  
Sbjct  435  NSSEPWSYTK-KAIRIKDQPLCLQSNGPKNPVTLTRTSCSTSSSIWQTVSASRMHLSSTT  493

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + +++CLDVD+ N ++ N CKCL+ DS+C+P SQWFKII +TR
Sbjct  494  SNKTSLCLDVDATNNVVANACKCLSKDSTCEPMSQWFKIIKATR  537



>gb|KCW59701.1| hypothetical protein EUGRSUZ_H02460 [Eucalyptus grandis]
Length=262

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 148/210 (70%), Gaps = 5/210 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVS FG +L G NVNDNRYFNCF  +AA+LDFDWALWT+ GSYYLR+G VG++E +GVL 
Sbjct  55   FVSGFGGELSGQNVNDNRYFNCFFQVAAKLDFDWALWTIVGSYYLRKGIVGMDETFGVLN  114

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             ++  PRN SFLQRIS +Q+PF+G   + +   +++FHP+TGLC++R    + L+LG C+
Sbjct  115  KDFSGPRNASFLQRISALQAPFQG-ATSSNPTRRILFHPLTGLCIQRKPEQEQLQLGACN  173

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
            ES+ W +T    + + GT  C+QA++L KP KL   C D  S+W+ IS+S MH SS +  
Sbjct  174  ESEAWTHTHHHTVRMRGTDLCMQADRLEKPVKLSTNCADHGSRWKTISESNMHFSSNIV-  232

Query  294  GSN--VCLDVD-SNNVIITNTCKCLNNDSS  214
            GSN  VCLD+D S   +I + CKCL  DS+
Sbjct  233  GSNVTVCLDIDFSTKTVIASPCKCLREDST  262



>gb|EEC77494.1| hypothetical protein OsI_16340 [Oryza sativa Indica Group]
Length=554

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 162/224 (72%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT+V DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  309  FFSEFGFDMSGTHVADNRYLTCFLTVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTES-RLHKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S + + +IFHP++GLCV  V   + LELGPC
Sbjct  369  WDWCTARNPSFIKRINALQSPFQGPGLPNSHQPYNVIFHPLSGLCV-LVKSSEALELGPC  427

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             +S+ W YT G  L ++ T  CLQA+ +G+ AKLG  C+  SSKW+++S+S MH+S++L 
Sbjct  428  DKSNAWNYTKGYELILKQTGQCLQAKSVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELT  487

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +G+ VCLD   +  I TN CKCL  D  C+P SQWFKII S++
Sbjct  488  NNGTRVCLDASPDGNITTNQCKCLTVDPDCNPESQWFKIILSSK  531



>ref|XP_004975985.1| PREDICTED: uncharacterized protein LOC101760765 [Setaria italica]
Length=566

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 156/237 (66%), Gaps = 12/237 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D RG N NDNRY+ C    AA+LD DWALW L GSYYLREG   L+E YGVL 
Sbjct  313  ILSEFGVDNRGGNTNDNRYYGCAAAAAADLDMDWALWALQGSYYLREGVRDLDEVYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQPLELGPC  478
              W  PRN S L R+  +Q P RGPG  +   + ++FHP+TG CV RR S   PLELGPC
Sbjct  373  RAWSGPRNASALSRVQALQRPLRGPGLDQVPPYTVLFHPVTGTCVLRRRS--PPLELGPC  430

Query  477  SESDPWGYTAG-KALTV---EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHL-  313
            SE++ W Y+A  + L V   +G+  CL+AE  GKPA LG  C D  ++W ++SDS++H+ 
Sbjct  431  SETEAWAYSAQEQRLAVAPRDGSSLCLRAEGAGKPASLGASCGDAMARWRLVSDSKLHVA  490

Query  312  --SSKLKDGSN-VCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTK  154
              SS   DG   +CLDV ++   ++TN C+CL+ D+SCDP SQWFK++ STR    +
Sbjct  491  TSSSAAVDGDGALCLDVGADGRSVVTNPCRCLSADNSCDPQSQWFKLVTSTRSVAAE  547



>ref|NP_001053105.1| Os04g0480900 [Oryza sativa Japonica Group]
 emb|CAD41088.2| OSJNBb0011N17.5 [Oryza sativa Japonica Group]
 dbj|BAF15019.1| Os04g0480900 [Oryza sativa Japonica Group]
 dbj|BAG98948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61201.1| hypothetical protein OsJ_15210 [Oryza sativa Japonica Group]
Length=554

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 163/224 (73%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT+V DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  309  FFSEFGFDMSGTHVADNRYLTCFLTVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S+  + +IFHP++GLCV  V   + LELGPC
Sbjct  369  WDWCTARNPSFIKRINALQSPFQGPGLPNSQQPYNVIFHPLSGLCV-LVKSSEALELGPC  427

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             +S+ W YT G  L ++ T  CLQA+ +G+ AKLG  C+  SSKW+++S+S MH+S++L 
Sbjct  428  DKSNAWNYTKGYELILKQTGQCLQAKSVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELT  487

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +G+ VCL+   +  I TN CKCL  D +C+P SQWFKII S++
Sbjct  488  NNGTRVCLEASPDGNITTNQCKCLTVDPNCNPESQWFKIILSSK  531



>ref|XP_010495004.1| PREDICTED: uncharacterized protein LOC104772051 [Camelina sativa]
Length=550

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 155/225 (69%), Gaps = 5/225 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N ND+RY  C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  316  FLSEFGIDERGGNANDDRYIECLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPC  478
             +W   RN SFLQ+IS++QSP +GPG   +  + L+FHP+TGLC+ +  + +  L LGPC
Sbjct  376  SDWISVRNSSFLQKISLLQSPLQGPG-PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPC  434

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  KAL ++    CLQ+     P       C+  SSKW+ +S SRMHLSS  
Sbjct  435  NSSEPWSYTK-KALRIKDRPLCLQSNGPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAA  493

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + +++CLDVD+ NN ++ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  494  SNNTSLCLDVDATNNNVVANACKCLSKDSSCEPMSQWFKIIKATR  538



>emb|CAH66880.1| OSIGBa0158F13.11 [Oryza sativa Indica Group]
Length=554

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 163/224 (73%), Gaps = 3/224 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFG D+ GT+V DNRY  CFL +AAE+D DWA+W L GSYY+REGT+  +E YG+L+
Sbjct  309  FFSEFGFDMSGTHVADNRYLTCFLTVAAEMDLDWAIWALQGSYYIREGTLAYDESYGLLS  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL-HKLIFHPMTGLCVRRVSLFQPLELGPC  478
            W+WC  RN SF++RI+ +QSPF+GPG   S+  + +IFHP++GLCV  V   + LELGPC
Sbjct  369  WDWCTARNPSFIKRINALQSPFQGPGLPNSQQPYNVIFHPLSGLCV-LVKSSEALELGPC  427

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL-  301
             +S+ W YT G  L ++ T  CLQA+ +G+ AKLG  C+  SSKW+++S+S MH+S++L 
Sbjct  428  DKSNAWNYTKGYELILKQTGQCLQAKSVGENAKLGTSCSKSSSKWKLLSNSGMHVSTELT  487

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +G+ VCL+   +  I TN CKCL  D +C+P SQWFKII S++
Sbjct  488  NNGTRVCLEASPDGNITTNQCKCLTVDPNCNPESQWFKIILSSK  531



>ref|XP_010458756.1| PREDICTED: uncharacterized protein LOC104739968 isoform X2 [Camelina 
sativa]
Length=516

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 156/225 (69%), Gaps = 5/225 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N ND+RY  C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  282  FLSEFGIDERGGNTNDDRYIGCLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLD  341

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+IS++QSP +GPG  ++  + L+FHP+TGLC V+ ++    L LGPC
Sbjct  342  SDWISVRNSSFLQKISLLQSPLQGPG-PQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPC  400

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  +AL ++    CLQ+     P       C+  SSKW+ +S SR+HLSS  
Sbjct  401  NSSEPWSYTK-QALRIKDQPLCLQSNGPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTA  459

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + +++CLDVD+ NN ++ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  460  SNNTSLCLDVDATNNNVVANACKCLSKDSSCEPMSQWFKIIKATR  504



>emb|CDY16066.1| BnaC08g40570D [Brassica napus]
Length=553

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 148/223 (66%), Gaps = 6/223 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG NVN++RYF C  G AAE D DW+LW L G+YYLR+G VGL E+YGVL 
Sbjct  315  FLSEFGIDERGGNVNNDRYFGCLTGWAAENDVDWSLWALTGTYYLRQGVVGLNEYYGVLD  374

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+IS++QS  +GPG   +  + L+FHP+TGLC VR +     L LGPC
Sbjct  375  SDWISVRNSSFLQKISLLQSTLQGPG-PRTDAYNLVFHPLTGLCLVRSLKDTTMLTLGPC  433

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            + S+PW YT  K L +E    CLQ+     P           S+W+ IS SRMHL+    
Sbjct  434  NSSEPWSYTK-KTLRIEDQPLCLQSN---GPENRVTMSRTGCSRWQTISASRMHLALTTS  489

Query  297  DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
              +++CLDVD+ N I+ N CKCL+ DSSC P SQWFKII++TR
Sbjct  490  KNNSLCLDVDATNNILANPCKCLSKDSSCQPMSQWFKIINATR  532



>ref|XP_010458755.1| PREDICTED: uncharacterized protein LOC104739968 isoform X1 [Camelina 
sativa]
Length=550

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 156/225 (69%), Gaps = 5/225 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N ND+RY  C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  316  FLSEFGIDERGGNTNDDRYIGCLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+IS++QSP +GPG  ++  + L+FHP+TGLC V+ ++    L LGPC
Sbjct  376  SDWISVRNSSFLQKISLLQSPLQGPG-PQTDAYNLVFHPLTGLCMVQSLNDKAMLTLGPC  434

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  +AL ++    CLQ+     P       C+  SSKW+ +S SR+HLSS  
Sbjct  435  NSSEPWSYTK-QALRIKDQPLCLQSNGPNNPVTMTRTSCSTSSSKWQNVSASRLHLSSTA  493

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + +++CLDVD+ NN ++ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  494  SNNTSLCLDVDATNNNVVANACKCLSKDSSCEPMSQWFKIIKATR  538



>ref|NP_189245.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
 dbj|BAB02434.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77125.1| Cellulase (glycosyl hydrolase family 5) protein [Arabidopsis 
thaliana]
Length=508

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 157/227 (69%), Gaps = 8/227 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVNDNRY  C LG AAE D DW++WTL GSYYLREG VG+ EFYG+L 
Sbjct  285  FLSEFGIDLRGKNVNDNRYIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEFYGILD  344

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   R+ SFLQR+S++ SP +GPG ++S+++ L+FHP+TGLC+ + S+  P  + LG 
Sbjct  345  SDWVRVRSQSFLQRLSLILSPLQGPG-SQSKVYNLVFHPLTGLCMLQ-SILDPTKVTLGL  402

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSS  307
            C+ES PW YT    LT++    CL++     P KL    C+  + S+WE IS S M L++
Sbjct  403  CNESQPWSYTPQNTLTLKDKSLCLESTGPNAPVKLSETSCSSPNLSEWETISASNMLLAA  462

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTR  169
            K  + S +CLDVD  N ++ + CKC+   DSSCDP SQWFKI+  ++
Sbjct  463  KSTNNS-LCLDVDETNNLMASNCKCVKGEDSSCDPISQWFKIVKVSK  508



>ref|XP_010240029.1| PREDICTED: uncharacterized protein LOC100839976 [Brachypodium 
distachyon]
Length=562

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 159/234 (68%), Gaps = 6/234 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RG N NDNRY+ C   +AA+LD DWALWTL GSYYLREG   L+E YGVL 
Sbjct  312  FLSEFGVDNRGGNANDNRYYGCAAAVAADLDLDWALWTLQGSYYLREGVRDLDEVYGVLD  371

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQPLELGPC  478
             +W  PRN + L+R+  +Q  FRGPG+ E+  +  +FHP TGLCV RR S   PLELG C
Sbjct  372  RSWRNPRNATALRRVRALQRAFRGPGFAEAAPYVALFHPSTGLCVARRSSPVSPLELGSC  431

Query  477  SESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFC-TDDSSKWEIISDSRMHLSS  307
              ++ W Y A +      +    CL+AE  G+P ++G+ C TD+ ++W ++SDS++H+++
Sbjct  432  EGAEAWAYDAQRQRLALRDSPLMCLRAEGAGRPVRVGMACATDEMARWRLVSDSKLHVAA  491

Query  306  KLKDGSNV-CLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKS  151
                G+ + CLDV ++   ++TNTC+CL+ D+SCDP SQWFK++ STR    +S
Sbjct  492  NASSGAGMLCLDVGADGRSVVTNTCRCLSADNSCDPESQWFKLVSSTRRVGARS  545



>dbj|BAK05121.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 154/237 (65%), Gaps = 9/237 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+D RG N NDNRY+ C   +AA+LD DWALWTL GSYYLR+G + L+E YGVL 
Sbjct  317  FLSEFGVDNRGGNANDNRYYGCAAAVAADLDLDWALWTLQGSYYLRQGVLDLDEVYGVLD  376

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
              W  PRN + L+R+  +Q P RGPGY E+  + ++FHP TGLCV R S  QPLELG C+
Sbjct  377  RAWSSPRNHTALRRVQPLQRPLRGPGYAEAAPYTVLFHPATGLCVLRRSPTQPLELGACA  436

Query  474  ESDPWGYTA--GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
             ++ W Y    G+    +    CL A+  G P + G+ C DD S+W ++SDS++H++   
Sbjct  437  NTEAWEYAPQQGRLALRDSPLMCLHAQGAGLPVRFGMPCDDDMSRWRLVSDSKLHVAVNA  496

Query  300  KDGSN------VCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTTTKS  151
                +      +CLDVD++   ++TN C+CL+ D+SCDP +QWFK++ STR     S
Sbjct  497  SSSGSGSGGGMLCLDVDADGQSVVTNPCRCLSADNSCDPENQWFKLVTSTRSVAASS  553



>ref|XP_010476303.1| PREDICTED: uncharacterized protein LOC104755594 [Camelina sativa]
Length=559

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 152/226 (67%), Gaps = 6/226 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N  D+RY  C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  328  FLSEFGIDERGGNAADDRYIGCLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLD  387

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRV--SLFQPLELGP  481
             +W   RN SFLQ+IS++QSP +GPG   +  + L+FHP+TGLC+ R        L LGP
Sbjct  388  SDWISVRNSSFLQQISLLQSPLQGPG-PRTDAYNLVFHPLTGLCMVRSLNDKTMMLTLGP  446

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSK  304
            C+ S+PW YT  +AL ++    CLQ+     P       C+  SSKW+ +S SRMHLSS 
Sbjct  447  CNSSEPWSYTK-QALRIKDQSLCLQSNGPNNPVTMTRTSCSTSSSKWQTVSASRMHLSST  505

Query  303  LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
              + +++CLDVD+ NN ++ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  506  ASNNTSLCLDVDATNNNVVANACKCLSKDSSCEPMSQWFKIIKATR  551



>ref|XP_010691763.1| PREDICTED: uncharacterized protein LOC104905020 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 144/222 (65%), Gaps = 7/222 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G+DL      D R+ NCFL    E D DWALW L GSYYLREG V  +E +G+L 
Sbjct  306  FVSEWGVDLSYFGKRDKRFTNCFLAWMVEHDLDWALWALTGSYYLREGQVNAKEQFGILD  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP---LELG  484
              W   RN  FLQRIS++Q P +GP  +    HK+IFHP+TGLC+    L +P   ++LG
Sbjct  366  PKWTHIRNERFLQRISVIQYPRQGPEASFRNKHKMIFHPLTGLCI----LSKPGMEVQLG  421

Query  483  PCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
             CS+S+ W +T    L ++G+Y CL+A+ L  PAKL   C  + + W  ISDS++HL++ 
Sbjct  422  NCSKSNHWNHTPENTLEIKGSYLCLKAQGLNLPAKLSTSCRGEGTSWAPISDSKLHLATT  481

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIID  178
            L + S  CLDVDS N +IT +CKCL+  + CDP SQWFKI D
Sbjct  482  LSNNSTACLDVDSQNNLITTSCKCLSEKNKCDPGSQWFKIAD  523



>ref|XP_006292902.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
 gb|EOA25800.1| hypothetical protein CARUB_v10019167mg [Capsella rubella]
Length=511

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/230 (51%), Positives = 156/230 (68%), Gaps = 11/230 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVNDNRY  C LG AAE D DW++WTL GSYYLREG VG+ E+YGVL 
Sbjct  285  FLSEFGIDLRGKNVNDNRYIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLD  344

Query  654  WNWCEPRNLSFLQRISIMQSPFR---GPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LE  490
             +W   RN+SFLQR+S++QSP +   GPG ++ +++ L+FHP+TGLC+ + S+  P  + 
Sbjct  345  SDWDRVRNMSFLQRLSLIQSPLQSLPGPG-SQPKVYNLVFHPLTGLCMLQ-SILDPTKVT  402

Query  489  LGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLF--CTDDSSKWEIISDSRMH  316
            LG C+ES PW YT    LT++    CL+      P KL      + + SKW  IS S M 
Sbjct  403  LGLCNESQPWSYTPDNTLTLKDKSLCLENTGPNAPVKLSKTSCSSPNLSKWHTISASNML  462

Query  315  LSSKLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTR  169
            L++K  + S +CLDVD +N +I + CKC+   DSSCDP SQWFKII  ++
Sbjct  463  LAAKSTNNS-LCLDVDESNNLIASNCKCVKGEDSSCDPMSQWFKIIKVSK  511



>ref|XP_010425288.1| PREDICTED: uncharacterized protein LOC104710406 [Camelina sativa]
Length=555

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 157/223 (70%), Gaps = 8/223 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRGTNVNDNRY  C LG AAE D DW++WTL GSYYLREG VG+ E+YGVL 
Sbjct  332  FLSEFGIDLRGTNVNDNRYIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLD  391

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   R+ SFLQR+S++QSP +GPG ++ +++ L+FHP+TGLC+ + S+  P  + LG 
Sbjct  392  SDWDRVRSRSFLQRLSLIQSPLQGPG-SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGL  449

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSS  307
            C+ES PW YT    L ++    CL++     P KL  + C+  + SKW+ IS S M L++
Sbjct  450  CNESQPWSYTPDNTLKLKEKSLCLESTGSNVPVKLSKMSCSSPNLSKWQSISASNMLLAA  509

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKII  181
            K  + S +CLDVD +N ++ + CKC+   D+SCDP SQWFKI+
Sbjct  510  KSSNNS-LCLDVDESNNLMASDCKCVKGEDTSCDPTSQWFKIV  551



>ref|XP_010501449.1| PREDICTED: uncharacterized protein LOC104778702 [Camelina sativa]
Length=259

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 151/225 (67%), Gaps = 5/225 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             V +  ++ RG N ND+RY  C  G AAE D DW+LW L GSYYLR+G VG+ E+YGVL 
Sbjct  25   IVEKTLMNERGGNANDDRYIECLTGWAAENDLDWSLWALTGSYYLRQGVVGMIEYYGVLD  84

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPC  478
             +W   RN SFLQ+IS++QSP +GPG   +  + L+FHP+TGLC+ +  + +  L LGPC
Sbjct  85   SDWISVRNSSFLQKISLLQSPLQGPG-PRTDAYNLVFHPLTGLCMVQSLIDKTMLTLGPC  143

