BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043K04

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004169575.1|  PREDICTED: protein ECERIFERUM 3-like               260   4e-83   
ref|XP_009609207.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    270   5e-82   Nicotiana tomentosiformis
ref|XP_009609208.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    270   5e-82   Nicotiana tomentosiformis
ref|XP_009788358.1|  PREDICTED: protein ECERIFERUM 3-like               270   7e-82   Nicotiana sylvestris
ref|XP_011082697.1|  PREDICTED: protein ECERIFERUM 3-like               266   2e-80   Sesamum indicum [beniseed]
gb|KJB23542.1|  hypothetical protein B456_004G104100                    258   3e-80   Gossypium raimondii
ref|XP_006341693.1|  PREDICTED: protein ECERIFERUM 3-like               265   4e-80   Solanum tuberosum [potatoes]
ref|XP_011073242.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    264   1e-79   Sesamum indicum [beniseed]
ref|XP_011073241.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    264   1e-79   Sesamum indicum [beniseed]
ref|XP_010318689.1|  PREDICTED: protein ECERIFERUM 3 isoform X3         261   4e-79   
ref|XP_010318688.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         262   5e-79   Solanum lycopersicum
ref|XP_004235875.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         262   5e-79   Solanum lycopersicum
ref|XP_011079338.1|  PREDICTED: protein ECERIFERUM 3-like               261   1e-78   Sesamum indicum [beniseed]
gb|EYU24562.1|  hypothetical protein MIMGU_mgv1a002930mg                260   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_004149879.1|  PREDICTED: protein ECERIFERUM 3-like               260   2e-78   Cucumis sativus [cucumbers]
ref|XP_008443806.1|  PREDICTED: protein ECERIFERUM 3                    259   4e-78   Cucumis melo [Oriental melon]
emb|CDO98263.1|  unnamed protein product                                260   6e-78   Coffea canephora [robusta coffee]
gb|KJB23543.1|  hypothetical protein B456_004G104100                    258   1e-77   Gossypium raimondii
gb|KJB23541.1|  hypothetical protein B456_004G104100                    257   3e-77   Gossypium raimondii
gb|KJB23544.1|  hypothetical protein B456_004G104100                    257   3e-77   Gossypium raimondii
ref|XP_007013964.1|  Fatty acid hydroxylase superfamily                 257   5e-77   
gb|KDP38762.1|  hypothetical protein JCGZ_04115                         256   7e-77   Jatropha curcas
gb|KHG27245.1|  Protein WAX2                                            256   1e-76   Gossypium arboreum [tree cotton]
ref|XP_010687696.1|  PREDICTED: protein ECERIFERUM 3                    255   1e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO62363.1|  hypothetical protein CISIN_1g006768mg                   253   4e-76   Citrus sinensis [apfelsine]
ref|XP_008223562.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         252   2e-75   Prunus mume [ume]
gb|KDO62360.1|  hypothetical protein CISIN_1g006768mg                   252   3e-75   Citrus sinensis [apfelsine]
ref|XP_006453492.1|  hypothetical protein CICLE_v10007738mg             252   3e-75   Citrus clementina [clementine]
ref|NP_001146749.1|  uncharacterized protein LOC100280351               247   3e-75   Zea mays [maize]
gb|ACN25216.1|  unknown                                                 244   4e-75   Zea mays [maize]
ref|XP_002270033.2|  PREDICTED: protein ECERIFERUM 3-like               250   8e-75   Vitis vinifera
ref|XP_007221983.1|  hypothetical protein PRUPE_ppa002836mg             250   1e-74   Prunus persica
emb|CBI25242.3|  unnamed protein product                                250   1e-74   Vitis vinifera
gb|AFW87579.1|  hypothetical protein ZEAMMB73_499314                    245   2e-74   
ref|XP_011016520.1|  PREDICTED: protein ECERIFERUM 3-like               237   3e-74   Populus euphratica
ref|NP_001131238.1|  gl1 protein                                        241   5e-74   