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPA-KLGLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  KAL ++    CLQ+     P       C+  SSKW+ +S SRMHLSS  
Sbjct  144  NSSEPWSYTK-KALRIKDRPLCLQSNGPNNPVTMTLTSCSTSSSKWQNVSASRMHLSSAA  202

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + +++CLDVD+ NN ++ N CKCL+ DSSC+P SQWFKII +TR
Sbjct  203  SNNTSLCLDVDATNNNVVANACKCLSKDSSCEPMSQWFKIIKATR  247



>ref|XP_009381699.1| PREDICTED: uncharacterized protein LOC103969775 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 150/226 (66%), Gaps = 5/226 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G+D +G N+NDNRYF C L   A+ D DWALWTL GSYYLREG V   E YG+LT
Sbjct  252  FVSEYGVDQQGGNLNDNRYFGCILAFLADKDVDWALWTLQGSYYLREGVVDKGESYGMLT  311

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLF-QPLELGPC  478
            ++W   RN + LQ++  +Q PF+GPG +++  + +I HP TGLCVR+ SL    L+ GPC
Sbjct  312  YDWAGVRNQTVLQKVRAVQQPFQGPGVSKTPPYIIILHPSTGLCVRQGSLTSHTLDFGPC  371

Query  477  SES-DPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
              +   + YT  + LT   +  C+ A   GKP K    C+D  S W+++SDS MH+S+ L
Sbjct  372  DGNMQAFHYTQQQTLTSVDSSLCVSATGSGKPVKFD-SCSDSGSSWDLVSDSGMHVSTTL  430

Query  300  K-DGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRG  166
              DGS +CLDV  N V +TN CKCL +D++CDP SQWFK++ S + 
Sbjct  431  PGDGSTLCLDVGQNGV-VTNPCKCLRDDANCDPGSQWFKLVTSAKA  475



>ref|XP_002876948.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53207.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=509

 Score =   225 bits (574),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 156/224 (70%), Gaps = 9/224 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVNDNRY  C LG AAE D DW++WTL GSYYLREG VG+ E+YG+L 
Sbjct  285  FLSEFGIDLRGKNVNDNRYIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGILD  344

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   R+ +FLQR+S++QSP +GPG ++S+++ L+FHP+TGLC+ + S+  P  + LG 
Sbjct  345  SDWVRVRSQNFLQRLSLIQSPLQGPG-SQSKVYNLVFHPLTGLCMLQ-SILDPTKVTLGL  402

Query  480  CSESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLS  310
            C+ES PW YT     LT++    CL+      P KL    C+  + SKWE IS S M L+
Sbjct  403  CNESQPWSYTPENTLLTLKDKSLCLETTGPNAPVKLSEASCSSPNLSKWETISASNMLLA  462

Query  309  SKLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKII  181
            +K  + S +CLDVD +N +I + CKC+   DSSCDP SQWFKI+
Sbjct  463  AKSTNNS-LCLDVDESNNLIASNCKCVKGEDSSCDPISQWFKIV  505



>ref|XP_009148543.1| PREDICTED: uncharacterized protein LOC103871957 [Brassica rapa]
Length=574

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 150/224 (67%), Gaps = 4/224 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N +DNRYF C  G AA  D DW+LW L GSYYLREG VGL E+YGVL 
Sbjct  332  FLSEFGIDERGGNADDNRYFGCVSGWAAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLD  391

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+I+++QS  +GPG   +  + L+FHP TGLC VR ++    L LGPC
Sbjct  392  SDWISVRNSSFLQKITLLQSQLQGPG-PSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPC  450

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKL-GLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  + L  +    CLQ+   G    +  + C+   S W+ IS S+MHL+S  
Sbjct  451  NSSEPWSYTK-QTLRSKDQSLCLQSNGPGNRVTMTKMDCSSPGSIWQTISASKMHLASTT  509

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + ++VCLDVD+++ ++ N CKCL+ DSSC+P SQWF II +TR
Sbjct  510  SNNTSVCLDVDADDNVLANACKCLSKDSSCEPMSQWFTIIKATR  553



>emb|CDY19395.1| BnaC05g09040D [Brassica napus]
Length=527

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 150/224 (67%), Gaps = 4/224 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N +DNRYF C  G AA  D DW+LW L GSYYLREG VGL E+YGVL 
Sbjct  285  FLSEFGIDERGGNADDNRYFGCVSGWAAGNDVDWSLWALTGSYYLREGKVGLVEYYGVLD  344

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+I+++QS  +GPG   +  + L+FHP TGLC VR ++    L LGPC
Sbjct  345  SDWISVRNSSFLQKITLLQSQLQGPG-PSTDAYNLVFHPYTGLCLVRSLNDTTMLTLGPC  403

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKL-GLFCTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  + L ++    CLQ+   G    +    C+   S W+ IS S+MHL+S  
Sbjct  404  NSSEPWSYTK-QTLRIKDQSLCLQSNGPGNRVTMTKTDCSSPGSIWQTISASKMHLASTT  462

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + ++VCLDV +++ ++ N CKCL+ DSSC+P SQWF II++TR
Sbjct  463  SNNTSVCLDVAADDKVLANACKCLSKDSSCEPMSQWFTIINATR  506



>ref|XP_006400290.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
 gb|ESQ41743.1| hypothetical protein EUTSA_v10015581mg [Eutrema salsugineum]
Length=528

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 144/222 (65%), Gaps = 10/222 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +   NRY +C L  AAE D DWA+W L G YY REG  G+ E YG+L 
Sbjct  311  FLSEFGTDQRGGDFEGNRYMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGP  481
             NW    N ++LQR+S++Q P +GPG   +  HK +FHP+TGLC+ R S      L LGP
Sbjct  371  ANWHNVHNYTYLQRLSVIQPPHKGPGIKHNH-HKKLFHPLTGLCLVRKSPCHESELTLGP  429

Query  480  CSESDPWGYTAGKALTVEG--TYFCLQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLS  310
            C++ +PW Y+ G  L ++G     CL+ E + GK  KLG  CT    K + IS ++MHLS
Sbjct  430  CTKDEPWSYSHGGTLEIKGGTQRSCLEGETMVGKSVKLGTRCT----KVKRISATKMHLS  485

Query  309  SKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
             K KDGS VCLDVDS+N +  N CKCL  DSSC+PASQWFKI
Sbjct  486  FKSKDGSLVCLDVDSDNNVFANRCKCLTGDSSCEPASQWFKI  527



>ref|XP_010502524.1| PREDICTED: uncharacterized protein LOC104779826 [Camelina sativa]
Length=534

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 155/223 (70%), Gaps = 8/223 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVN+NRY  C LG AAE D DW++WTL GSYYLREG VG+ E+YGVL 
Sbjct  311  FLSEFGIDLRGQNVNENRYIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   R+  FLQR+S++QSP +GPG ++ +++ L+FHP+TGLC+ + S+  P  + LG 
Sbjct  371  SDWDRVRSRIFLQRLSLIQSPLQGPG-SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGL  428

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSS  307
            C+ES PW YT    L ++    CL++     P KL  + C+  + SKW+ IS S M L++
Sbjct  429  CNESRPWSYTPDNTLKLKEKSLCLESTGSNAPVKLSKMSCSSPNLSKWQTISASNMLLAA  488

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKII  181
            K  + S +CLDVD +N ++ + CKC+   D+SCDP SQWFKI+
Sbjct  489  KSSNNS-LCLDVDESNNLMASDCKCVKGEDNSCDPTSQWFKIV  530



>emb|CBI20316.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 121/163 (74%), Gaps = 4/163 (2%)
 Frame = -2

Query  651  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  472
            NW    N +F QRIS +QSP +GP  +  R HK+I HP TGLC+ R SL +PL+LGPC+E
Sbjct  2    NW----NSNFFQRISALQSPLQGPDVSRVRPHKIILHPSTGLCILRESLSEPLKLGPCTE  57

Query  471  SDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG  292
            S+ WGYT  K L V+GTYFCLQA  LGKPAKL + CT   S WEIISDS+M+LS+KL DG
Sbjct  58   SEAWGYTPQKILIVKGTYFCLQAVGLGKPAKLSIICTQPGSNWEIISDSKMYLSTKLGDG  117

Query  291  SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGT  163
            + VCLDVDS++ I+T+ CKCL  D  CDP SQWFK++DST  T
Sbjct  118  TTVCLDVDSSSNIVTDACKCLGRDDMCDPGSQWFKVVDSTNIT  160



>emb|CDX98009.1| BnaA06g07600D [Brassica napus]
Length=557

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 145/224 (65%), Gaps = 4/224 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N +DNRYF C  G AA  D DW+LW L G YYLREG VGL E+YGVL 
Sbjct  315  FLSEFGIDERGGNADDNRYFGCVSGWAAGNDVDWSLWALTGRYYLREGKVGLVEYYGVLD  374

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ+I+++QS  +GPG   +  + L+FHP TGLC VR  +    L LGPC
Sbjct  375  SDWISVRNSSFLQKITLLQSQLQGPG-PSTDAYNLVFHPYTGLCLVRSPNDTTMLTLGPC  433

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRMHLSSKL  301
            + S+PW YT  + L  +    CLQ+   G    +    C+   S W+ IS S MHL+S  
Sbjct  434  NSSEPWSYTK-QTLRSKDQSLCLQSNGPGNRVTMTKRDCSSPGSIWQTISASNMHLASTT  492

Query  300  KDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             + ++VCLDVD++N ++ N CKCL+ DSSC+P SQWF I  +TR
Sbjct  493  SNNTSVCLDVDADNNVLANDCKCLSKDSSCEPMSQWFTITKATR  536



>ref|NP_197252.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAC01894.1| putative protein [Arabidopsis thaliana]
 gb|AED92434.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 142/221 (64%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG ++  NRY NC L  AAE D DWA+W + G YY REG  G+ E YG+L 
Sbjct  310  FLSEFGTDQRGGDLEGNRYMNCMLAWAAEKDLDWAVWAVTGVYYFREGKRGVVEAYGMLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGP  481
             NW    N ++L+R+S++Q P  GPG   +  HK IFHP+TGLC+ R S      L LGP
Sbjct  370  ANWHNVHNYTYLRRLSVIQPPHTGPGVKHNH-HKKIFHPLTGLCLVRKSHCHESELTLGP  428

Query  480  CSESDPWGYTAGKALTV-EGTYFCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L +  G   CL+ E  +GK  KLG  CT    K E IS ++MHLS 
Sbjct  429  CTKDEPWSYSHGGILEIRRGHKSCLEGETAVGKSVKLGRICT----KIEQISATKMHLSF  484

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
               DGS VCLDVDS+N ++ N+C CL  D++C+PASQWFKI
Sbjct  485  NTSDGSLVCLDVDSDNNVVANSCNCLTGDTTCEPASQWFKI  525



>ref|XP_002871770.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48029.1| glycosyl hydrolase family 5 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=527

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 147/221 (67%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +   NRY +C L  AAE D DWA+W L G YY REG  G+ E YG+L 
Sbjct  311  FLSEFGTDQRGGDFEGNRYMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVLEAYGMLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGP  481
             NW    N ++L+R+S++Q P +GPG   +  HK IFHP+TGLC VR+ S ++  L LGP
Sbjct  371  ANWHNVHNYTYLRRLSVIQPPHKGPGIKHNH-HKKIFHPLTGLCLVRKSSCYESELMLGP  429

Query  480  CSESDPWGYTAGKALTVEGTY-FCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L ++G +  CL+ E  +G+  KLG  CT    K   IS ++MHLS 
Sbjct  430  CTKGEPWSYSHGGILEIKGGHKSCLEGETAVGRSVKLGKKCT----KIMQISATKMHLSL  485

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            K  DGS VCLDVDS+N ++ N+CKCL  D +C+PASQWFKI
Sbjct  486  KTNDGSLVCLDVDSDNNVVANSCKCLTGDITCEPASQWFKI  526



>ref|XP_004955049.1| PREDICTED: uncharacterized protein LOC101776534 [Setaria italica]
Length=556

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 141/234 (60%), Gaps = 12/234 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRG ++  NRYF C   +AA+ D DWA W L GSY LR+G  G++E YGVL 
Sbjct  312  FLSEFGADLRGGDLRGNRYFPCAAAVAAKHDLDWAYWALQGSYALRQGVAGMDEVYGVLD  371

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            W+W +PRN + L RI  +Q P +GPGY E+  + ++FHP+TGLC    +    LEL PC+
Sbjct  372  WSWTKPRNETVLSRIQALQRPIQGPGYGEALPYTVLFHPLTGLCAAASAAAGTLELRPCN  431

Query  474  ESDPWGYTAGKALTVE-------GTYFCLQAEKLGKPAKLGL-FCTDDSSKWEIISDSRM  319
            E+D W Y    +  V        G   CL+AE  G PA+LG   C D  S W I SDS M
Sbjct  432  ETDAWAYAPPSSTLVRRDAAAAGGLLPCLRAEGRGLPARLGTKACGDALSTWRIASDSGM  491

Query  318  HLSSKLK---DGSNVCLDVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            H++        G  +CLDV ++   I+TN C CL  D +CDP  QWFK++ STR
Sbjct  492  HVAVDAAPELGGGTLCLDVGADGRSIVTNPCACLRGDGTCDPERQWFKLVTSTR  545



>emb|CBI20314.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = -2

Query  651  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSE  472
            NW    N SF QRIS +QSP +GP  +  R HK+IFHP TGLC+ R S  +PL+LGPC++
Sbjct  2    NW----NSSFFQRISALQSPLQGPDVSRVRRHKIIFHPSTGLCILRESGSEPLKLGPCTK  57

Query  471  SDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG  292
            S+ WGYT  K LTV+GTYFCLQA  LGKPAKL + CT   S WE ISDS+M+LS+KL DG
Sbjct  58   SEAWGYTPQKLLTVKGTYFCLQAVGLGKPAKLSIICTKPGSNWENISDSKMYLSTKLGDG  117

Query  291  SNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDST  172
            + VCLDVDS++ I+T+ CKCL     CDP SQWFK++DST
Sbjct  118  TRVCLDVDSSSTIVTDACKCLGRGDMCDPGSQWFKVVDST  157



>gb|KFK38059.1| hypothetical protein AALP_AA3G064700 [Arabis alpina]
Length=449

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRG ++  NRY NC L  A E D DWA+W L G YYLREG   + E +G+L 
Sbjct  233  FLSEFGADLRGGDLEGNRYMNCMLAWAVEKDIDWAVWVLTGDYYLREGKRNVVEPFGILD  292

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLE--LGP  481
             NW + RN S+LQR+S++Q P +GPG   +  HK IFHP+TGLC+ R SL    E  LGP
Sbjct  293  TNWHDARNSSYLQRLSVIQQPHKGPGLRHNH-HKKIFHPLTGLCIVRESLCHDSELVLGP  351

Query  480  CSESDPWGYTAGKALTVE-GTYFCLQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y     L ++     C++  K+ GK  KLG  C    SK E IS S+MH S 
Sbjct  352  CTKEEPWSYNNHGTLMIKTHESICVEGGKVAGKVVKLGKEC----SKIERISASKMHFSL  407

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            K +DGS +CLDVDS N ++ + CKCL  D++C+P SQWFKI
Sbjct  408  KDQDGSLICLDVDSKNKVVWSPCKCLTGDATCEPESQWFKI  448



>ref|XP_006289374.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
 gb|EOA22272.1| hypothetical protein CARUB_v10002868mg [Capsella rubella]
Length=527

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +   NRY +C L  AAE D DWA+W L G YY REG  G+ E YG+L 
Sbjct  311  FLSEFGTDQRGGDFEGNRYMSCMLAWAAEKDMDWAVWALTGVYYFREGKRGVVEAYGMLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGP  481
             NW    N ++L+R+S++Q P +GPG   +  HK IFHP+TGLC+ R S      L LGP
Sbjct  371  ANWHNVHNSTYLRRLSVIQPPHKGPGIRRNH-HKKIFHPLTGLCLVRKSPCHDSELTLGP  429

Query  480  CSESDPWGYTAGKALTVEGTY-FCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L ++G +  CL+ E  +GK  KLG  CT    K + IS ++MHLS 
Sbjct  430  CTKDEPWSYSHGGTLEIKGGHKSCLEGETAVGKSVKLGKRCT----KVKQISATKMHLSF  485

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            +  +GS VCLDVDS+N +I N+CKCL  D SC+PASQWFKI
Sbjct  486  ETDEGSLVCLDVDSDNNVIANSCKCLTGDVSCEPASQWFKI  526



>ref|XP_010492706.1| PREDICTED: uncharacterized protein LOC104770057 [Camelina sativa]
Length=528

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 148/222 (67%), Gaps = 10/222 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG ++  NRY +C L  AAE D DWA+W L G YY+REG  G+ E YG+L 
Sbjct  311  FLSEFGTDQRGGDLEGNRYMSCMLAWAAEKDMDWAVWALTGVYYIREGKRGVVESYGMLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGP  481
             NW    N ++L+R+S++Q P +GPG   +  HK IFHP+TGLC+ R S      L LGP
Sbjct  371  ANWHNVHNSTYLRRLSVIQQPHKGPGIKHNH-HKKIFHPLTGLCLVRKSPCHESELTLGP  429

Query  480  CSESDPWGYT-AGKALTVEGTY-FCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLS  310
            C++ +PW Y+  G  L ++G +  CL++E  +GK  KLG  CT    K + IS ++MHLS
Sbjct  430  CTKDEPWSYSHHGGVLEIKGGHKSCLESETAVGKSVKLGKKCT----KIKQISATKMHLS  485

Query  309  SKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
             K  +GS VCLDVDS+N ++ N+CKCL  D SC+PASQWFKI
Sbjct  486  FKTNEGSLVCLDVDSDNNVVANSCKCLTGDVSCEPASQWFKI  527



>emb|CDY13614.1| BnaA06g33090D [Brassica napus]
Length=460

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 147/227 (65%), Gaps = 6/227 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG N+ND+RY  C LG AAE D DW++W L GSYYLREG VG+ E+YGVL 
Sbjct  232  FLSEFGIDLRGGNINDDRYIGCILGWAAENDIDWSIWALQGSYYLREGVVGMTEYYGVLD  291

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPC  478
             +W   RN SF+QR+S++QS  +GP   +  +  LIFHP+TGLC+ + SL    + LG C
Sbjct  292  SDWISVRNNSFMQRLSLIQSTLQGPD-PQPEVSNLIFHPLTGLCMLQSSLDLTKVNLGRC  350

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSK  304
            ++S PW YT    L ++    CL       P KL    C+  S S+W+ IS S M L++K
Sbjct  351  NQSQPWDYTTDNTLKLKNIPLCLANTGPNAPVKLSEASCSIPSLSQWQPISASNMLLAAK  410

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTRG  166
              + S +CLDVD +N ++   CKC+N  D+SCDP SQWFKI+   + 
Sbjct  411  STNNS-LCLDVDGDNNVVATNCKCVNGEDTSCDPMSQWFKIVKVNKA  456



>ref|XP_010420476.1| PREDICTED: uncharacterized protein LOC104706046 [Camelina sativa]
Length=527

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 143/221 (65%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG ++  NRY +C L  AAE D DWA+W L G YY+REG  G+ E YG+L 
Sbjct  311  FLSEFGTDQRGGDLEGNRYMSCMLAWAAEKDMDWAVWALTGVYYIREGKRGVVESYGMLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGP  481
             NW    N ++L+R+S++Q P +GPG   +  HK IFHP+TGLC+ R S      L LGP
Sbjct  371  ANWHNVHNSTYLRRLSVIQQPHKGPGIKHNH-HKKIFHPLTGLCLVRKSPCHESELTLGP  429

Query  480  CSESDPWGYTAGKALTVEGTY-FCLQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L ++G +  CL+ E   GK  KLG  CT    K   IS ++MHLS 
Sbjct  430  CTKDEPWSYSHGGVLEIKGGHKSCLEGETAEGKSVKLGKRCT----KIMQISATKMHLSF  485

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            K  +GS VCLDVD +N ++ N CKCL  D SC+PASQWFKI
Sbjct  486  KTNEGSLVCLDVDPDNNVVANPCKCLTGDVSCEPASQWFKI  526



>ref|XP_009152075.1| PREDICTED: uncharacterized protein LOC103875317 [Brassica rapa]
Length=538

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 147/227 (65%), Gaps = 6/227 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG N+ND+RY  C LG AAE D DW++W L GSYYLREG VG+ E+YGVL 
Sbjct  310  FLSEFGIDLRGGNINDDRYIGCILGWAAENDIDWSIWALQGSYYLREGVVGMTEYYGVLN  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPC  478
             +W   RN SF+QR+S++QS  +GP   +  +  LIFHP+TGLC+ + SL    + LG C
Sbjct  370  SDWISVRNNSFMQRLSLIQSTLQGPD-PQPEVSNLIFHPLTGLCMLQSSLDPTKVNLGRC  428

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSK  304
            ++S PW YT    L ++    CL       P KL    C+  S S+W+ IS S M L++K
Sbjct  429  NQSQPWDYTTDNTLKLKNIPLCLANTGPNAPVKLSEASCSTPSLSQWQPISASNMLLAAK  488

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTRG  166
              + S +CLDVD +N ++   CKC+N  DSSCDP SQWFKI+   + 
Sbjct  489  STNNS-LCLDVDGDNNVVATNCKCVNGEDSSCDPMSQWFKIVKVNKA  534



>emb|CDY38435.1| BnaA10g17230D [Brassica napus]
Length=524

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +   NRY +C L  AAE D DWA+W L G YY REG  G+ E YG+L 
Sbjct  308  FLSEFGTDQRGGDFEGNRYMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGP  481
             NW    N ++LQR+S++Q P +GPG   +  HK IFHP+TGLC VR+   ++  L LGP
Sbjct  368  ANWHHVHNHTYLQRLSVIQPPHKGPGIKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGP  426

Query  480  CSESDPWGYTAGKALTVEGTY-FCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L ++G +  C++ E  +G+  KLG  CT    K + IS ++MHL+ 
Sbjct  427  CTKDEPWSYSHGDRLEIKGGHKSCVEGETSVGRSVKLGKKCT----KIKRISATKMHLAF  482

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            K  DG  VCLDVDS+N I+ N CKCL  D SC+PASQWFKI
Sbjct  483  KNNDGLLVCLDVDSDNNIVANHCKCLTGDISCEPASQWFKI  523



>ref|XP_009107523.1| PREDICTED: uncharacterized protein LOC103833179 [Brassica rapa]
Length=527

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 145/221 (66%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +   NRY +C L  AAE D DWA+W L G YY REG  G+ E YG+L 
Sbjct  311  FLSEFGTDQRGGDFEGNRYMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGP  481
             NW    N ++LQR+S++Q P +GPG   +  HK IFHP+TGLC VR+   ++  L LGP
Sbjct  371  ANWHHVHNHTYLQRLSVIQPPHKGPGIKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGP  429

Query  480  CSESDPWGYTAGKALTVEGTY-FCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L ++G +  C++ E  +G+  KLG  CT    K + IS ++MHL+ 
Sbjct  430  CTKDEPWSYSHGDRLEIKGGHKSCVEGETSVGRSVKLGKKCT----KIKRISATKMHLAF  485

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            K  DG  VCLDVDS+N I+ N CKCL  D SC+PASQWFKI
Sbjct  486  KNNDGLLVCLDVDSDNNIVANHCKCLTGDISCEPASQWFKI  526



>emb|CDY16914.1| BnaC09g40410D [Brassica napus]
Length=524

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 144/221 (65%), Gaps = 9/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +   NRY +C L  AAE D DWA+W L G YY REG  G+ E YG+L 
Sbjct  308  FLSEFGTDQRGGDFEGNRYMSCMLAWAAEKDIDWAVWALTGVYYFREGKRGVVEAYGMLD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQ-PLELGP  481
             NW    N ++LQR+S++Q P +GPG   +  HK IFHP+TGLC VR+   ++  L LGP
Sbjct  368  ANWHHVHNHTYLQRLSVIQPPHKGPGIKHNH-HKKIFHPLTGLCLVRKSPCYESELTLGP  426

Query  480  CSESDPWGYTAGKALTVEGTY-FCLQAE-KLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
            C++ +PW Y+ G  L ++G +  C++ E  +G   KLG  CT    K + IS ++MHLS 
Sbjct  427  CTKDEPWSYSHGDRLEIKGGHKSCVEGETSVGSSVKLGKKCT----KIKRISATKMHLSF  482

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKI  184
            K  DG  VCLDVDS+N ++ N CKCL  D SC+PASQWFKI
Sbjct  483  KNNDGLLVCLDVDSDNNVVANHCKCLTGDISCEPASQWFKI  523



>ref|XP_002446675.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
 gb|EES11003.1| hypothetical protein SORBIDRAFT_06g020270 [Sorghum bicolor]
Length=586

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 162/250 (65%), Gaps = 23/250 (9%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D RG N NDNRY+ C    AA+LD DWALW L GSYYLREG +GL+E YGVL 
Sbjct  318  ILSEFGVDNRGGNTNDNRYYGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLD  377

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC--VRRVS----LFQPL  493
            W WC+PRN + L+R+  +Q P RGPG  E+  + ++FHP++G+C  VRR S    L QP 
Sbjct  378  WAWCKPRNDTALRRVQALQRPLRGPGLAEAAPYAVLFHPVSGMCVVVRRRSPTPTLAQPF  437

Query  492  E--LGPCSESDPWGYTAGK---ALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISD  328
            E  LGPCSE+  W Y+A +    L       CL+AE  G+PA LG+ C D  ++W ++SD
Sbjct  438  ELGLGPCSETGAWEYSAQQQRLGLRDTAALLCLRAEGAGRPATLGVTCGDAMARWSLVSD  497

Query  327  SRMHLS----------SKLKDGSN-VCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKI  184
            S++H++              DG+  +CLDV ++   ++TN C+CL+ D+SCDP SQWFK+
Sbjct  498  SKLHVAVNATSSSSAGVSDSDGNGLLCLDVGADGRSVVTNPCRCLSADNSCDPQSQWFKL  557

Query  183  IDSTRGTTTK  154
            + STR   TK
Sbjct  558  VSSTRSVVTK  567



>emb|CDX83591.1| BnaC07g23310D [Brassica napus]
Length=460

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/227 (49%), Positives = 146/227 (64%), Gaps = 6/227 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFGIDLRG NVNDNRY  C LG AAE D DW++W L GSYY+REG VG+ E+YGVL 
Sbjct  232  ILSEFGIDLRGGNVNDNRYMGCILGWAAENDIDWSIWGLQGSYYIREGVVGMTEYYGVLD  291

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPC  478
             +W   RN SF+QR+S++QS  +GP   +  +  LIFHP+TGLC+ + SL    + LG C
Sbjct  292  SDWISVRNNSFMQRLSLIQSTLQGPD-PQPDVSNLIFHPLTGLCMLQSSLDPTKVNLGRC  350

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG-LFCTDDS-SKWEIISDSRMHLSSK  304
            ++S PW YT    L ++    CL       P KL    C+  S S+W+ IS S M L++K
Sbjct  351  NQSQPWDYTTENTLKLKNIPLCLANTGPNAPLKLSETSCSIPSLSQWQPISASNMLLAAK  410

Query  303  LKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTRG  166
              + S +CLDVD +N ++   CKC+N  DSSCDP SQWFKI+   + 
Sbjct  411  STNNS-LCLDVDGDNNVVATNCKCVNGEDSSCDPMSQWFKIVKVNKA  456



>gb|ACF85134.1| unknown [Zea mays]
Length=492

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 156/242 (64%), Gaps = 15/242 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D RG N NDNRY+ C    AA+LD DWALW L GSYYLREG +GL+E YGVL 
Sbjct  232  ILSEFGVDNRGVNTNDNRYYGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLD  291

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR----VSLFQP--L  493
            W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP++G+CV R     SL QP  L
Sbjct  292  WAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHPVSGMCVVRRSPTPSLTQPFQL  351

Query  492  ELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRM  319
             LGPC+E++ W Y+A +      +    CL+AE  G+PA L + C D  ++W  +SDS++
Sbjct  352  SLGPCNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPASLAVSCGDAMARWGFVSDSKL  411

Query  318  HLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            H++      +       +CLDV ++   ++TN C+CL+ D+SCDP  QWFK++ STR   
Sbjct  412  HVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSADNSCDPQGQWFKLVSSTRSVV  471

Query  159  TK  154
            TK
Sbjct  472  TK  473



>ref|XP_004975262.1| PREDICTED: uncharacterized protein LOC101779133 [Setaria italica]
Length=595

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 155/255 (61%), Gaps = 18/255 (7%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D RG N  DNRY+ C    AA LD DWALW L GSYYLREG  G +E YGVL 
Sbjct  332  ILSEFGVDNRGGNAADNRYWGCVAAAAAGLDLDWALWALQGSYYLREGVAGHDEAYGVLG  391

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV---RRVSLFQPLELG  484
             +W  PRN + L+R+  +Q PFRGPG  E+  +  +FHP TGLCV   RR SL   LELG
Sbjct  392  HDWLRPRNGTALRRVRALQRPFRGPGLDEAAPYDALFHPATGLCVVRRRRSSL--TLELG  449

Query  483  PCSESDPWGYTAGKALTVEGTYF--CLQAEKLGKPAKLGL---FCTDDSSKWEIISDSRM  319
            PC+E++ W Y     L + G++   CL+AE  G+P +LG+    C    ++W + S S++
Sbjct  450  PCNETEAWEYNPEHRLVLRGSWLRPCLRAEGAGRPVRLGVGRAGCAGAQARWLLESKSKL  509

Query  318  HLSSKLKDGSN------VCLDVDSNN-VIITNTCKCLNNDSS-CDPASQWFKIIDSTRGT  163
            H++      S+      +CLDV ++   I+TN C+CL+  SS CDP SQWFK++ STR  
Sbjct  510  HVAVHAPPSSSSSRSEILCLDVSADGRSIVTNRCRCLSGGSSRCDPESQWFKLVSSTRKV  569

Query  162  TTKSDFQSTSFLYFL  118
             + S   +   L+ L
Sbjct  570  ASGSSVLAQLLLHVL  584



>ref|NP_001130915.1| hydrolase, hydrolyzing O-glycosyl compound precursor [Zea mays]
 gb|ACF85192.1| unknown [Zea mays]
 gb|ACG23910.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
 gb|ACN27949.1| unknown [Zea mays]
 gb|ACN28477.1| unknown [Zea mays]
 gb|ACN34624.1| unknown [Zea mays]
 gb|ACN34788.1| unknown [Zea mays]
 tpg|DAA37297.1| TPA: hydrolase, hydrolyzing O-glycosyl compound [Zea mays]
Length=576

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 156/242 (64%), Gaps = 15/242 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D RG N NDNRY+ C    AA+LD DWALW L GSYYLREG +GL+E YGVL 
Sbjct  316  ILSEFGVDNRGVNTNDNRYYGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR----VSLFQP--L  493
            W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP++G+CV R     SL QP  L
Sbjct  376  WAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHPVSGMCVVRRSPTPSLTQPFQL  435

Query  492  ELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRM  319
             LGPC+E++ W Y+A +      +    CL+AE  G+PA L + C D  ++W  +SDS++
Sbjct  436  SLGPCNETEAWEYSAQQQRLALRDAALLCLRAEGAGRPASLAVSCGDAMARWGFVSDSKL  495

Query  318  HLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            H++      +       +CLDV ++   ++TN C+CL+ D+SCDP  QWFK++ STR   
Sbjct  496  HVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSADNSCDPQGQWFKLVSSTRSVV  555

Query  159  TK  154
            TK
Sbjct  556  TK  557



>gb|ACF79301.1| unknown [Zea mays]
Length=576

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 155/242 (64%), Gaps = 15/242 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D RG N NDNRY+ C    AA+LD DWALW L GSYYLREG +GL+E YGVL 
Sbjct  316  ILSEFGVDNRGVNTNDNRYYGCAAAAAADLDLDWALWALQGSYYLREGVLGLDEVYGVLD  375

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR----VSLFQP--L  493
            W WC PRN + L+R+  +Q P RGPG  E+  + ++FHP++G+CV R     SL QP  L
Sbjct  376  WAWCRPRNDTALRRVQALQRPLRGPGLAEAAPYTVLFHPVSGMCVVRRSPTPSLTQPFQL  435

Query  492  ELGPCSESDPWGYTAGKALTV--EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRM  319
             LGPC+E++ W Y+A +           CL+AE  G+PA L + C D  ++W  +SDS++
Sbjct  436  SLGPCNETEAWEYSAQQQRLALRNAALLCLRAEGAGRPASLAVSCGDAMARWGFVSDSKL  495

Query  318  HLSSKLKDGSN------VCLDVDSN-NVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            H++      +       +CLDV ++   ++TN C+CL+ D+SCDP  QWFK++ STR   
Sbjct  496  HVAVNATSSAGSVGDGLLCLDVGADGRSVVTNPCRCLSADNSCDPQGQWFKLVSSTRSVV  555

Query  159  TK  154
            TK
Sbjct  556  TK  557



>ref|XP_002452393.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
 gb|EES05369.1| hypothetical protein SORBIDRAFT_04g024910 [Sorghum bicolor]
Length=570

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 141/247 (57%), Gaps = 25/247 (10%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +  DNRYF C   +AAE D DWA W L GSY LR+G VG++E YGVL 
Sbjct  314  FLSEFGADSRGGDRKDNRYFPCAAAVAAEHDVDWAYWALQGSYALRQGVVGMDEVYGVLD  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ---PLELG  484
            W+W +PRN + L RI  +Q P +GPGY E+  + ++FHP+TGLC  R +       LELG
Sbjct  374  WSWSKPRNQTVLPRIQALQRPLQGPGYGEALPYTVLFHPLTGLCAVRRASAAAATTLELG  433

Query  483  PCSESDPWGYTA--------GKALTVEGTYFCLQAEKLGKPAKLGL-FCTDDSSKWEIIS  331
            PC+E+D W Y            A    G   CL+AE  G+PA+LG   C D  S W + +
Sbjct  434  PCNETDAWAYAPPSSTLVLRDAAAAAGGLPTCLRAEGRGQPARLGTNACGDPLSTWRLAT  493

Query  330  DSRMHLS------------SKLKDGSNVCLDVDSNN-VIITNTCKCLNNDSSCDPASQWF  190
            DS MH++                    +CLDV ++   I+TN C C   D +CDP  QWF
Sbjct  494  DSAMHVAVDAAALGLGGGEDGGGGSGMLCLDVGTDGRSIVTNPCACQRGDGACDPEGQWF  553

Query  189  KIIDSTR  169
            K++ STR
Sbjct  554  KLVTSTR  560



>ref|XP_010549752.1| PREDICTED: uncharacterized protein LOC104820833 [Tarenaya hassleriana]
Length=531

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 143/224 (64%), Gaps = 11/224 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG +  G + + NRY NC LG AAE D DWA+W LAG YYLR+G  GL E YG+L 
Sbjct  313  FLSEFGTNQGGGDGDGNRYMNCMLGWAAEKDVDWAIWALAGDYYLRQGKRGLVETYGMLN  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQ--PLELGP  481
             NW    N +FL+RIS++Q P++GPG + ++ H  IFHP+TG CV R S  +   L LGP
Sbjct  373  PNWHHIHNSTFLRRISVIQPPYKGPGVSHNQ-HNRIFHPLTGFCVVRNSRKRRSELTLGP  431

Query  480  CSESDPWGYTAGKALTV---EGTYFCLQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHL  313
            C   +PW Y       V     +  CL+ +   G+  KLG  C    SK E +S S+MHL
Sbjct  432  CGRHEPWSYNGHIGTLVMKDHRSVLCLEGDVTGGRRVKLGKKC----SKIERVSASKMHL  487

Query  312  SSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKII  181
            S K + GS++CLDVDS N ++ N CKCL+ D+SCDP SQWFKI+
Sbjct  488  SFKTRLGSSLCLDVDSMNNVVANPCKCLSKDASCDPTSQWFKIL  531



>gb|EAY86525.1| hypothetical protein OsI_07905 [Oryza sativa Indica Group]
Length=582

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 148/251 (59%), Gaps = 29/251 (12%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +  D+RY  C   +AAELD DWALW L GSY LR+G  G +E YGVL 
Sbjct  313  FLSEFGADTRGGSRKDDRYLPCAAAVAAELDLDWALWALQGSYALRQGVAGADEVYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR------VSLFQPL  493
            W+W +PRN + L RI  +Q P RGPGY E+R + ++FHP+TG CV R       +    L
Sbjct  373  WSWSKPRNATALSRIQSLQRPLRGPGYDEARPYTVLFHPLTGRCVVRRAADDAAAAAATL  432

Query  492  ELGPCSESDPWGYT-AGKALTVEGT-----YFCLQAEKLGKPAKLGLF----CTDDS-SK  346
            ELG C ++D W YT     L + G        CL+AE  G+PA+L       C  D+ S 
Sbjct  433  ELGRCEDTDAWAYTQPASTLAMRGAGRGSPPLCLRAEGSGRPARLATSDAGGCRGDALST  492

Query  345  WEIISDSRMHLS---------SKLKDGSNVCLDV-DSNNVIITNTCKCLNNDSS--CDPA  202
            W ++S S MH++         S+   G  +CLDV D    ++TN C+CL++ ++  CDP 
Sbjct  493  WRLVSGSTMHVAVNATTTTTPSRDGGGGLLCLDVGDDGRSVVTNPCRCLDDAAAGECDPE  552

Query  201  SQWFKIIDSTR  169
            +QWFK++ STR
Sbjct  553  TQWFKLVTSTR  563



>ref|XP_008678768.1| PREDICTED: uncharacterized protein LOC100501654 isoform X2 [Zea 
mays]
 gb|AFW62834.1| hypothetical protein ZEAMMB73_750687 [Zea mays]
Length=548

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 145/242 (60%), Gaps = 20/242 (8%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +  DNR+F C   +AAE D DWA W L GSY LR+G  G++E YGVL 
Sbjct  297  FLSEFGADSRGGDPKDNRFFPCAAAVAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLD  356

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRR-VSLFQPLELGP  481
            W+W +PRN + L RI  +Q P +GPGY E+  + ++FHP+TGLC VRR  ++   LELGP
Sbjct  357  WSWSKPRNETVLPRIQALQRPLQGPGYGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGP  416