gb|KHG27244.1|  Protein WAX2                                            249   6e-74   Gossypium arboreum [tree cotton]
ref|XP_010047031.1|  PREDICTED: protein ECERIFERUM 3                    248   7e-74   Eucalyptus grandis [rose gum]
ref|XP_009400348.1|  PREDICTED: protein ECERIFERUM 3-like               248   7e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83325.1|  hypothetical protein B456_013G242200                    246   8e-74   Gossypium raimondii
ref|XP_002325096.1|  hypothetical protein POPTR_0018s10830g             248   1e-73   
ref|XP_004965700.1|  PREDICTED: protein ECERIFERUM 3-like               248   1e-73   Setaria italica
gb|AAB87722.1|  glossy1 homolog                                         246   1e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002451653.1|  hypothetical protein SORBIDRAFT_04g005330          247   2e-73   Sorghum bicolor [broomcorn]
gb|KEH32582.1|  fatty acid hydroxylase superfamily protein              247   2e-73   Medicago truncatula
gb|EAZ01917.1|  hypothetical protein OsI_23945                          247   2e-73   Oryza sativa Indica Group [Indian rice]
gb|ACF79426.1|  unknown                                                 241   3e-73   Zea mays [maize]
ref|XP_002437383.1|  hypothetical protein SORBIDRAFT_10g025920          246   3e-73   Sorghum bicolor [broomcorn]
ref|NP_001058237.1|  Os06g0653000                                       246   3e-73   
emb|CDP02895.1|  unnamed protein product                                246   5e-73   Coffea canephora [robusta coffee]
gb|KHG30512.1|  Protein WAX2 -like protein                              246   5e-73   Gossypium arboreum [tree cotton]
ref|XP_008794400.1|  PREDICTED: protein ECERIFERUM 3-like               246   5e-73   Phoenix dactylifera
ref|XP_002270075.1|  PREDICTED: protein ECERIFERUM 3-like               246   5e-73   Vitis vinifera
emb|CBI25244.3|  unnamed protein product                                246   6e-73   Vitis vinifera
ref|XP_010278025.1|  PREDICTED: protein ECERIFERUM 3                    245   7e-73   Nelumbo nucifera [Indian lotus]
gb|KJB83324.1|  hypothetical protein B456_013G242200                    245   7e-73   Gossypium raimondii
ref|XP_011018104.1|  PREDICTED: protein ECERIFERUM 3                    246   7e-73   Populus euphratica
gb|ACN25333.1|  unknown                                                 245   8e-73   Zea mays [maize]
ref|XP_006401167.1|  hypothetical protein EUTSA_v10012960mg             245   1e-72   Eutrema salsugineum [saltwater cress]
ref|XP_004309858.1|  PREDICTED: protein ECERIFERUM 3                    245   1e-72   Fragaria vesca subsp. vesca
ref|XP_002864528.1|  hypothetical protein ARALYDRAFT_495876             245   2e-72   
ref|XP_006657201.1|  PREDICTED: protein ECERIFERUM 3-like               244   2e-72   
gb|KJB83323.1|  hypothetical protein B456_013G242200                    244   2e-72   Gossypium raimondii
gb|KJB83318.1|  hypothetical protein B456_013G242200                    244   2e-72   Gossypium raimondii
ref|XP_009587593.1|  PREDICTED: protein ECERIFERUM 3-like               244   2e-72   Nicotiana tomentosiformis
ref|XP_009387454.1|  PREDICTED: protein ECERIFERUM 3-like isoform X4    244   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004951702.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    244   2e-72   Setaria italica
ref|XP_008804902.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    244   2e-72   Phoenix dactylifera
ref|XP_003570600.1|  PREDICTED: protein ECERIFERUM 3-like               244   2e-72   Brachypodium distachyon [annual false brome]
ref|NP_001266321.1|  gl1 protein                                        244   3e-72   
ref|XP_008658046.1|  PREDICTED: uncharacterized protein LOC100192...    244   3e-72   
gb|EYU21788.1|  hypothetical protein MIMGU_mgv1a025856mg                244   3e-72   Erythranthe guttata [common monkey flower]
gb|ACN25689.1|  unknown                                                 244   3e-72   Zea mays [maize]
ref|XP_006845484.1|  hypothetical protein AMTR_s00019p00142280          242   4e-72   