Query  480  CSESDPWGYTAGKALTV-----EGTYFCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRM  319
            C+E+D W Y    +  V          CL+AE  G+PA+LG+  C D  S W + +DS M
Sbjct  417  CNETDAWAYAPPSSTLVLRDAAAAGLPCLRAEGPGQPARLGIRDCGDPMSTWRLATDSGM  476

Query  318  HLS-----------SKLKDGSNVCLDVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDS  175
            H++                G  +CLDV ++   I+TN C C   D +CDP  QWFK++ S
Sbjct  477  HVAVDAALGLGGGEDGGGGGGMLCLDVGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTS  536

Query  174  TR  169
            TR
Sbjct  537  TR  538



>ref|XP_008678767.1| PREDICTED: uncharacterized protein LOC100501654 isoform X1 [Zea 
mays]
Length=564

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 145/242 (60%), Gaps = 20/242 (8%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +  DNR+F C   +AAE D DWA W L GSY LR+G  G++E YGVL 
Sbjct  313  FLSEFGADSRGGDPKDNRFFPCAAAVAAEHDVDWAYWALQGSYALRQGVAGMDEVYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRR-VSLFQPLELGP  481
            W+W +PRN + L RI  +Q P +GPGY E+  + ++FHP+TGLC VRR  ++   LELGP
Sbjct  373  WSWSKPRNETVLPRIQALQRPLQGPGYGEALPYTVLFHPLTGLCAVRRAAAVTTTLELGP  432

Query  480  CSESDPWGYTAGKALTV-----EGTYFCLQAEKLGKPAKLGLF-CTDDSSKWEIISDSRM  319
            C+E+D W Y    +  V          CL+AE  G+PA+LG+  C D  S W + +DS M
Sbjct  433  CNETDAWAYAPPSSTLVLRDAAAAGLPCLRAEGPGQPARLGIRDCGDPMSTWRLATDSGM  492

Query  318  HLS-----------SKLKDGSNVCLDVDSNN-VIITNTCKCLNNDSSCDPASQWFKIIDS  175
            H++                G  +CLDV ++   I+TN C C   D +CDP  QWFK++ S
Sbjct  493  HVAVDAALGLGGGEDGGGGGGMLCLDVGTDGRSIVTNPCACQRGDGTCDPEGQWFKLVTS  552

Query  174  TR  169
            TR
Sbjct  553  TR  554



>emb|CDY26627.1| BnaA09g46500D [Brassica napus]
Length=337

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 137/222 (62%), Gaps = 28/222 (13%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SE GID RG NVND+RYF C  G AA+ D DW+LW L G+YYLR G VGL E+YGVL 
Sbjct  123  FLSEIGIDERGGNVNDDRYFGCLTGWAAKNDVDWSLWALTGTYYLRLGVVGLNEYYGVLD  182

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   RN SFLQ+I ++QS  +GPG   +  + L+FHP+TGLC+             CS
Sbjct  183  SDWISVRNSSFLQKIYLLQSTLQGPG-PRTDAYNLVFHPLTGLCL------------VCS  229

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
              D    TA   L  +        +K+G P  LG    +  S+W+ IS SRMHL+     
Sbjct  230  LKD----TAMLTLVTD--------QKIGLPC-LGRVVRE--SRWQTISASRMHLALTTSK  274

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
             +++CLDVD+ N I+ N CKCL+ DSSC P SQWFKII++TR
Sbjct  275  NNSLCLDVDATNNILANPCKCLSKDSSCQPMSQWFKIINATR  316



>gb|KFK43579.1| hypothetical protein AALP_AA1G144700 [Arabis alpina]
Length=646

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 8/206 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N ND+ YF C  G AAE D DW+LW L GSYYLR+G VGL E+YG L 
Sbjct  292  FLSEFGIDERGQNANDDHYFGCLTGWAAENDVDWSLWALTGSYYLRQGVVGLNEYYGALD  351

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +W   RN SFLQ++ ++QS  +GPG      + L+ HP+TGLC VR ++    L LGPC
Sbjct  352  TDWNSVRNSSFLQKLYLLQSSLQGPG-PRIDAYNLVLHPLTGLCLVRSLNDKTMLTLGPC  410

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLF---CTDDSSKWEIISDSRMHLSS  307
            + S+PW YT  K L ++    CLQ+   G   ++ +    C+   SKWE IS SRMHL+S
Sbjct  411  NSSEPWSYTK-KTLKIKDQSLCLQSN--GPKNRITMTRTSCSRPDSKWETISASRMHLAS  467

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCL  229
               + +++CLDVD+ N ++ N CKCL
Sbjct  468  TTSNKTSLCLDVDATNNVVANACKCL  493



>ref|XP_006395580.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32866.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=534

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 142/227 (63%), Gaps = 7/227 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVNDNRY  C LG AAE D DW++W L GSYY+REG  G+ E+YG+L 
Sbjct  310  FLSEFGIDLRGGNVNDNRYIGCILGWAAENDVDWSIWALTGSYYIREGVAGMVEYYGMLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
             +    R++ FL R+S++Q+  +GP   + +++ L+FHP+TGLC V+  S    + LG C
Sbjct  370  SDGISIRSIGFLLRLSLIQTLLQGP-VPQPKVYNLVFHPLTGLCMVQTSSDPNKVTLGTC  428

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFC--TDDSSKWEIISDS-RMHLSS  307
            + S  W YT    L ++    CL+     +  KL      + + SKW+ IS S  M L+S
Sbjct  429  NTSPQWSYTLDNTLKIKDKSLCLENTGPNQRVKLSETSCWSPNLSKWQTISGSINMLLAS  488

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTR  169
            K  D S +CLDVD +  I+   CKC+   DSSCDP SQWFKI+  +R
Sbjct  489  KSSDNS-LCLDVDGHKNIVATNCKCVKGEDSSCDPTSQWFKIVKVSR  534



>emb|CBI16819.3| unnamed protein product [Vitis vinifera]
Length=310

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 99/120 (83%), Gaps = 3/120 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY NCF GLAAELDFDWALWTL GSYY REG +GLEEFYG+L 
Sbjct  185  FVSEFGVDQRGTNVNDNRYLNCFFGLAAELDFDWALWTLVGSYYTREGVIGLEEFYGLLN  244

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV---RRVSLFQPLELG  484
            WNWCE RN SFLQRIS +QSPF+GP  +++R HK+IFHP TGLC+   +R+S F+ +  G
Sbjct  245  WNWCEVRNSSFLQRISALQSPFQGPDLSDARPHKVIFHPATGLCIVWKKRISAFKQMGQG  304



>ref|XP_010662248.1| PREDICTED: thylakoid lumenal protein At1g12250, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=307

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 115/158 (73%), Gaps = 0/158 (0%)
 Frame = -2

Query  633  NLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGY  454
            N  +L++    ++   GP    +R +K++ HP TGLCV R SL +PL+LGPC+ES+ WGY
Sbjct  130  NGEYLEKAVAYKASLTGPDAPHARPYKMVLHPSTGLCVLRGSLSEPLKLGPCTESEAWGY  189

Query  453  TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLD  274
            T  K L ++GTY CLQA  LGKPAKL + C++  S WE ISDS+M+LS+KL +G+ VCLD
Sbjct  190  TPQKILIIKGTYLCLQAVGLGKPAKLSVICSNPGSNWESISDSKMYLSTKLGNGTTVCLD  249

Query  273  VDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            VDS++ I+TN+CKCL+ D  CDP SQWFKI +ST  T+
Sbjct  250  VDSSDDIVTNSCKCLSRDDMCDPGSQWFKIANSTDITS  287



>gb|KFK25904.1| hypothetical protein AALP_AA8G177600 [Arabis alpina]
Length=523

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 14/224 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG D  G +++ NRY NC +  AAE D DWA+W LAG YYLR G   + E YGVL 
Sbjct  308  ILSEFGTDESGADMSGNRYMNCLVAWAAENDLDWAVWALAGDYYLRTGDTNMVETYGVLD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGP  481
             NW + RN SFLQ++S +Q PFRGPG        L+FHP+TGLC+    S   P L LGP
Sbjct  368  ANWIDVRNTSFLQQLSGIQLPFRGPGLQS---KNLLFHPLTGLCISNNPSANSPTLRLGP  424

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEK-LGKPAKL--GLFCTDDSSKWEIISDSRMHLS  310
            C++S+P  Y   K   +     C++A   +G+  KL  G  C    SK   IS ++MHLS
Sbjct  425  CAKSEPSTYNP-KEGNLWINKMCVEAPNVVGQKVKLRVGTRC----SKLGQISATKMHLS  479

Query  309  SKLKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
             K  +G  +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  480  FKTSNGLLLCLDVDQRDNSIVANPCKCLTRDASCDPASQWFKVL  523



>gb|EMT10461.1| Endoglucanase E1 [Aegilops tauschii]
Length=498

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 134/218 (61%), Gaps = 16/218 (7%)
 Frame = -2

Query  714  GSYYLREGTVGLEEFYGVLTWNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPM  535
            GSYYLR+G + L+E YGVL   W  PRN + L+R+  +Q P RGPGY E+  + ++FHP 
Sbjct  284  GSYYLRQGVLDLDEVYGVLDRAWSRPRNDTALRRVQPLQRPLRGPGYAEAAPYTVLFHPA  343

Query  534  TGLCVRRVSLFQPLELGPCSESDPWGYTA--GKALTVEGTYFCLQAEKLGKPAKLGLFCT  361
            TGLCV R SL QPLELG C++++ W Y    G+    +    CL+A+  G+P +LG  C 
Sbjct  344  TGLCVLRRSLTQPLELGACADTEAWEYAPQQGRLALRDSPLMCLRAQGAGRPVRLGTPCD  403

Query  360  DDSSKWEIISDSRMHLSSKLKDGSN-------VCLDVDSN-NVIITNTCKCLNNDSSCDP  205
            DD S+W ++SDS++H++      S+       +CLDV ++   ++TN C+CL+ D+SCDP
Sbjct  404  DDMSRWRLVSDSKLHVAVNTSSSSSSGSGSGMLCLDVGADGQSVVTNPCRCLSADNSCDP  463

Query  204  ASQWFKIIDSTRGTTTKSDFQSTSFLYFLAKKLFASYI  91
             SQWFK++ STR         +   L  L  KL +S I
Sbjct  464  ESQWFKLVSSTRSVA------ANGMLAELPVKLGSSKI  495



>ref|XP_002272386.2| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera]
Length=536

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 137/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+D+RG N +DNRYFNC L   A+ D DWALWTL GSYY REG  G EE Y VL 
Sbjct  313  ILSEFGVDVRGVNQDDNRYFNCLLPTVADKDLDWALWTLQGSYYYREGKAGPEEVYSVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW +PR+  +L+R++I+Q   + P       + L+ HP +G CV  V     +    C 
Sbjct  373  YNWDKPRDPKYLERLTILQQTIQDPNSIALSYYVLV-HPESGFCV-NVEGQDNVHGSSCR  430

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            E   W ++  G  + + G+  CL+A   G P  L   C    + W+++SDS +H+++  +
Sbjct  431  ERSKWSHSGDGSPIQLVGSELCLKAVGDGVPVALSTDCKSPWATWKLVSDSMLHIAAMDE  490

Query  297  DGSNVCLDVDSNNV--IITNTCKCLNNDSSCDPASQWFKIIDS  175
             G+++CL+  S+N   I+T +C CLNN+++CDP SQWF+++ S
Sbjct  491  QGNSLCLESTSSNYSSILTRSCACLNNETNCDPQSQWFRLVPS  533



>emb|CBI34407.3| unnamed protein product [Vitis vinifera]
Length=477

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 133/223 (60%), Gaps = 5/223 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+DLRG N  DNRYFNC L   AE D DWALWTL  SYY REG  G EE Y VL 
Sbjct  254  IISEFGVDLRGVNQADNRYFNCLLPTVAEKDLDWALWTLQASYYYREGKAGPEEVYSVLD  313

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW +PR+  +L+R++I+Q   + P  T +  + LI H  +G CV  V     +    C 
Sbjct  314  YNWDKPRDPKYLERLTILQQTIQDPNST-TLSYYLIVHTESGFCV-NVEGEDNVHGSSCR  371

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            E   W +   G  + + G   CL+A   G P  L   C    + W+++SDSR+H+++  +
Sbjct  372  ERSKWSHGGDGWPIRLVGGELCLKAVGDGVPVTLSTDCKSPRATWKLVSDSRLHVAAMDE  431

Query  297  DGSNVCLDVDSNNV--IITNTCKCLNNDSSCDPASQWFKIIDS  175
             G+++CL+  S+N   I+T  C C+ N+++CDP SQWFK++ S
Sbjct  432  QGNSLCLEATSSNYSSILTRRCACVKNEANCDPQSQWFKLVPS  474



>ref|XP_002272534.1| PREDICTED: uncharacterized protein LOC100257079 [Vitis vinifera]
Length=545

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 134/232 (58%), Gaps = 12/232 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG N  DNR+F CFL   A+ D DWALWTL GSYY R+G VG EE YGVL 
Sbjct  313  FLSEFGIDLRGVNPRDNRFFGCFLAFVAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGP-C  478
            +NW +PRN  FL+RI I+Q   + P     + H LIFHP +G CV      Q    G  C
Sbjct  373  YNWDKPRNPKFLKRIRILQDILQDPNSNVPKYH-LIFHPRSGRCVSVKGEGQDQIHGRNC  431

Query  477  SESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
             +   W +   G A+ + G+  CL+A   G PAKL   C+   ++W++IS S++H+++  
Sbjct  432  KKGSRWSHDGNGGAIRLMGSGLCLKAVGDGLPAKLSTDCSSPQARWKLISKSKLHIAAMD  491

Query  300  KDGSNVCLDVDSNN--VIITNTCKCLNNDSS-------CDPASQWFKIIDST  172
            + G  +CLD  ++N   I+T TC C   D          +P  QWFK + S 
Sbjct  492  EQGKPLCLDGKNSNSSSILTRTCICALQDGDGSDLDCLTNPQRQWFKFVPSN  543



>emb|CBI34404.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 134/232 (58%), Gaps = 12/232 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG N  DNR+F CFL   A+ D DWALWTL GSYY R+G VG EE YGVL 
Sbjct  329  FLSEFGIDLRGVNPRDNRFFGCFLAFVAQRDLDWALWTLQGSYYYRDGVVGQEETYGVLD  388

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGP-C  478
            +NW +PRN  FL+RI I+Q   + P     + H LIFHP +G CV      Q    G  C
Sbjct  389  YNWDKPRNPKFLKRIRILQDILQDPNSNVPKYH-LIFHPRSGRCVSVKGEGQDQIHGRNC  447

Query  477  SESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
             +   W +   G A+ + G+  CL+A   G PAKL   C+   ++W++IS S++H+++  
Sbjct  448  KKGSRWSHDGNGGAIRLMGSGLCLKAVGDGLPAKLSTDCSSPQARWKLISKSKLHIAAMD  507

Query  300  KDGSNVCLDVDSNN--VIITNTCKCLNNDSS-------CDPASQWFKIIDST  172
            + G  +CLD  ++N   I+T TC C   D          +P  QWFK + S 
Sbjct  508  EQGKPLCLDGKNSNSSSILTRTCICALQDGDGSDLDCLTNPQRQWFKFVPSN  559



>ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera]
Length=530

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 133/223 (60%), Gaps = 5/223 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG+DLRG N  DNRYFNC L   AE D DWALWTL  SYY REG  G EE Y VL 
Sbjct  307  IISEFGVDLRGVNQADNRYFNCLLPTVAEKDLDWALWTLQASYYYREGKAGPEEVYSVLD  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW +PR+  +L+R++I+Q   + P  T +  + LI H  +G CV  V     +    C 
Sbjct  367  YNWDKPRDPKYLERLTILQQTIQDPNST-TLSYYLIVHTESGFCV-NVEGEDNVHGSSCR  424

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
            E   W +   G  + + G   CL+A   G P  L   C    + W+++SDSR+H+++  +
Sbjct  425  ERSKWSHGGDGWPIRLVGGELCLKAVGDGVPVTLSTDCKSPRATWKLVSDSRLHVAAMDE  484

Query  297  DGSNVCLDVDSNNV--IITNTCKCLNNDSSCDPASQWFKIIDS  175
             G+++CL+  S+N   I+T  C C+ N+++CDP SQWFK++ S
Sbjct  485  QGNSLCLEATSSNYSSILTRRCACVKNEANCDPQSQWFKLVPS  527



>ref|XP_010514260.1| PREDICTED: uncharacterized protein LOC104790246 [Camelina sativa]
Length=511

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 125/181 (69%), Gaps = 6/181 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVNDNRY  C LG AAE D DW++WTL GSYYLREG VG+ E+YGVL 
Sbjct  333  FLSEFGIDLRGKNVNDNRYIGCILGWAAENDVDWSIWTLQGSYYLREGVVGMSEYYGVLD  392

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP--LELGP  481
             +W   R+ SFLQR+S++QSP +GPG ++ +++ L+FHP+TGLC+ + S+  P  + LG 
Sbjct  393  SDWDRVRSRSFLQRLSLIQSPLQGPG-SQPKVYNLVFHPLTGLCMLQ-SILDPTKVTLGL  450

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKL-GLFCTDDS-SKWEIISDSRMHLSS  307
            C+ES PW YT    L ++    CL++     P KL  + C+  + SKW+  S S M L++
Sbjct  451  CNESQPWSYTPDNTLRLKDKSLCLESTGSNAPVKLSNMSCSSPNLSKWQTTSASNMLLAA  510

Query  306  K  304
            K
Sbjct  511  K  511



>emb|CDY38093.1| BnaC02g06800D [Brassica napus]
Length=415

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 129/221 (58%), Gaps = 8/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG D RG +V+ NRY NC +  AAE D DWA+W L G YYLR GT  + E YGVL 
Sbjct  200  ILSEFGTDERGVDVSGNRYMNCLVAWAAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLD  259

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV--RRVSLFQPLELGP  481
              W   RN ++LQ++S +Q PFRGPG  E    KLI HP TGLCV          L L  
Sbjct  260  ATWKNVRNSTYLQKLSGIQHPFRGPGLQEK---KLILHPHTGLCVTNNHSGNVPTLRLEL  316

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            C++S+P  +   + +           +  G+  KLG+      SK   IS ++MHLS K 
Sbjct  317  CTKSEPSTFDPKEGILWINKMCVETPDVAGQKVKLGV--GTKCSKLGQISATKMHLSFKT  374

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
             +G  +CLDVD  +N I+ N CKCL  D+SCDPA+QWFK++
Sbjct  375  SNGLLLCLDVDERDNSIVANPCKCLTKDASCDPANQWFKVL  415



>emb|CDX89335.1| BnaA01g15580D [Brassica napus]
Length=523

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 129/221 (58%), Gaps = 8/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG D RG +V+ NRY NC +  AAE D DWA+W L G YYLR GT  + E YGVL 
Sbjct  308  ILSEFGTDERGVDVSGNRYMNCLVAWAAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV--RRVSLFQPLELGP  481
              W   RN ++LQ++S +Q PFRGPG  E    KL+ HP TGLCV          L L  
Sbjct  368  ATWKNVRNSTYLQKLSGIQHPFRGPGLQEK---KLVLHPHTGLCVTTNHSGNVPTLRLEL  424

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            C++S+   +   + +           +  G+  KLG+      SK   IS ++MHLS K 
Sbjct  425  CTQSESSTFNPKEGILWVNKMCVETPDVAGQKVKLGV--GSKCSKLGQISATKMHLSFKT  482

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
             +G  +CLDVD  +N+I+ N CKCL  D+SCDPASQWFK++
Sbjct  483  SNGLLLCLDVDERDNIIVANPCKCLTKDASCDPASQWFKVL  523



>ref|XP_010266913.1| PREDICTED: plastocyanin, chloroplastic-like [Nelumbo nucifera]
Length=290

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -2

Query  579  GYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAE  400
            G    R + +IFHP TGLCV R SL +PL+LG C+ES+PW Y+  + L ++GTYFC+QA+
Sbjct  117  GRPRGRPYNMIFHPPTGLCVLRKSLTEPLQLGSCAESEPWKYSPQQILFLKGTYFCMQAD  176

Query  399  KLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNND  220
             LGKPAKLG+ CTD  S W++ISD  MHLSS L DG+ VCLDVDSNN I+TN+CK  + D
Sbjct  177  GLGKPAKLGIMCTDPGSNWDVISDGNMHLSSNLVDGTAVCLDVDSNNNIVTNSCKYSSED  236

Query  219  SSCDPASQWFKIIDSTR  169
             + D ASQWF+I+ +++
Sbjct  237  HTPDSASQWFEIVRNSK  253



>emb|CDY38091.1| BnaC02g06820D [Brassica napus]
Length=523

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 128/221 (58%), Gaps = 8/221 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG D RG +V+ NRY NC +  AAE D DWA+W L G YYLR GT  + E YGVL 
Sbjct  308  ILSEFGTDERGVDVSGNRYMNCLVAWAAEKDLDWAVWALTGDYYLRTGTKHMVETYGVLD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV--RRVSLFQPLELGP  481
              W   RN ++LQ++S +Q PFRGPG  E    KLI HP TGLCV          L L  
Sbjct  368  ATWKNVRNSTYLQKLSGIQHPFRGPGLQEK---KLILHPHTGLCVTNNHSGNVPTLRLEL  424

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            C++S+   +   + +           +  G+  KLG+      SK   IS ++MHLS K 
Sbjct  425  CTQSESSTFNPKEGILWVNKMCVETPDVAGQKVKLGV--GSKCSKLGPISATKMHLSFKT  482

Query  300  KDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
             +G  +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  483  SNGLLLCLDVDERDNSIVANPCKCLTKDASCDPASQWFKVL  523



>ref|XP_006378255.1| hypothetical protein POPTR_0010s05970g [Populus trichocarpa]
 gb|ERP56052.1| hypothetical protein POPTR_0010s05970g [Populus trichocarpa]
Length=120

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -2

Query  507  LFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISD  328
            +  PL LG C+ES+ W YT  K L+V+GTYFCLQ +   KPAKLG+ CTD +SKWE ISD
Sbjct  1    MLAPLRLGRCTESEAWSYTPQKILSVKGTYFCLQTDDAAKPAKLGIICTDSNSKWETISD  60

Query  327  SRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQWFKIIDSTRGTT  160
            S+MHLSS    G  VCLD+DSNN I+TNTCKCL+ D++CDP SQWFK+++STR +T
Sbjct  61   SKMHLSSNASSGITVCLDIDSNNTIVTNTCKCLSKDNACDPESQWFKLVNSTRSST  116



>ref|XP_009121460.1| PREDICTED: uncharacterized protein LOC103846306 [Brassica rapa]
Length=524

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/222 (44%), Positives = 135/222 (61%), Gaps = 10/222 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F++EFG +LR  +V+ NRY NC +  AAE D DWA+W L G YYLR G   + E +GVL 
Sbjct  309  FLTEFGANLRSGDVSGNRYMNCLVAWAAENDLDWAVWALTGDYYLRTGQKHMVETFGVLA  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGP  481
             NW +  N ++LQ++S +Q P RGPG       KL+FHP TGLCV   +S   P L L  
Sbjct  369  PNWKDVANSTYLQKLSGIQLPVRGPGLQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQ  425

Query  480  CSESDPWGYTAGKALTVEGTYFCLQA-EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C +++P  +   + + +     C++A + +G+  KLG       SK    S + MHLS K
Sbjct  426  CRKAEPSTFNPSEGI-LWSNKMCVEAPDAVGQKVKLG--AGTKCSKLGQTSATHMHLSFK  482

Query  303  LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
              +GS +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  483  TNNGSLICLDVDELDNSIVANPCKCLTMDASCDPASQWFKVL  524



>emb|CDX69429.1| BnaA10g17780D [Brassica napus]
Length=524

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/222 (44%), Positives = 135/222 (61%), Gaps = 10/222 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F++EFG +LR  +V+ NRY NC +  AAE D DWA+W L G YYLR G   + E +GVL 
Sbjct  309  FLTEFGANLRSGDVSGNRYMNCLVAWAAENDLDWAVWALTGDYYLRTGQKHMVETFGVLA  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGP  481
             NW +  N ++LQ++S +Q P RGPG       KL+FHP TGLCV   +S   P L L  
Sbjct  369  PNWKDVANSTYLQKLSGIQLPVRGPGLQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQ  425

Query  480  CSESDPWGYTAGKALTVEGTYFCLQA-EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C +++P  +   + + +     C++A + +G+  KLG       SK    S + MHLS K
Sbjct  426  CRKAEPSTFNPSEGI-LWSNKMCVEAPDAVGQKVKLG--AGTKCSKLGQTSATHMHLSFK  482

Query  303  LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
              +GS +CLDVD  +N I+ N CKCL  D+SCDPA+QWFK++
Sbjct  483  TNNGSLICLDVDERDNSIVANPCKCLTMDASCDPATQWFKVL  524



>gb|KGN50360.1| hypothetical protein Csa_5G168960 [Cucumis sativus]
Length=343

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 130/225 (58%), Gaps = 8/225 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RG N  D+R+ +CF     E D DWALW   GSYY R+G VG EE +GVL 
Sbjct  115  FVSEFGLDQRGVNEADDRFLSCFSAHLVEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLN  174

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPC  478
            +NW + RN  F Q   ++Q+  + P    S  + +++HP +G CV    +    + L  C
Sbjct  175  YNWSDVRNPHFSQMFQLLQTMLQDPNSNSSNTY-VMYHPQSGQCVLVQDMKHMQIYLNDC  233

Query  477  SESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            S +  W Y   G  + +  T FCL+A   G P  L   C  + S W  ISDS++HL++  
Sbjct  234  SNASHWSYEGDGTPIMLASTNFCLKASGDGLPPSLSRDCFGEQSVWTAISDSKLHLATLT  293

Query  300  KDGSN-VCLDVDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
            K G+N +CL+ +S+N   I+  +C C+ NDS+C  D  +QWF+++
Sbjct  294  KQGNNGMCLEKESSNSSRILMRSCVCVGNDSNCLQDTQAQWFQLV  338



>ref|XP_010437042.1| PREDICTED: uncharacterized protein LOC104720845 isoform X1 [Camelina 
sativa]
 ref|XP_010437060.1| PREDICTED: uncharacterized protein LOC104720858 isoform X1 [Camelina 
sativa]
Length=523

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 133/222 (60%), Gaps = 10/222 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             ++EFG +  G +++ NRY NC +  AA+ D DWA+W L G YYLR G   + E +G+L 
Sbjct  308  MLTEFGTEESGRDISGNRYMNCLVAWAAQNDLDWAVWALTGDYYLRTGKTDMVETFGILD  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR--VSLFQPLELGP  481
             NW + RN ++LQ++S +Q PF+GPG         IFHP++GLCV          L LGP
Sbjct  368  ANWKDVRNATYLQQLSGIQYPFKGPGLQSK---NAIFHPLSGLCVTHNPSDKLPTLRLGP  424

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C ++D   +   + + +     C++A  + G+  KLG+      SK   I+ ++MHL+ K
Sbjct  425  CPKADTSTFNPNEGI-LWINKMCVEAPNVAGQKVKLGV--GTKCSKLGQIAATKMHLAFK  481

Query  303  LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
              +G  +CLDVD  +N ++ N CKCL  D+SCDPASQWFK++
Sbjct  482  TSNGLLLCLDVDERDNSVVANPCKCLTKDASCDPASQWFKVL  523



>ref|XP_010492588.1| PREDICTED: uncharacterized protein LOC104769956 isoform X1 [Camelina 
sativa]
Length=523

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/222 (41%), Positives = 133/222 (60%), Gaps = 10/222 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG D  G +++ NRY NC +  AA+ D DWA+W L G YYLR G   + E YG+L 
Sbjct  308  ILSEFGTDEGGGDISGNRYMNCLVAWAAQNDLDWAVWALTGDYYLRSGKTDMAETYGILN  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGP  481
             NW + RN ++LQ++S +Q PFRGPG    +   ++FHP +GLCV    S   P L LGP
Sbjct  368  PNWKDVRNATYLQKLSGIQQPFRGPGL---QTKNVLFHPSSGLCVTNNPSDRSPTLRLGP  424

Query  480  CSESDPWGYTAGKALTVEGTYFCLQAEKL-GKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C ++D   +   + + +     C++     G+  +LG+    + SK   I+ ++MH S K
Sbjct  425  CPKADTSAFNINEGI-LWVNKMCVKIPSFAGQKVELGV--GTNCSKLGQIAATKMHWSFK  481

Query  303  LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
              +G  +CLDVD  +N ++ N CKCL  D SCDPASQWFK++
Sbjct  482  TSNGLLLCLDVDERDNSVVVNPCKCLTKDGSCDPASQWFKVL  523



>emb|CDX69431.1| BnaA10g17800D [Brassica napus]
Length=418

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 11/223 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F++EFG +LR  +V+ NRY NC +  AAE D DWA+W L G YYLR G   + E +GVL 
Sbjct  202  FLTEFGANLRSGDVSGNRYMNCLVAWAAENDLDWAVWALTGDYYLRTGQKHMVETFGVLA  261

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGP  481
             NW +  N ++LQ++S +Q P RGPG       KL+FHP +GLCV   +S   P L L  
Sbjct  262  PNWKDVANSTYLQKLSGIQLPVRGPGLQSK---KLLFHPTSGLCVTSNLSNNSPTLRLEQ  318

Query  480  CSESDPWGYTAGKALTVEGTYFCLQA-EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C +++P  +   +   +     C++A + +G+  KLG+      SK    S + MHLS K
Sbjct  319  CRKAEPSTFNPSEGF-LWSNKLCVEAPDAVGQKVKLGV--GTKCSKLGQTSATHMHLSFK  375

Query  303  -LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
               +GS +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  376  TTSNGSLLCLDVDERDNSIVANPCKCLTMDASCDPASQWFKVL  418



>gb|ABR17494.1| unknown [Picea sitchensis]
Length=543

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/231 (42%), Positives = 137/231 (59%), Gaps = 11/231 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG+NV DNR+ NCFL  AAE DFDWALWTL GSYYLR G  G EE YG+  
Sbjct  310  FISEFGIDERGSNVGDNRFINCFLAFAAEGDFDWALWTLQGSYYLRNGQPGFEETYGIFN  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
              W + R+  F+ R+  +Q PF+    +   L+K ++HP TGLC+   S    L+L  C 
Sbjct  370  GRWDDLRDPPFVSRLKSLQKPFQESFSSSEPLYKTLYHPATGLCL-ATSGEGGLKLDSCD  428

Query  474  ESDPWGYTAGK-ALTV-EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
                + Y + + A T+ + +  C+ A+  G  A+L   C   +SKW+ +S S + +S  L
Sbjct  429  SPTLFEYKSPQGAFTLSDESSTCIAAKGPGLAAELSTQCAASNSKWQRVSSSNLQVSVTL  488

Query  300  K-DGSN--VCLDVDSNNVIITNTCKCLNNDSSC----DPASQWFKIIDSTR  169
              +G++  +CLD  S+  ++TN C CL  DS C    +P  QWFK+I + R
Sbjct  489  SVNGTSQMLCLDGKSSPQVLTNDCICL-KDSDCRKDENPEMQWFKLITTNR  538



>ref|XP_004143723.1| PREDICTED: uncharacterized protein LOC101213113 [Cucumis sativus]
Length=539

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 130/225 (58%), Gaps = 8/225 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RG N  D+R+ +CF     E D DWALW   GSYY R+G VG EE +GVL 
Sbjct  311  FVSEFGLDQRGVNEADDRFLSCFSAHLVEKDLDWALWGWQGSYYYRQGKVGPEEVFGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSL-FQPLELGPC  478
            +NW + RN  F Q   ++Q+  + P    S  + +++HP +G CV    +    + L  C
Sbjct  371  YNWSDVRNPHFSQMFQLLQTMLQDPNSNSSNTY-VMYHPQSGQCVLVQDMKHMQIYLNDC  429

Query  477  SESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            S +  W Y   G  + +  T FCL+A   G P  L   C  + S W  ISDS++HL++  
Sbjct  430  SNASHWSYEGDGTPIMLASTNFCLKASGDGLPPSLSRDCFGEQSVWTAISDSKLHLATLT  489

Query  300  KDGSN-VCLDVDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
            K G+N +CL+ +S+N   I+  +C C+ NDS+C  D  +QWF+++
Sbjct  490  KQGNNGMCLEKESSNSSRILMRSCVCVGNDSNCLQDTQAQWFQLV  534



>emb|CDY16991.1| BnaC09g41180D [Brassica napus]
Length=495

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 135/223 (61%), Gaps = 11/223 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F++EFG +LR  +V+ NRY NC +  AAE D DWA+W L G YYLR G   + E +GVL 
Sbjct  279  FLTEFGANLRSGDVSGNRYMNCLVAWAAENDLDWAVWALTGDYYLRTGQKHMVETFGVLA  338

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCV-RRVSLFQP-LELGP  481
             NW +  N ++LQ++S +Q P  GPG       KL+FHP TGLCV   +S   P L L  
Sbjct  339  PNWKDVANSTYLQKLSGIQLPVTGPGLQSK---KLLFHPTTGLCVTSNLSNNSPTLRLEQ  395

Query  480  CSESDPWGYTAGKALTVEGTYFCLQA-EKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
            C +++P  +   + + +     C++A + +G+  KLG+      SK    S + MHLS K
Sbjct  396  CRKAEPSTFNPSEGI-LWSNKMCVEAPDAVGQKVKLGV--GTKCSKLGQTSATHMHLSFK  452

Query  303  -LKDGSNVCLDVDS-NNVIITNTCKCLNNDSSCDPASQWFKII  181
               +GS +CLDVD  +N I+ N CKCL  D+SCDPASQWFK++
Sbjct  453  TTSNGSLLCLDVDERDNSIVANPCKCLTMDASCDPASQWFKVL  495



>ref|XP_006395579.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
 gb|ESQ32865.1| hypothetical protein EUTSA_v10003968mg [Eutrema salsugineum]
Length=507

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 125/227 (55%), Gaps = 34/227 (15%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGIDLRG NVNDNRY  C LG AAE D DW++W L GSYY+REG  G+ E+YG   
Sbjct  310  FLSEFGIDLRGGNVNDNRYIGCILGWAAENDVDWSIWALTGSYYIREGVAGMVEYYG---  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLC-VRRVSLFQPLELGPC  478
                                P   P     +++ L+FHP+TGLC V+  S    + LG C
Sbjct  367  --------------------PVPQP-----KVYNLVFHPLTGLCMVQTSSDPNKVTLGTC  401

Query  477  SESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFC--TDDSSKWEIISDS-RMHLSS  307
            + S  W YT    L ++    CL+     +  KL      + + SKW+ IS S  M L+S
Sbjct  402  NTSPQWSYTLDNTLKIKDKSLCLENTGPNQRVKLSETSCWSPNLSKWQTISGSINMLLAS  461

Query  306  KLKDGSNVCLDVDSNNVIITNTCKCLN-NDSSCDPASQWFKIIDSTR  169
            K  D S +CLDVD +  I+   CKC+   DSSCDP SQWFKI+  +R
Sbjct  462  KSSDNS-LCLDVDGHKNIVATNCKCVKGEDSSCDPTSQWFKIVKVSR  507



>ref|XP_003608279.1| Endoglucanase [Medicago truncatula]
 gb|ABD32354.1| Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago 
truncatula]
 gb|AES90476.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=536

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 129/226 (57%), Gaps = 6/226 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D+ G N  DN++  CF+  AA +D DW+LW+  GSYY REG+VG  E Y V+ 
Sbjct  310  FISEFGYDMTGGNAVDNKFMPCFVSYAASVDLDWSLWSFGGSYYFREGSVGAGETYAVMD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            ++W   R+  F Q+  ++Q   + P    S+ H ++FHP+TG C         L LG C 
Sbjct  370  YDWKNYRDPKFPQKFQLLQKKIQDPTSNLSKSH-IMFHPLTGKCAHANGSNNELVLGDCK  428

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W +   G  + +  +  CL+AE  G PA L   C    S W+ +S + +HL++   
Sbjct  429  SHSEWSFEGDGSPIRLMDSAMCLKAEGEGLPATLSEHCLSPQSSWKSVSKTGLHLATSHG  488

Query  297  DGSNVCLDVDSNNV-IITNTCKCLN-NDSSC--DPASQWFKIIDST  172
            +G   CL+++S++  I+T  C C++ NDSSC  +P SQWF++I + 
Sbjct  489  NGPLFCLEMESDSSKIVTRKCICIDENDSSCLDNPQSQWFQLISTN  534



>ref|XP_008467306.1| PREDICTED: uncharacterized protein LOC103504686 [Cucumis melo]
Length=539

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 131/225 (58%), Gaps = 8/225 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D  G N  D+R+ +CF     E D DWALW   GSYY R+G V LEE +GVL 
Sbjct  311  FVSEFGLDQTGVNEADDRFLSCFSAHLVEKDLDWALWGWQGSYYYRQGKVELEEVFGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQP-LELGPC  478
            +NW + RN  F Q   ++Q+  + P    S  + L++HP +G CV+   + Q  + L  C
Sbjct  371  YNWSDVRNPRFSQMFQLLQTMLQDPNSNSSNTY-LMYHPQSGQCVQVHDMKQKEIFLNNC  429

Query  477  SESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
            S +  W Y   G  + +  T FCL+A   G P  L   C  + S W  ISDS++HL++  
Sbjct  430  SNASHWSYEGDGTPIMLASTNFCLKANGNGLPPSLSRDCFGEQSVWTAISDSKLHLATLT  489

Query  300  KDGSN-VCLDVDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
            K G+N +CL+ +S+N   I+  +C C+ +DS+C  D  +QWF+++
Sbjct  490  KQGNNGMCLEKESSNSSRILMRSCVCVGSDSNCLQDTQAQWFQLV  534



>gb|KEH20758.1| cellulase (glycosyl hydrolase family 5), putative [Medicago truncatula]
Length=154

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = -2

Query  591  FRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFC  412
            F GPG T    HKL+FHP TGLCV R SL +PL+L PCS SD W YT  K L+V+GTYFC
Sbjct  35   FTGPGITVGNPHKLLFHPSTGLCVIRKSLLEPLKLDPCSLSDGWNYTPQKILSVKGTYFC  94

Query  411  LQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGS-NVCLDVDSNNVIITNTCK  235
            +QA K G PA L + C++ +SKW++ISDS++HLSSK+  GS NVCLDV+ NN+I+TN CK
Sbjct  95   IQAVKEGMPATLSILCSNPNSKWDMISDSKLHLSSKINSGSTNVCLDVNDNNIIVTNACK  154