dbj|BAJ85039.1|  predicted protein                                      243   4e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009387453.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3    244   5e-72   
ref|XP_009798188.1|  PREDICTED: protein ECERIFERUM 3-like               243   6e-72   Nicotiana sylvestris
dbj|BAB08850.1|  lipid transfer protein; glossy1 homolog                242   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390985.1|  PREDICTED: protein ECERIFERUM 3-like               243   7e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008643558.1|  PREDICTED: uncharacterized protein LOC100280...    245   7e-72   
ref|XP_002270946.1|  PREDICTED: protein ECERIFERUM 3                    243   7e-72   Vitis vinifera
ref|XP_006646964.1|  PREDICTED: protein ECERIFERUM 3-like               243   8e-72   
emb|CDX88639.1|  BnaA03g10100D                                          243   1e-71   
dbj|BAK04216.1|  predicted protein                                      240   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010483318.1|  PREDICTED: protein ECERIFERUM 3                    242   2e-71   Camelina sativa [gold-of-pleasure]
dbj|BAJ87617.1|  predicted protein                                      241   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010443488.1|  PREDICTED: protein ECERIFERUM 3-like               242   2e-71   Camelina sativa [gold-of-pleasure]
ref|NP_200588.2|  protein ECERIFERUM 3                                  241   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EMS67420.1|  Protein WAX2                                            243   3e-71   Triticum urartu
ref|XP_009766364.1|  PREDICTED: protein ECERIFERUM 3-like               241   4e-71   Nicotiana sylvestris
gb|EEC72610.1|  hypothetical protein OsI_06088                          241   5e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_009132107.1|  PREDICTED: protein ECERIFERUM 3-like               241   5e-71   Brassica rapa
ref|NP_001046080.1|  Os02g0178800                                       241   5e-71   
emb|CDY11848.1|  BnaC03g12740D                                          241   6e-71   Brassica napus [oilseed rape]
ref|XP_003549515.1|  PREDICTED: protein ECERIFERUM 3-like               241   6e-71   Glycine max [soybeans]
ref|XP_006279594.1|  hypothetical protein CARUB_v10026077mg             241   6e-71   Capsella rubella
emb|CDY32747.1|  BnaA02g08090D                                          240   6e-71   Brassica napus [oilseed rape]
gb|AAR90847.1|  glossy1 protein                                         240   6e-71   Zea mays [maize]
ref|XP_009120300.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    240   7e-71   Brassica rapa
tpg|DAA61563.1|  TPA: glossy1                                           240   7e-71   
emb|CDY51280.1|  BnaA10g11680D                                          240   7e-71   Brassica napus [oilseed rape]
ref|NP_001105247.1|  glossy1                                            240   8e-71   Zea mays [maize]
ref|XP_004242647.1|  PREDICTED: protein ECERIFERUM 3                    240   8e-71   Solanum lycopersicum
ref|XP_003563334.1|  PREDICTED: protein ECERIFERUM 3-like               240   8e-71   Brachypodium distachyon [annual false brome]
emb|CDY50795.1|  BnaCnng19590D                                          240   8e-71   Brassica napus [oilseed rape]
emb|CDY11847.1|  BnaC03g12730D                                          240   1e-70   Brassica napus [oilseed rape]
ref|XP_009417462.1|  PREDICTED: protein ECERIFERUM 3-like               239   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17538.1|  Protein WAX2                                            239   2e-70   Glycine soja [wild soybean]
emb|CDY02769.1|  BnaC02g11200D                                          239   3e-70   
ref|XP_009126813.1|  PREDICTED: protein ECERIFERUM 3                    238   3e-70   Brassica rapa
gb|AGT16346.1|  glossy1 protein                                         238   4e-70   Saccharum hybrid cultivar R570