>ref|XP_011080895.1| PREDICTED: uncharacterized protein LOC105164045 [Sesamum indicum]
Length=535

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 129/226 (57%), Gaps = 11/226 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N  DNRY +C L + AE D DWALWT  GSY LREGTV LEE YGV  
Sbjct  309  FLSEFGIDQRGANEADNRYISCLLAVVAETDIDWALWTFQGSYMLREGTVNLEEVYGVND  368

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW  PRN +FL R+ +++   + P  T    + ++FHP +G CVR       + L  C 
Sbjct  369  LNWDRPRNPAFLDRLQLIRQLNQEP-KTNRPTYYIMFHPQSGQCVRIGK--TNIVLANCK  425

Query  474  ESDPWG-YTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W  +  G  + V G+  CL     GK A +   C+ + SKW+ +S S +HL ++  
Sbjct  426  TASHWDQHQDGGTIKVAGSPQCLGVAGDGKVAGVSDDCSSNGSKWKHVSSSGLHLGAQDG  485

Query  297  DGSNVCLDVD-SNNVIITNTCKCLNND----SSCD--PASQWFKII  181
            +G  +CL+   SN+ ++T  C C+ ++     +CD  P  QWFK++
Sbjct  486  EGKYLCLERSASNSTLVTKKCLCVGDNLVDFPTCDDNPEVQWFKLV  531



>ref|XP_010053198.1| PREDICTED: uncharacterized protein LOC104441706 [Eucalyptus grandis]
 gb|KCW77462.1| hypothetical protein EUGRSUZ_D01800 [Eucalyptus grandis]
Length=538

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 131/223 (59%), Gaps = 7/223 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+ EFG D  G +  D+R+ +CF+G AA  D DWALW L GSYY R+G VG EE +GVL 
Sbjct  314  FLGEFGFDQTGKSQADDRFLSCFMGYAAGKDLDWALWALQGSYYYRQGVVGPEETFGVLD  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW   RN  F +R  ++Q+  + P  + S +  +++HP +GLC+R  +  + +    C 
Sbjct  374  FNWDGLRNPKFKERFQLVQTMVQDPS-SNSPMSYIMYHPQSGLCIRANNNHE-IGTAECQ  431

Query  474  ESDPW-GYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W  Y  G  + + GT  CL+A   G P  L   C++  S W  IS+S++H+++  +
Sbjct  432  HWSRWIHYRDGSPIRLMGTPLCLKALGDGLPPVLSNDCSNRRSAWRSISNSKLHVAATDE  491

Query  297  DGSNVCLDVDSN--NVIITNTCKCLNNDSSC--DPASQWFKII  181
             G+ +CL+  SN  +VI+T  C C+++DS C  +P  QWFK +
Sbjct  492  HGNRLCLEKKSNESSVILTRKCICVDDDSGCTENPQGQWFKFV  534



>ref|XP_002272491.1| PREDICTED: uncharacterized protein LOC100262188 [Vitis vinifera]
Length=541

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 132/227 (58%), Gaps = 9/227 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+DLR  NV DNRYFNC+L   A  D DWALWTL  SYY R+G++ LEE Y VL 
Sbjct  314  FISEFGMDLRMGNVVDNRYFNCYLPTVAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLD  373

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW +PRN  FL++++I+Q   + P  +E+  + +I H  +GLCV  V   + +    C 
Sbjct  374  FNWEKPRNPQFLEKLTILQEMLQDPN-SEASPYYVIVHAKSGLCV-NVDGEKKVHGSGCR  431

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W ++  G  + + G+  CL+A   G+P K+   C    S+W  +S  ++HL+ + +
Sbjct  432  HRTKWTHSGDGWPIELMGSNLCLKAVGDGRPVKVSTDCRSQQSRWRRVSKEKLHLAVRDE  491

Query  297  DG--SNVCLDVDSNN--VIITNTCKCLNNDSSC--DPASQWFKIIDS  175
                 ++CLD  S++   I+T  C C   D +C  +  S WF+++ S
Sbjct  492  HDHTESLCLDASSSDPSSIVTRKCACKEGDLNCHHEEQSNWFQLVPS  538



>ref|XP_008810943.1| PREDICTED: uncharacterized protein LOC103722247 [Phoenix dactylifera]
Length=554

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 127/234 (54%), Gaps = 14/234 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTN  DNR+ +CFLG AAE D DWALW L GSYYLR G  G  E YGVL 
Sbjct  320  FVSEFGVDQRGTNRADNRFLSCFLGYAAERDLDWALWALQGSYYLRNGIPGFNETYGVLD  379

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYT-----ESRL----HKLIFHPMTGLCVRRVSLF  502
             NW  P+N  F ++  ++Q   +    T     + RL    +++I+HP +G CV  V   
Sbjct  380  ANWDRPKNPRFREKFRLIQDTLQDKYPTKYSNPDPRLSVAAYQIIYHPHSGQCV-SVDDS  438

Query  501  QPLELGPCSESDPWGYTAGK-ALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDS  325
              + L  C +   W Y   + A+ + G+  CL+ E  G P  L   C D+ S W  +S S
Sbjct  439  SNVVLSDCKKRKRWSYNGNRTAVWLMGSAQCLRVEGEGLPVLLSAECDDNRSVWGPVSSS  498

Query  324  RMHLSSKLKDGSNVCLDVDS--NNVIITNTCKCLNN-DSSCDPASQWFKIIDST  172
               +S     G ++CL+ +S  +N I T  C CL+N   S +P +QWF  I S 
Sbjct  499  WFQISGMDAQGRHLCLERNSSNSNSIFTKKCLCLDNLGCSKNPQTQWFHFIPSN  552



>emb|CBI34405.3| unnamed protein product [Vitis vinifera]
Length=970

 Score =   161 bits (408),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 132/227 (58%), Gaps = 9/227 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG+DLR  NV DNRYFNC+L   A  D DWALWTL  SYY R+G++ LEE Y VL 
Sbjct  743  FISEFGMDLRMGNVVDNRYFNCYLPTVAAKDLDWALWTLQASYYYRQGSLFLEEVYSVLD  802

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW +PRN  FL++++I+Q   + P  +E+  + +I H  +GLCV  V   + +    C 
Sbjct  803  FNWEKPRNPQFLEKLTILQEMLQDPN-SEASPYYVIVHAKSGLCV-NVDGEKKVHGSGCR  860

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W ++  G  + + G+  CL+A   G+P K+   C    S+W  +S  ++HL+ + +
Sbjct  861  HRTKWTHSGDGWPIELMGSNLCLKAVGDGRPVKVSTDCRSQQSRWRRVSKEKLHLAVRDE  920

Query  297  DG--SNVCLDVDSNN--VIITNTCKCLNNDSSC--DPASQWFKIIDS  175
                 ++CLD  S++   I+T  C C   D +C  +  S WF+++ S
Sbjct  921  HDHTESLCLDASSSDPSSIVTRKCACKEGDLNCHHEEQSNWFQLVPS  967


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SE+GI+L+ T+  D+RYF CFL   AE D DWALWTL  SY+ R+G  G  E Y VL 
Sbjct  310  FISEYGINLQETSQVDSRYFTCFLPTVAEKDLDWALWTLQASYHYRQGHAGGGESYSVLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRL  559
            ++W +PR   FL+R+ I+Q+  +  G  + ++
Sbjct  370  YSWSKPRYPQFLERMVILQNLLQESGGKKKKI  401



>ref|XP_008445780.1| PREDICTED: uncharacterized protein LOC103488703 [Cucumis melo]
Length=448

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/225 (36%), Positives = 130/225 (58%), Gaps = 6/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G D R  +  +NR+ +CF    A+ D DWALWT  GSYY REG   L E +GVL 
Sbjct  222  FVSEYGYDQREVDDAENRFMSCFTAHLAQKDLDWALWTWQGSYYYREGQAELPETFGVLE  281

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + +N +F+Q+  ++Q+  + P  + +    +I+HP +G C+   +  + + L  CS
Sbjct  282  SNWTQIKNPNFVQKFQLLQTMLQDPN-SNASFSYVIYHPQSGQCIEVSNDNKDIFLTNCS  340

Query  474  ESDPWGY-TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S  W +      + +  T  CL+A   G  A L   C    S W  IS+S++HL++  +
Sbjct  341  TSSRWSHDNDSTPIKMSNTGLCLKASGEGLAASLSNDCLGKQSVWSAISNSKLHLATVTE  400

Query  297  DGSNVCLDVDSNNV--IITNTCKCLNNDSSC--DPASQWFKIIDS  175
            +G ++CL ++S+N   I+TN+C C  +D +C  D  SQWF+++++
Sbjct  401  NGKSLCLQIESSNSSKIVTNSCICTTDDPTCLQDTQSQWFELVET  445



>ref|XP_006439449.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
 gb|ESR52689.1| hypothetical protein CICLE_v10023534mg [Citrus clementina]
Length=538

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 123/227 (54%), Gaps = 14/227 (6%)
 Frame = -2

Query  831  VSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTW  652
            +SEFG D R  N+ DN Y  C +  AAE D DWALW L GSYYLR G  G EE +G L  
Sbjct  308  LSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDS  367

Query  651  NWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVR---RVSLFQPLELGP  481
             W  PRN +FL+R+  +Q+    P  + +R   +IFHP++G CV    R  L+     GP
Sbjct  368  TWQRPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYAS-NRGP  426

Query  480  CSESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSK  304
             S    W Y   G  + +     CL+    G P  L   C  + S W ++S S++HL++K
Sbjct  427  FSR---WSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATK  483

Query  303  LKD--GSNVCLDVDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
              +  G  +CL V   N   ++T  C C+ +DSSC  +P SQWFK++
Sbjct  484  DDEHGGELLCLQVSPTNSSQVVTTKCICVGDDSSCLQNPQSQWFKLV  530



>ref|XP_010916958.1| PREDICTED: uncharacterized protein LOC105041671 [Elaeis guineensis]
Length=485

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 126/225 (56%), Gaps = 6/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTN  DNR+ +CFLG AAE D DWALW L GSYY+R+G  G +E YGVL 
Sbjct  261  FVSEFGVDQRGTNRADNRFLSCFLGYAAERDLDWALWALQGSYYMRDGIPGSKETYGVLD  320

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + +N  F ++  ++Q   + P  + +  +++I+HP +G CV  V     + L  C 
Sbjct  321  SNWDQAKNPRFQEKFRLIQEMLQEP-RSSTATNQIIYHPHSGQCV-SVDDDNNVVLSDCK  378

Query  474  ESDPWGYTAGK-ALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W Y   + A+ + G+  CL+ E  G    L   C D+ S W  +S S   +S    
Sbjct  379  NRKWWSYDGNRTAIWLAGSTHCLRVEGEGLSVLLSAECNDNQSFWGPVSSSWFQISGMDA  438

Query  297  DGSNVCLDVDSNN--VIITNTCKCLNN-DSSCDPASQWFKIIDST  172
             G N+CL+ +S+N   I T  C C +N   S +P +QWF+ I S 
Sbjct  439  QGRNLCLERNSSNSDSIWTKECLCSDNLGCSKNPQTQWFRFIPSN  483



>ref|XP_004151386.1| PREDICTED: uncharacterized protein LOC101207450 [Cucumis sativus]
Length=364

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 126/224 (56%), Gaps = 7/224 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G D R  +  +NR+ +CF    A+ D DWALWT  GSYY REG   L E +GVL 
Sbjct  136  FVSEYGYDQREVDDAENRFMSCFTAHLAQKDLDWALWTWQGSYYYREGQAELAETFGVLD  195

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + +N +F+Q+  ++Q+  + P Y+ +    +I+H  +G C+   +  + + L  CS
Sbjct  196  SNWTQIKNPNFVQKFQLLQTMLQDP-YSNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCS  254

Query  474  ESDPWGY-TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S  W +      + +  T  CL+A   G  A L   C    S W  IS+S +HL +  +
Sbjct  255  TSSRWSHDNDSTPIKMSSTGLCLKASGEGLEASLSTDCIGKQSLWSAISNSNLHLGTVTE  314

Query  297  DGSNVCLD-VDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
            DG ++CL  ++S+N   I+TN+C C  ND +C  D  SQWF+++
Sbjct  315  DGKSLCLQIIESSNSSKIVTNSCICTTNDPTCLQDTQSQWFELV  358



>ref|XP_002272454.2| PREDICTED: uncharacterized protein LOC100267356 isoform X1 [Vitis 
vinifera]
Length=575

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 131/227 (58%), Gaps = 9/227 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SE+GI+L+ T+  D+RYF CFL   AE D DWALWTL  SY+ R+G  G  E Y VL 
Sbjct  348  FISEYGINLQETSQVDSRYFTCFLPTVAEKDLDWALWTLQASYHYRQGHAGGGESYSVLD  407

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPC-  478
            ++W +PR   FL+R+ I+Q+  + P    S  + L+ H  +G CV  V     + +  C 
Sbjct  408  YSWSKPRYPQFLERMVILQNLLQDPNSNVSPYY-LLVHAQSGFCV-NVKHNDVVSVSSCR  465

Query  477  --SESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
              S +  W +   ++ +   G   CL+A   G P  L   C+   + W+++SDS + +++
Sbjct  466  KNSRNSRWNHEGDRSPIKKLGRKHCLKAVGDGVPLTLSDDCSSPRATWQLVSDSMLQIAA  525

Query  306  KLKDGSNVCLDV--DSNNV-IITNTCKCLNNDSSCDPASQWFKIIDS  175
              + G+ +CLD    SN+  I+T  C CLNN++ CDP SQWFK++ S
Sbjct  526  MDEQGNPLCLDATPSSNSTPILTRACACLNNEAGCDPLSQWFKLVPS  572



>gb|KGN45940.1| hypothetical protein Csa_6G028440 [Cucumis sativus]
Length=539

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/224 (37%), Positives = 126/224 (56%), Gaps = 7/224 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G D R  +  +NR+ +CF    A+ D DWALWT  GSYY REG   L E +GVL 
Sbjct  311  FVSEYGYDQREVDDAENRFMSCFTAHLAQKDLDWALWTWQGSYYYREGQAELAETFGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + +N +F+Q+  ++Q+  + P Y+ +    +I+H  +G C+   +  + + L  CS
Sbjct  371  SNWTQIKNPNFVQKFQLLQTMLQDP-YSNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCS  429

Query  474  ESDPWGY-TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S  W +      + +  T  CL+A   G  A L   C    S W  IS+S +HL +  +
Sbjct  430  TSSRWSHDNDSTPIKMSSTGLCLKASGEGLEASLSTDCIGKQSLWSAISNSNLHLGTVTE  489

Query  297  DGSNVCLD-VDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
            DG ++CL  ++S+N   I+TN+C C  ND +C  D  SQWF+++
Sbjct  490  DGKSLCLQIIESSNSSKIVTNSCICTTNDPTCLQDTQSQWFELV  533



>gb|EYU23411.1| hypothetical protein MIMGU_mgv1a004205mg [Erythranthe guttata]
Length=539

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 126/233 (54%), Gaps = 25/233 (11%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTN  +NRY +C L + AE+D DWALWT  GSY LREGT+ LEE YGV+ 
Sbjct  312  FLSEFGIDQRGTNEAENRYISCLLAVVAEIDIDWALWTFQGSYILREGTLNLEEVYGVMD  371

Query  654  WNWCEPRNLSFLQRISIMQSP-----FRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLE  490
             NW  PRN  +L R+ I++        + P Y       ++FHP +G C   +  +  + 
Sbjct  372  LNWDGPRNPQYLDRLQILRQKNQELESKNPNYY------IMFHPQSGKCA-HIYKYGDII  424

Query  489  LGPCSESDPW--GYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMH  316
            L  C  +  W      G      G+  CL     G  A +   C   SSKW+I+S S +H
Sbjct  425  LATCETATRWEQHQDGGPIKLAGGSSRCLTVAGDGGAASVSGDC---SSKWKIVSSSGLH  481

Query  315  LSSKLKDGSNVCLDVDS--NNVIITNTCKCLNND------SSCDPASQWFKII  181
            L+++   G  +CL++++  N  I+T  C C+ +D       S +P  QWFK++
Sbjct  482  LAAQDGKGKYLCLEMNATDNFTIVTKKCLCVGDDLRDFPTCSDNPQGQWFKLV  534



>gb|KGN50395.1| hypothetical protein Csa_5G171770 [Cucumis sativus]
Length=538

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 127/229 (55%), Gaps = 13/229 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG N   NR+ +CF     E DFDW LW L GSYY REG    EE +GVL 
Sbjct  311  FVSEFGIDQRGVNEGQNRFLSCFFSYLTENDFDWGLWALQGSYYYREGVKNAEENFGVLD  370

Query  654  WNWCEPRNLS-FLQRISIMQSPFRGP--GYTESRLHKLIFHPMTGLCVRRVSLFQPLELG  484
              + + +N   FLQR  +MQ+  + P   +T S    +++HP++G CVR    +Q L + 
Sbjct  371  STFAKAKNSKLFLQRFQLMQTKLQDPSSNFTTSL---IMYHPLSGGCVRMNKKYQ-LGIS  426

Query  483  PCSESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
             C  S+ W +    + + + G+  CL+A  +G P  L   C+   S W+  S +++ L++
Sbjct  427  SCKTSNRWIHEQDSSPIKLAGSVLCLKAIGVGLPPILSQDCSSQQSIWKYGSSAKLQLAT  486

Query  306  KLKDGSNVCLD--VDSNNVIITNTCKCLNNDSSC--DPASQWFKIIDST  172
              + G  +CL      ++ I+TN C C +NDS C  DP SQWF ++ S 
Sbjct  487  VDEQGQALCLQRAASHSHQIVTNKCLC-SNDSQCQEDPQSQWFTLVPSN  534



>ref|XP_006584934.1| PREDICTED: uncharacterized protein LOC100811735 [Glycine max]
Length=337

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 125/223 (56%), Gaps = 7/223 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             VSEFG D+ G +  DN Y  C +   A +D DW+LW   GSYY R+G VGL E Y V+ 
Sbjct  113  LVSEFGYDMTGGSFADNMYLPCIVSYFASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMD  172

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   R+ +F Q+  ++Q   + P    S+   +IFHP+TG C   V+  + L +G C 
Sbjct  173  DDWKSYRDPNFTQKFELLQRMVQDPTSNVSK-SNIIFHPLTGYCA-HVNNSKELVMGDCK  230

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W Y   G  + +  +  CL+A     P  L   C    S W+ +S + +HL++  K
Sbjct  231  SNSLWSYEGDGSPIRLMNSAKCLKAVGERLPPSLSEDCLSPQSSWKTVSMTGLHLATFDK  290

Query  297  DGSNVCLDVDSNNV-IITNTCKCL-NNDSSC--DPASQWFKII  181
            DG  +CL+ DSN+  I+T+ C C+ ++DSSC  +P SQWFK++
Sbjct  291  DGDLLCLEKDSNSSKIVTSKCICISDDDSSCLDNPQSQWFKLV  333



>ref|XP_004170746.1| PREDICTED: endoglucanase E1-like [Cucumis sativus]
Length=539

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 125/224 (56%), Gaps = 7/224 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G D R  +  +NR+ +CF    A+ D DWALWT  GSYY REG   L E +GVL 
Sbjct  311  FVSEYGYDQREVDDAENRFMSCFTAHLAQKDLDWALWTWQGSYYYREGQAELAETFGVLD  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + +N +F+Q+  ++Q+  + P  + +    +I+H  +G C+   +  + + L  CS
Sbjct  371  SNWTQIKNPNFVQKFQLLQTMLQDPN-SNASFSYVIYHVQSGQCIEVSNDNKEIFLTNCS  429

Query  474  ESDPWGY-TAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S  W +      + +  T  CL+A   G  A L   C    S W  IS+S +HL +  +
Sbjct  430  TSSRWSHDNDSTPIKMSSTGLCLKASGEGLEASLSTDCVGKQSLWSAISNSNLHLGTVTE  489

Query  297  DGSNVCLD-VDSNNV--IITNTCKCLNNDSSC--DPASQWFKII  181
            DG ++CL  ++S+N   I+TN+C C  ND +C  D  SQWF+++
Sbjct  490  DGKSLCLQIIESSNSSKIVTNSCICTANDPTCLQDTQSQWFELV  533



>ref|XP_009387704.1| PREDICTED: uncharacterized protein LOC103974573 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -2

Query  585  GPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQ  406
            G  Y   R   +IFHP TG CV R S+  PL LGPC++SD W YT  K L V+GTYFCLQ
Sbjct  41   GQVYASRRPSNVIFHPPTGSCVLRKSVTDPLRLGPCNQSDDWNYTPQKFLVVKGTYFCLQ  100

Query  405  AEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN  226
            +   GKPAKLG+ C++  S W+I S S+  +S +L DG+ +CLDVD  N +ITN C CL 
Sbjct  101  SVDSGKPAKLGIVCSESDSSWDITSKSKAQISKELPDGTALCLDVDPENTLITNPCLCL-  159

Query  225  NDSSCDPASQWFK  187
            +  +CD  SQWF+
Sbjct  160  SIGTCDRESQWFE  172



>ref|XP_010932263.1| PREDICTED: uncharacterized protein LOC105052971 [Elaeis guineensis]
Length=194

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = -2

Query  564  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  385
            R + +IFHP T  CV R SL +PL+LGPC++SD W YT  K L V+GTYFCLQA   GKP
Sbjct  47   RPNNIIFHPSTNSCVLRQSLNEPLKLGPCNQSDGWTYTPQKLLMVKGTYFCLQAVDSGKP  106

Query  384  AKLGLFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDP  205
            A+LG+ C+ D S+WE+ S  + HLS+K  DGS +CLDVD  N +ITN C CL+N+  C+ 
Sbjct  107  ARLGIVCSSD-SEWEVTSSGKPHLSTKKADGSFLCLDVDPGNTLITNPCLCLSNE-RCEA  164

Query  204  ASQWFKI  184
             +QWF+I
Sbjct  165  DNQWFEI  171



>gb|EYU23409.1| hypothetical protein MIMGU_mgv1a004243mg [Erythranthe guttata]
Length=538

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 127/232 (55%), Gaps = 24/232 (10%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTN  DNRY  C L   AE+D DW+LW + GSY LREG   +EE YGV+ 
Sbjct  313  FLSEFGIDQRGTNEADNRYITCLLAAVAEIDIDWSLWAIQGSYILREGNADVEETYGVMN  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRG-----PGYTESRLHKLIFHPMTGLCVRRVSLFQPLE  490
            +NW  P+N +F+ R+ I++   +G     PGY       ++ HP +G CV ++     + 
Sbjct  373  FNWDGPKNPAFVDRLQILKQVNQGANSKNPGYY------IMLHPQSGKCV-QIGNNNSVR  425

Query  489  LGPCSESDPWG-YTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHL  313
            L  C  +  W  +  G  L + G+  CL     G    +   CT   SKW+ +S S + L
Sbjct  426  LADCKTASRWDQHQDGGPLKLSGSSLCLAVAGDGGATSVSDNCT---SKWKYVSSSGLQL  482

Query  312  SSKLKDGSNVCLDVDSNN--VIITNTCKCLNND----SSC--DPASQWFKII  181
            +++   G   CL+++ ++   +IT  C C+ +D    S+C  +P  QWFK++
Sbjct  483  AAQDGMGKYFCLEMNGSDHSTVITKKCLCVGDDLGDFSTCADNPQVQWFKLV  534



>ref|XP_008467257.1| PREDICTED: uncharacterized protein LOC103504654 [Cucumis melo]
Length=539

 Score =   150 bits (378),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 124/225 (55%), Gaps = 8/225 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID  GTN   NR+ +CF     E DFDW LW L GSYY + G    EE +GVL 
Sbjct  312  FVSEFGIDQTGTNEGQNRFLSCFFSYLTENDFDWGLWALQGSYYYKVGVKNAEENFGVLD  371

Query  654  WNWCEPRNLS-FLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPC  478
             N+ + +N   FLQR  +MQ+  + P    +    +++HP++G CVR    +Q L +  C
Sbjct  372  SNFTKAKNSKLFLQRFQLMQTKLQDPSSNFTTTF-IMYHPLSGGCVRMNKKYQ-LGISSC  429

Query  477  SESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKL  301
              S+ W +   G  + + G+  CL+A  +G P  L   C+   S W   S++++ L++  
Sbjct  430  KTSNRWSHEQDGAPIKLAGSILCLKAIGVGLPPILSQDCSSQQSIWRYASNAKLQLATVD  489

Query  300  KDGSNVCLDVDSN-NVIITNTCKCLNNDSSC--DPASQWFKIIDS  175
            + G  +CL   S+ + I+TN C C   DS C  DP SQWF ++ S
Sbjct  490  EQGQALCLQRASHSHQIVTNKCLC-TIDSQCQEDPQSQWFTLVPS  533



>ref|XP_004151560.1| PREDICTED: uncharacterized protein LOC101211788 [Cucumis sativus]
Length=341

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 124/225 (55%), Gaps = 6/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSE+G D R  N  +NR+ +CF    A+ D DWALW   GSYY REG     E +GVL 
Sbjct  115  FVSEYGYDQREVNDAENRFMSCFTAHLAQRDLDWALWAWQGSYYFREGQAEPGESFGVLD  174

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW + +N +F+Q+  ++Q+    P  + +    +I+HP +  C++  +  + + L  CS
Sbjct  175  SNWTQIKNPNFVQKFQLLQTMLHDPN-SNASFSYVIYHPQSSQCIQVSNDNKEIFLTNCS  233

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W +   G  + +  T   L+A   G  A L        S W  IS+S++HL++  +
Sbjct  234  TPTRWSHNNDGTPIEMSSTGLYLKASGEGLEASLSTDTLSQQSVWSAISNSKLHLATFTQ  293

Query  297  DGSNVCLDVDSNNV--IITNTCKCLNNDSSC--DPASQWFKIIDS  175
             G ++CL +DS+N   ++TN+C C N D +C  D  SQWF+++++
Sbjct  294  GGKSLCLQMDSSNSSKVVTNSCICTNGDPNCLQDTRSQWFELVET  338



>ref|XP_008807477.1| PREDICTED: uncharacterized protein LOC103719832 [Phoenix dactylifera]
Length=175

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = -2

Query  552  LIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLG  373
            +IFHP T  CV R SL +PL+LGPC++SD W YT  K L V GTYFCLQA   GKPA+LG
Sbjct  49   VIFHPSTRSCVLRKSLNEPLKLGPCNQSDAWSYTPQKILMVRGTYFCLQAVDSGKPARLG  108

Query  372  LFCTDDSSKWEIISDSRMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLNNDSSCDPASQW  193
            + C+ D S+WE+ S ++ HLS+K  DGS +CLDVD  N +ITN C CL+N   C+  +QW
Sbjct  109  VVCSSD-SEWEVTSSAKPHLSTKRADGSLLCLDVDPGNTLITNPCLCLSNQ-RCEADNQW  166

Query  192  FKI  184
            F+I
Sbjct  167  FEI  169



>ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus]
Length=535

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 123/224 (55%), Gaps = 7/224 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGI+  G N   NR+ +CF     + DFDW LW L GSYY REG    EE +GVL 
Sbjct  310  FVSEFGINQMGVNEGQNRFLSCFFTYLTKNDFDWGLWALQGSYYYREGVKNDEETFGVLD  369

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
              +   +N  FLQ+  +MQ+  + P  +      +++HP++G CVR    +Q L +  C 
Sbjct  370  SKFTNVKNPKFLQKFQLMQTKLQDPS-SNLTTSFIMYHPLSGECVRMNKKYQ-LGVSSCK  427

Query  474  ESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S+ W +      + + G+  CLQA   G P  L   C+   S W+  S++++ L++  +
Sbjct  428  TSNRWSHEQDDTPIKLAGSILCLQAVGDGLPPILSKDCSSQQSAWKYASNAKLQLATVDE  487

Query  297  DGSNVCLDVDSN-NVIITNTCKCLNNDSSC--DPASQWFKIIDS  175
            +G  +CL   S+ + I+TN C C  NDS C  DP SQWF ++ S
Sbjct  488  EGQALCLQRASHSHQILTNKCMC-PNDSECQGDPQSQWFTLVPS  530



>gb|KGN50394.1| hypothetical protein Csa_5G171760 [Cucumis sativus]
Length=538

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 128/229 (56%), Gaps = 13/229 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RG N   NR+ +CF     E DFDW LW L GSYY REG    EE +GVL 
Sbjct  311  FVSEFGIDQRGVNEGQNRFLSCFFSYLTENDFDWGLWALQGSYYYREGVKNAEENFGVLD  370

Query  654  WNWCEPRNLS-FLQRISIMQSPFRGP--GYTESRLHKLIFHPMTGLCVRRVSLFQPLELG  484
              + + +N   FLQR  +MQ+  + P   +T S    +++HP++G CVR    +Q L + 
Sbjct  371  STFAKAKNSKLFLQRFQLMQTKLQDPSSNFTTSL---IMYHPLSGGCVRMNKKYQ-LGIS  426

Query  483  PCSESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSS  307
             C  S+ W +    + + + G+  CL+A  +G P  L   C+   S W+  S++++ L++
Sbjct  427  SCKTSNRWIHEQDSSPIKLAGSVLCLKAIGVGLPPILSQDCSSQQSIWKYGSNAKLQLAT  486

Query  306  KLKDGSNVCLD--VDSNNVIITNTCKCLNNDSSC--DPASQWFKIIDST  172
              + G  +CL      ++ ++TN C C ++DS C  DP SQWF ++ S 
Sbjct  487  IDEQGQALCLQRAASHSHQLVTNKCLC-SSDSQCQEDPQSQWFTLVPSN  534



>emb|CDP12092.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 141/254 (56%), Gaps = 26/254 (10%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG N  DNRY +C L   AE D DWALWTL GSY LR+G V LEE YG+  
Sbjct  691  FLSEFGADQRGGNEADNRYLSCLLAFVAEHDLDWALWTLQGSYILRQGVVELEEVYGMFD  750

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW   RN +  +R+ +++     P  + +  H  ++HP +GLC  ++     +    C 
Sbjct  751  VNWDHIRNSTLSRRLQLVKQIIWDPK-SNNTTHSKLYHPQSGLCA-QIGNNGSVRGSDCQ  808

Query  474  ESDPWGYT-AGKALTV----EGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS  310
                W    AG ++ +    EGT+ CL+A   G+PA +   C + ++ W+++S S++H++
Sbjct  809  SPGRWKQQEAGSSIQLEAEAEGTFGCLRAVGDGQPATVSSDCGNQTTLWKLVSSSQLHIA  868

Query  309  SKLKDGSNVCLDVD-SNNVIITNTCKCLNNDS------SCDPASQWFKIIDSTRGTTTKS  151
            ++   G  +CL+++ S++V++T  C CL+ +S      + +P  QWFK++ +        
Sbjct  869  AQ---GGYLCLEMNSSDSVVVTRKCLCLDENSNDVPNCAENPEGQWFKLVPTN-------  918

Query  150  DFQSTSFLYFLAKK  109
              +S  F +F  KK
Sbjct  919  --ESLIFFFFGDKK  930


 Score = 76.6 bits (187),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F++EFG D  G N  DN +  C++   AE D DWALW L GSYYLR+G    EE YG+  
Sbjct  254  FITEFGGDQIGDNTADNYFLTCYISWLAENDLDWALWALQGSYYLRDGKHDPEETYGLFN  313

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPG  577
             +W   RN  F  ++ ++Q      G
Sbjct  314  SSWGPLRNPQFHTKLQLIQRTLIATG  339



>ref|XP_009605826.1| PREDICTED: uncharacterized protein LOC104100317 [Nicotiana tomentosiformis]
Length=526

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 123/224 (55%), Gaps = 9/224 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RGTN  DN +  CFL L AELD DWA+W L G+YY REG  G+EE YG+  
Sbjct  306  FVSEFGIDQRGTNQADNLFLGCFLSLLAELDLDWAVWALQGNYYTREGQQGMEEMYGMFN  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
              W   R+  +  ++ ++Q   + P   +   H L+FHP +G C+   +    L    C 
Sbjct  366  STWNSLRSPEYHAKLQLIQQKLQDPKSKQPMYH-LLFHPQSGKCLHAAA-NNVLYASDCI  423

Query  474  ESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W Y      + + GT  CL   + G P  L   C++ S+ W+ +S+ +  LS+  +
Sbjct  424  GASRWSYDGDDTPIRLTGTSLCLTTSREGLPVTLSTDCSEQST-WKFVSNYQ--LSNHDE  480

Query  297  DGSNVCLDVD---SNNVIITNTCKCLNNDSSCDPASQWFKIIDS  175
            +G+ +CLD D   S++ ++   C  L+  S+ +P +QWFK + +
Sbjct  481  NGTELCLDFDTYYSSSKVLVRKCIGLDEKSNDNPQTQWFKFVSA  524



>gb|KHN45741.1| Endoglucanase [Glycine soja]
Length=531

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/225 (37%), Positives = 126/225 (56%), Gaps = 7/225 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             VSEFG D+ G +  DN Y  C +   A +D DW+LW   GSYY R+G VGL E Y V+ 
Sbjct  307  LVSEFGYDMTGGSFADNMYLPCIVSYFASVDLDWSLWAFQGSYYYRQGKVGLGESYAVMD  366

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   R+ +F Q+  ++Q   + P    S+   +IFHP+TG C   V+  + L +G C 
Sbjct  367  DDWKSYRDPNFTQKFELLQRMVQDPTSNVSK-SNIIFHPLTGYCA-HVNNSKELVMGDCK  424

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W Y   G  + +  +  CL+A     P  L   C    S W+ +S + +HL++  K
Sbjct  425  SNSLWSYEGDGSPIRLMNSAKCLKAVGERLPPSLSEDCLSPQSSWKTVSMTGLHLATFDK  484

Query  297  DGSNVCLDVDSNNV-IITNTCKCL-NNDSSC--DPASQWFKIIDS  175
            DG  +CL+ DSN+  I+T+ C C+ ++DSSC  +P SQWFK++ +
Sbjct  485  DGDLLCLEKDSNSSKIVTSKCICISDDDSSCLDNPQSQWFKLVST  529



>ref|XP_007159232.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
 gb|ESW31226.1| hypothetical protein PHAVU_002G220300g [Phaseolus vulgaris]
Length=529

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 124/223 (56%), Gaps = 8/223 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG ++ G N  D+ Y+ C +     +D +W+LW   GSYYLR+G VG  E YGV+ 
Sbjct  306  FVSEFGYNMDGGNFADDSYWPCVVAHFTSVDLEWSLWAFQGSYYLRQGNVGPGESYGVMD  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            + W   R+ +F Q+  ++Q   + P    S+ H +IFHP TG C       + L +G C 
Sbjct  366  FEWENYRDPNFTQKFQLLQRIIQDPNSKASKSH-IIFHPSTGYCAHVND--KELVMGDCK  422

Query  474  ESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W +   G  + +  +  CL+A   G P  L   C    S W+ +S S +HL+S  K
Sbjct  423  SNSLWSFEGDGSPIRLMNSAMCLKAVGEGLPPTLSEDCLSAQSSWKAVSMSGLHLASFDK  482

Query  297  DGSNVCLDVDSNNV-IITNTCKCL-NNDSSC--DPASQWFKII  181
            +G  +CL+ DSN+  ++T  C C+ N+DSSC   P +QWF+++
Sbjct  483  NGDLLCLEKDSNSTKLVTRKCICIENDDSSCLDSPLNQWFRLV  525



>gb|KDO82155.1| hypothetical protein CISIN_1g008330mg [Citrus sinensis]
Length=435

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG DLRG NVNDNRY NCF G+AAELD+DWALWTL GSYYLREG +GL E+YG+  
Sbjct  319  FVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFD  378

Query  654  WNWCEPRNLSFLQRISIMQSPFRG  583
            WNWC+ RN SFL+RIS +QSPFRG
Sbjct  379  WNWCDIRNSSFLERISSLQSPFRG  402



>emb|CDY21995.1| BnaC09g01010D [Brassica napus]
Length=178

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 105/152 (69%), Gaps = 5/152 (3%)
 Frame = -2

Query  612  ISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKAL-  436
            +S +QSP +GPG  E++  K++FHP TGLC+ R SLFQ L+L  C+  + +  ++   L 
Sbjct  2    LSSIQSPLQGPGLMETQPKKIMFHPATGLCIVRNSLFQ-LKLSSCNGPERFILSSHGVLS  60

Query  435  -TVEGTYFCLQAEKLGKPAKLGLFCTD-DSSKWEIISDSRMHLSSKLKDGSNVCLDVDS-  265
             T E  +FCL+  + GK  KL LF ++ +SSKW+++S+S+M LS   KDG +VCLDVDS 
Sbjct  61   RTEEHVFFCLKVYEEGKSVKLRLFSSESNSSKWKVLSESKMQLSLVTKDGESVCLDVDSG  120

Query  264  NNVIITNTCKCLNNDSSCDPASQWFKIIDSTR  169
            +  I+T +CKCL  + SCDP SQWFK++ +TR
Sbjct  121  SGNIVTKSCKCLEGNGSCDPTSQWFKLVTNTR  152



>ref|XP_006378253.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
 gb|ERP56050.1| hypothetical protein POPTR_0010s059502g, partial [Populus trichocarpa]
Length=396

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY  CFL +AAELD DWALWTL GSYYLR+G +G+ E+YGV+ 
Sbjct  314  FVSEFGVDQRGTNVNDNRYLGCFLSVAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVMN  373

Query  654  WNWCEPRNLSFLQRISIMQSPFR  586
            WNWCE RN +FLQ+IS++QSPF+
Sbjct  374  WNWCEARNSTFLQQISVLQSPFQ  396



>ref|XP_009773950.1| PREDICTED: uncharacterized protein LOC104224082 [Nicotiana sylvestris]
Length=526

 Score =   144 bits (364),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 119/224 (53%), Gaps = 9/224 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID RGTN  DN +  CFL   AELD DWA+W L G+YY REG  G+EE YG+  
Sbjct  306  FVSEFGIDQRGTNQADNLFLGCFLSFLAELDLDWAVWALQGNYYTREGQQGMEEMYGMFN  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
              W   RN  +  ++ ++Q   + P   +   H L+FHP +G C+        +    C 
Sbjct  366  STWKTLRNPEYHAKLQLIQQTLQDPKSKQPMYH-LLFHPQSGKCLHAAD-NNVVYASDCI  423