dbj|BAJ85064.1|  predicted protein                                      239   4e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003542310.1|  PREDICTED: protein ECERIFERUM 3-like               238   4e-70   Glycine max [soybeans]
ref|XP_010452800.1|  PREDICTED: protein ECERIFERUM 3-like               238   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002308430.2|  hypothetical protein POPTR_0006s19140g             238   7e-70   
ref|XP_004507787.1|  PREDICTED: protein ECERIFERUM 3-like               238   8e-70   Cicer arietinum [garbanzo]
ref|XP_004956872.1|  PREDICTED: protein ECERIFERUM 3-like               237   1e-69   Setaria italica
emb|CDX88640.1|  BnaA03g10090D                                          236   2e-69   
ref|XP_010904609.1|  PREDICTED: protein ECERIFERUM 3-like               236   2e-69   Elaeis guineensis
ref|XP_006343719.1|  PREDICTED: protein ECERIFERUM 3-like               236   3e-69   Solanum tuberosum [potatoes]
ref|NP_001063227.1|  Os09g0426800                                       235   5e-69   
ref|XP_010914062.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         235   6e-69   Elaeis guineensis
gb|EAZ44800.1|  hypothetical protein OsJ_29433                          235   6e-69   Oryza sativa Japonica Group [Japonica rice]
gb|AFK49575.1|  unknown                                                 221   7e-69   Lotus japonicus
emb|CAN69291.1|  hypothetical protein VITISV_043141                     221   7e-69   Vitis vinifera
gb|KJB27033.1|  hypothetical protein B456_004G273200                    234   7e-69   Gossypium raimondii
ref|XP_010929210.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    234   8e-69   Elaeis guineensis
gb|KJB27032.1|  hypothetical protein B456_004G273200                    234   1e-68   Gossypium raimondii
ref|XP_010536953.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    234   1e-68   
gb|ACF79563.1|  unknown                                                 219   4e-68   Zea mays [maize]
gb|KHG04939.1|  Protein WAX2                                            233   4e-68   Gossypium arboreum [tree cotton]
ref|XP_010545441.1|  PREDICTED: protein ECERIFERUM 3 isoform X1         233   5e-68   Tarenaya hassleriana [spider flower]
gb|AEW67744.1|  WAX2 protein                                            218   9e-68   Eutrema halophilum
ref|XP_011070158.1|  PREDICTED: protein ECERIFERUM 3-like               232   9e-68   Sesamum indicum [beniseed]
gb|AAK68765.1|  Unknown protein                                         218   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002460243.1|  hypothetical protein SORBIDRAFT_02g025230          217   3e-67   
ref|XP_008775261.1|  PREDICTED: protein ECERIFERUM 3-like               226   4e-67   Phoenix dactylifera
ref|XP_009120299.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    230   7e-67   Brassica rapa
ref|XP_007154832.1|  hypothetical protein PHAVU_003G1516001g            215   2e-66   Phaseolus vulgaris [French bean]
dbj|BAK04110.1|  predicted protein                                      227   2e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578148.1|  PREDICTED: protein ECERIFERUM 3-like               227   5e-66   Brachypodium distachyon [annual false brome]
ref|XP_006350059.1|  PREDICTED: protein ECERIFERUM 3-like               226   2e-65   Solanum tuberosum [potatoes]
dbj|BAK02959.1|  predicted protein                                      224   5e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX88642.1|  BnaA03g10070D                                          224   1e-64   
gb|ADE77418.1|  unknown                                                 214   2e-64   Picea sitchensis
ref|XP_004973574.1|  PREDICTED: protein ECERIFERUM 3-like               221   8e-64   Setaria italica
emb|CAN62442.1|  hypothetical protein VITISV_009194                     218   8e-64   Vitis vinifera
gb|EYU37115.1|  hypothetical protein MIMGU_mgv1a021583mg                219   6e-63   Erythranthe guttata [common monkey flower]