Query  474  ESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W Y      + + GT  CL   + G P  L   C++ S+ W+  S+ +  LS+  +
Sbjct  424  GASRWSYDGDDTPIRLTGTSLCLTTSREGLPVALSTDCSEQST-WKFASNYQ--LSNHDE  480

Query  297  DGSNVCLDVD---SNNVIITNTCKCLNNDSSCDPASQWFKIIDS  175
            +GS +CLD D   S++ ++   C  L+  S  +P +QWFK + +
Sbjct  481  NGSELCLDFDTYYSSSKVLVRKCIGLDEKSIDNPQNQWFKFVSA  524



>gb|EYU23408.1| hypothetical protein MIMGU_mgv1a020519mg [Erythranthe guttata]
Length=538

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 126/227 (56%), Gaps = 14/227 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N  +NRY  C L   A+ D DWALWT  GSY LREG V  EE YGV+ 
Sbjct  313  FLSEFGIDQRGGNDAENRYITCLLATVADRDIDWALWTFQGSYILREGKVNSEEAYGVMD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             NW  PRN +FL ++ +++        ++   + ++FHP +G CV +V     + L  C 
Sbjct  373  LNWDRPRNPAFLDKLQLIRQ-MNQELESKKPTNYIMFHPQSGQCV-QVGKNNNIILSNCK  430

Query  474  ESDPWG-YTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W  +  G  + + G+  C+     G  A++   C   SSKW+I S S +HL+++  
Sbjct  431  TASRWDQHQDGGPIKLAGSPQCIGVAGDGGAARVSGDC---SSKWKIASTSGLHLAAQDG  487

Query  297  DGSNVCLDVDSNN--VIITNTCKCLNND------SSCDPASQWFKII  181
             G  +CL++++++   I+T  C C+ +D       S +P  QWFK++
Sbjct  488  KGKYLCLEMNASDHSTIVTKKCLCVGDDLVDFPTCSDNPQVQWFKLV  534



>ref|XP_004510834.1| PREDICTED: uncharacterized protein LOC101496378 [Cicer arietinum]
Length=540

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 126/225 (56%), Gaps = 12/225 (5%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
             +SEFG D  G++V DNR+  C        D DW LW   GSYY+RE  V L+E +GVL 
Sbjct  317  IISEFGFDQTGSSVEDNRFLTCLQTYLVGRDLDWGLWAFHGSYYVREDKVQLDESFGVLD  376

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHK--LIFHPMTGLCVRRVSLFQPLELGP  481
              W   R  +F  +  ++Q   + P    S+L K  +++HP+TG C  +V+    LE+G 
Sbjct  377  ATWHNLRYPNFTDKFQLLQRMNQDP---TSKLPKAYIMYHPLTGKCA-QVNEKNELEIGS  432

Query  480  CSES-DPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLS-S  307
            C E+ + W Y  G  +   GT  CL A     P  +   C   +S W+ +S SR+HL+ S
Sbjct  433  CGENKNRWIYD-GSQILWNGTKKCLTASGEDLPVSVSDDCKSKNSSWKPVSLSRLHLATS  491

Query  306  KLKDGSNVCLDVDSN-NVIITNTCKCLNNDSSC--DPASQWFKII  181
              ++G  +CL  DSN +V++T+ C C+N+DS C  DP SQWF+++
Sbjct  492  HDQNGKQLCLHKDSNSSVVVTSKCICINDDSLCLDDPQSQWFQLV  536



>ref|XP_008459280.1| PREDICTED: uncharacterized protein LOC103498458 [Cucumis melo]
Length=719

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 128/233 (55%), Gaps = 15/233 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGID  GTN   NR+ +CF     E DFDW LW L GSYY + G     E +GVL 
Sbjct  483  FVSEFGIDQTGTNEGQNRFLSCFFSYLTENDFDWGLWALQGSYYYKVGVKNAGENFGVLD  542

Query  654  WNWCEPRNLS-FLQRISIMQSPFRGPG----YTESRLH----KLIFHPMTGLCVRRVSLF  502
             N+ + +N   FLQR  +MQ+  +       YT+   +     +++HP++G C+R    +
Sbjct  543  SNFTKAKNSKLFLQRFQLMQTKLQESQRLLFYTDPSSNFTTSFIMYHPLSGGCMRMNKKY  602

Query  501  QPLELGPCSESDPWGYTA-GKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDS  325
            Q L +  C  S+ W +   G  + + G+  CL+A  +G P  L   C+   S W+  S++
Sbjct  603  Q-LGISSCKTSNRWSHEQDGAPIKLAGSILCLKAIGVGLPPILSQDCSSQQSIWKYGSNA  661

Query  324  RMHLSSKLKDGSNVCLDVDSN-NVIITNTCKCLNNDSSC--DPASQWFKIIDS  175
            ++ L++  + G  +CL   S+ + I+TN C C +NDS C  DP SQWF ++ S
Sbjct  662  KLQLATVDEQGQALCLQRASHSHQIVTNKCLC-SNDSQCQEDPQSQWFTLVPS  713



>gb|KEH18775.1| hydrolyzing O-glycosyl compounds hydrolase [Medicago truncatula]
Length=538

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 121/220 (55%), Gaps = 7/220 (3%)
 Frame = -2

Query  828  SEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLTWN  649
            +EFG D  G+ V DNR+  C        D DW LW   G YY+RE  V L+E +GV+   
Sbjct  318  TEFGFDQTGSTVEDNRFLTCLQTYLVGRDLDWGLWAFHGGYYVREDKVQLDETFGVVDAT  377

Query  648  WCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCSES  469
            W + R  +F  +  ++Q   + P    S+ + +++HP+TG CV +V+    LE+G C   
Sbjct  378  WHKLRYPNFTDKFQLLQRKNQDPTSKRSKAY-IMYHPLTGKCV-QVNENNKLEIGSCENQ  435

Query  468  DPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKDG-  292
              W Y  G  + ++ +  CL A   G P  +   C   +S W+  S S++HL++  +DG 
Sbjct  436  KRWTY-KGSQIFLKESQKCLTASGEGLPVSVSDDCESKNSSWKTASPSKLHLATVNQDGK  494

Query  291  SNVCLDVDSN-NVIITNTCKCLNNDSSC--DPASQWFKII  181
              +CL  D+N + ++T+ C C+++DS C  DP SQWF+++
Sbjct  495  QQLCLQKDTNSSAVVTSKCICIHDDSLCLDDPQSQWFQLV  534



>gb|EYU23410.1| hypothetical protein MIMGU_mgv1a004297mg [Erythranthe guttata]
Length=534

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 125/227 (55%), Gaps = 14/227 (6%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RGTN  DNRY +C L   AE+D DWALW   GSY  REG   ++E YGV+ 
Sbjct  308  FLSEFGIDQRGTNEADNRYISCLLAAVAEIDIDWALWAFQGSYIFREGKPDVDEAYGVMN  367

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
            +NW  PRN  F+ R+ I++   +    +++  + ++ HP +G CV ++     + L  C 
Sbjct  368  FNWDAPRNPGFVDRLQILRQTNQ-VADSKNPSYYIMLHPQSGQCV-QIGNTNNVLLANCK  425

Query  474  ESDPWG-YTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             +  W  +  G  + + G+  CL     G  A +   C    SKW+ +S S + L+++  
Sbjct  426  TASRWDQHEDGGLMKLSGSSLCLAVAGDGGAASVSGNC---RSKWKYVSSSGLQLAAQDG  482

Query  297  DGSNVCLDVDSNN--VIITNTCKCLNND----SSC--DPASQWFKII  181
             G   CL+++ ++   +IT  C C+ +D    S+C  +P  QWFK++
Sbjct  483  MGKYFCLEMNGSDHSTVITKKCLCVGDDLRDFSTCADNPEVQWFKLV  529



>ref|XP_004170742.1| PREDICTED: uncharacterized protein LOC101225189, partial [Cucumis 
sativus]
Length=337

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 119/220 (54%), Gaps = 5/220 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRG N   NR+ +CFL      D DWA W   GSY  R+G   ++E +G++ 
Sbjct  116  FLSEFGYDLRGGNKAQNRFMSCFLARIIGKDIDWAYWAFQGSYMYRQGQQDVDESFGIMD  175

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W + R+    Q + + +   + P  ++  +  ++ HP++G CV ++     +ELG C 
Sbjct  176  SSWTKDRSPRLQQMLQLAKRINQDPN-SKGPMSYIMLHPVSGQCV-KLDGKGGIELGDCE  233

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
                W +T   +        CL++   GKP  +   C+ D S W + S +++ LS+K   
Sbjct  234  TPTLWDHTGDGSPMKLWNGQCLKSAGDGKPPVVSAECSGDGSSWTVASKAKLQLSTK-SG  292

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSC--DPASQWFKII  181
            G N+CL+ +S+  I+   C CL ++ +C  DP SQWFK++
Sbjct  293  GENICLEKESDTSIVVKKCICLKDEWNCFDDPQSQWFKLV  332



>ref|XP_002315653.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
 gb|EEF01824.2| hypothetical protein POPTR_0010s05960g [Populus trichocarpa]
Length=377

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG+D RGTNVNDNRY  CFL +AAELD DWALWTL GSYYLR+G +G+ E+YGVL 
Sbjct  292  FVSEFGVDQRGTNVNDNRYLGCFLSVAAELDLDWALWTLVGSYYLRQGVIGMNEYYGVLN  351

Query  654  WNWCEPRNLSFLQRISIMQSPFR  586
            WNW E RN +FLQ IS +QSPFR
Sbjct  352  WNWREVRNSTFLQLISALQSPFR  374



>gb|EAZ23667.1| hypothetical protein OsJ_07369 [Oryza sativa Japonica Group]
Length=583

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG D RG +  D+RY  C   +AAELD DWALW L GSY LR+G  G +E YGVL 
Sbjct  313  FLSEFGADTRGGSRKDDRYLPCAAAVAAELDLDWALWALQGSYALRQGVAGADEVYGVLD  372

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR  514
            W+W +PRN + L RI  +Q P RGPGY E+R + ++FHP+TG CV R
Sbjct  373  WSWSKPRNATALSRIQSLQRPLRGPGYDEARPYTVLFHPLTGRCVVR  419



>ref|XP_009403630.1| PREDICTED: uncharacterized protein LOC103987145 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 92/141 (65%), Gaps = 5/141 (4%)
 Frame = -2

Query  564  RLHKLIFHPMTGLCVRRVSLFQPLELGPCSESDPWGYTAGKALTVEGTYFCLQAEKLGKP  385
            R    IFHP TGLCV R ++  PL+LGPCS SD W YT  + L V GTYFCL+A  LG P
Sbjct  42   RPRTKIFHPPTGLCVTRRTMADPLKLGPCSASDSWRYTPQEFLMVTGTYFCLRAVGLGAP  101

Query  384  AKLGLFCTDDSSKWEIISDS-RMHLSSKLKDGSNVCLDVDSNNVIITNTCKCLN--NDSS  214
             +LG+ C    S+W+++S S + HL++KL DG+ VCLDVDS+  +++N+C   +  +D  
Sbjct  102  VRLGIICDPSDSRWQLVSGSEKTHLATKLTDGTEVCLDVDSDGCLVSNSCDGFHGGDDEH  161

Query  213  CDPASQWFKIIDSTRGTTTKS  151
                SQWFK++  T G T +S
Sbjct  162  LQVDSQWFKLV--TAGFTKQS  180



>emb|CDY34588.1| BnaC03g56880D [Brassica napus]
Length=343

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFGID RG N NDNRY  C  G AAE D DW+LW L GSYYLREG VG+ E+YG L 
Sbjct  200  FLSEFGIDQRGGNANDNRYLGCLSGWAAENDVDWSLWALTGSYYLREGVVGMIEYYGALD  259

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRR  514
             +W   RN SFLQ+IS++QSP +GPG  ++    L+FHP+TGLC+ R
Sbjct  260  SDWNSVRNSSFLQQISLLQSPLQGPG-PKTDAFNLVFHPLTGLCLVR  305



>ref|XP_011026965.1| PREDICTED: uncharacterized protein LOC105127394 [Populus euphratica]
Length=535

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 124/226 (55%), Gaps = 9/226 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFGID +     D+R+ +CF   AAE D DW LW L GSYYLR+    +EE++GVL 
Sbjct  311  FFSEFGIDRKQMPAGDDRFLSCFSTWAAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLE  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   +N +  +R+ +++     P  + + L+ +++HP +G CV    +   +  G C 
Sbjct  371  IDWDRVKNPAVERRLGLLKQTLLDPK-SMAPLNYIMYHPQSGACVGE-GMDGQIRAGNCK  428

Query  474  ESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W +   +  L ++GT  CL+A   G P  L   C+   + W+ IS S++HL+SK  
Sbjct  429  GLTRWTHNGHEGPLELKGTGLCLKAIGDGLPPILTPDCS--QTTWKPISASKLHLASKDH  486

Query  297  DGSNVCLDVDS--NNVIITNTCKCLNNDSSC--DPASQWFKIIDST  172
             G  +CL +       I+T  C C+ +D +C  +P SQWFK++++ 
Sbjct  487  KGEYLCLHLAPPFAGNIVTKKCICVGDDPTCKDNPTSQWFKLVETN  532



>gb|KGN50047.1| hypothetical protein Csa_5G151630 [Cucumis sativus]
Length=527

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 119/220 (54%), Gaps = 5/220 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRG N   NR+ +CFL      D DWA W   GSY  R+G   ++E +G++ 
Sbjct  306  FLSEFGYDLRGGNKAQNRFMSCFLARIIGKDIDWAYWAFQGSYMYRQGQQDVDESFGIMD  365

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W + R+    Q + + +   + P  ++  +  ++ HP++G CV ++     +ELG C 
Sbjct  366  SSWTKDRSPRLQQMLQLAKRINQDPN-SKGPMSYIMLHPVSGQCV-KLDGKGGIELGDCE  423

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
                W +T   +        CL++   GKP  +   C+ D S W + S +++ LS+K   
Sbjct  424  TPTLWDHTGDGSPMKLWNGQCLKSAGDGKPPVVSAECSGDGSSWTVASKAKLQLSTK-SG  482

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSC--DPASQWFKII  181
            G N+CL+ +S+  I+   C CL ++ +C  DP SQWFK++
Sbjct  483  GENICLEKESDTSIVVKKCICLKDEWNCFDDPQSQWFKLV  522



>ref|XP_004143963.1| PREDICTED: uncharacterized protein LOC101211910 [Cucumis sativus]
Length=525

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 119/220 (54%), Gaps = 5/220 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F+SEFG DLRG N   NR+ +CFL      D DWA W   GSY  R+G   ++E +G++ 
Sbjct  304  FLSEFGYDLRGGNKAQNRFMSCFLARIIGKDIDWAYWAFQGSYMYRQGQQDVDESFGIMD  363

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W + R+    Q + + +   + P  ++  +  ++ HP++G CV ++     +ELG C 
Sbjct  364  SSWTKDRSPRLQQMLQLAKRINQDPN-SKGPMSYIMLHPVSGQCV-KLDGKGGIELGDCE  421

Query  474  ESDPWGYTAGKALTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLKD  295
                W +T   +        CL++   GKP  +   C+ D S W + S +++ LS+K   
Sbjct  422  TPTLWDHTGDGSPMKLWNGQCLKSAGDGKPPVVSAECSGDGSSWTVASKAKLQLSTK-SG  480

Query  294  GSNVCLDVDSNNVIITNTCKCLNNDSSC--DPASQWFKII  181
            G N+CL+ +S+  I+   C CL ++ +C  DP SQWFK++
Sbjct  481  GENICLEKESDTSIVVKKCICLKDEWNCFDDPQSQWFKLV  520



>ref|XP_010026599.1| PREDICTED: uncharacterized protein LOC104416971 [Eucalyptus grandis]
Length=419

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 3/105 (3%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFG +L G NVNDNRYFNCF G+AA+LDFDWALWT+ GSYY  +G VG++E +GVL 
Sbjct  311  FVSEFGGELSGQNVNDNRYFNCFFGVAAKLDFDWALWTIVGSYYFGKGIVGMDETFGVLN  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLI-FHPMTGLC  523
             ++  PRN SFLQRIS +Q+PF+  G T S   ++I FHP+TGLC
Sbjct  371  KDFSGPRNASFLQRISALQAPFQ--GVTSSNPTRIILFHPLTGLC  413



>gb|KGN57438.1| hypothetical protein Csa_3G185670 [Cucumis sativus]
Length=427

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 113/210 (54%), Gaps = 5/210 (2%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            FVSEFGI+  G N   NR+ +CF     + DFDW LW L GSYY REG    EE +GVL 
Sbjct  221  FVSEFGINQMGANEGQNRFLSCFFTYLTKNDFDWGLWALQGSYYYREGVKNDEETFGVLD  280

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
              +   +N  FLQ+  +MQ+  + P  +      +++HP++G CVR    +Q L +  C 
Sbjct  281  SKFTNVKNPKFLQKFQLMQTKLQDPS-SNLTTSFIMYHPLSGECVRMNKKYQ-LGVSSCK  338

Query  474  ESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
             S+ W +      + + G+  CLQA   G P  L   C+   S W+  S++++ L++  +
Sbjct  339  TSNRWSHEQDDTPIKLAGSILCLQAVGDGLPPILSKDCSSQQSAWKYASNAKLQLATVDE  398

Query  297  DGSNVCLDVDSN-NVIITNTCKCLNNDSSC  211
             G  +CL   S+ + I+TN C C  NDS C
Sbjct  399  QGQALCLQRASHSHQILTNKCIC-PNDSDC  427



>ref|XP_002298005.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
 gb|EEE82810.2| hypothetical protein POPTR_0001s10020g [Populus trichocarpa]
Length=535

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 123/226 (54%), Gaps = 9/226 (4%)
 Frame = -2

Query  834  FVSEFGIDLRGTNVNDNRYFNCFLGLAAELDFDWALWTLAGSYYLREGTVGLEEFYGVLT  655
            F SEFGID +     D+R+ +CF   AAE D DW LW L GSYYLR+    +EE++GVL 
Sbjct  311  FFSEFGIDRKQMPAGDDRFLSCFSTWAAEKDLDWGLWALQGSYYLRQNVTNMEEYFGVLE  370

Query  654  WNWCEPRNLSFLQRISIMQSPFRGPGYTESRLHKLIFHPMTGLCVRRVSLFQPLELGPCS  475
             +W   +N    +R+ +++     P  T + L+ +++HP +G CV    +   +  G C 
Sbjct  371  IDWDRVKNPEVERRLGLLKQTLLDPKST-APLNYIMYHPQSGACVGE-GMDGQIRAGNCK  428

Query  474  ESDPWGYTAGKA-LTVEGTYFCLQAEKLGKPAKLGLFCTDDSSKWEIISDSRMHLSSKLK  298
                W +   +  L ++ T  CL+A   G P  L   C+   + W+ IS S++HL+SK  
Sbjct  429  GLTRWTHNGHEGPLELKRTGLCLKAIGDGLPPILTPDCS--QTTWKPISASKLHLASKDH  486

Query  297  DGSNVCLDVDS--NNVIITNTCKCLNNDSSC--DPASQWFKIIDST  172
             G  +CL ++      I+T  C C+ +D +C  +P SQWFK++++ 
Sbjct  487  RGEYLCLHLEPPFAGNIVTKKCICVGDDPTCKDNPTSQWFKLVETN  532



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1739635120055