ref|XP_010914063.1|  PREDICTED: protein ECERIFERUM 3 isoform X2         217   3e-62   Elaeis guineensis
gb|ADE75704.1|  unknown                                                 215   1e-61   Picea sitchensis
ref|XP_002961424.1|  hypothetical protein SELMODRAFT_164680             214   3e-61   Selaginella moellendorffii
ref|XP_002990278.1|  hypothetical protein SELMODRAFT_185167             214   4e-61   Selaginella moellendorffii
ref|XP_006836672.1|  hypothetical protein AMTR_s00088p00066300          207   1e-60   
ref|XP_004252089.1|  PREDICTED: protein ECERIFERUM 3-like               199   8e-59   Solanum lycopersicum
gb|EMT23422.1|  Protein WAX2                                            202   2e-56   
ref|XP_001781794.1|  predicted protein                                  199   3e-55   
ref|XP_001783415.1|  predicted protein                                  196   1e-54   
ref|XP_002975687.1|  hypothetical protein SELMODRAFT_103982             189   6e-52   Selaginella moellendorffii
ref|XP_002960347.1|  hypothetical protein SELMODRAFT_437448             187   3e-51   Selaginella moellendorffii
ref|XP_002967368.1|  hypothetical protein SELMODRAFT_408343             187   3e-51   Selaginella moellendorffii
ref|XP_009387452.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2    186   1e-50   
ref|XP_009132284.1|  PREDICTED: protein ECERIFERUM 3-like               185   2e-50   
ref|XP_009387450.1|  PREDICTED: protein ECERIFERUM 3-like isoform X1    186   2e-50   
ref|XP_001782380.1|  predicted protein                                  184   7e-50   
ref|XP_002993505.1|  hypothetical protein SELMODRAFT_137211             166   2e-47   
ref|XP_011012180.1|  PREDICTED: protein ECERIFERUM 3-like               171   8e-46   Populus euphratica
ref|XP_010103144.1|  Protein WAX2                                       172   1e-45   
gb|KHG04940.1|  Protein WAX2                                            171   2e-45   Gossypium arboreum [tree cotton]
ref|XP_005822223.1|  hypothetical protein GUITHDRAFT_158756             154   2e-39   Guillardia theta CCMP2712
ref|XP_003061467.1|  predicted protein                                  150   5e-38   Micromonas pusilla CCMP1545
ref|XP_003081883.1|  faceless pollen-1 (ISS)                            148   5e-37   
emb|CEF99557.1|  Uncharacterised domain Wax2, C-terminal                147   5e-37   Ostreococcus tauri
ref|XP_001420263.1|  predicted protein                                  146   1e-36   Ostreococcus lucimarinus CCE9901
ref|XP_002509294.1|  predicted protein                                  145   4e-36   Micromonas commoda
gb|AAA33934.1|  lipid transfer protein                                  139   2e-34   Senecio odorus
gb|AFW70401.1|  hypothetical protein ZEAMMB73_833522                    117   3e-29   
gb|EPS58637.1|  hypothetical protein M569_16175                         122   5e-29   Genlisea aurea
ref|XP_007509665.1|  predicted protein                                  119   7e-27   Bathycoccus prasinos
ref|XP_001756318.1|  predicted protein                                  110   1e-23   
ref|XP_002964260.1|  hypothetical protein SELMODRAFT_230422             107   7e-23   
gb|ADE77466.1|  unknown                                                 103   1e-22   Picea sitchensis
gb|ACN35049.1|  unknown                                                 105   2e-22   Zea mays [maize]
gb|ACN34356.1|  unknown                                                 106   2e-22   Zea mays [maize]
gb|KFK27319.1|  hypothetical protein AALP_AA8G367000                  97.4    4e-22   Arabis alpina [alpine rockcress]
ref|XP_002989550.1|  hypothetical protein SELMODRAFT_129942             101   1e-20   
ref|XP_011073243.1|  PREDICTED: protein ECERIFERUM 3-like isoform X3  94.4    2e-18   Sesamum indicum [beniseed]
dbj|BAF01865.1|  CER1 protein                                         90.5    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|EMT05122.1|  Protein WAX2                                          91.7    1e-17   
gb|EMS58990.1|  Protein WAX2                                          91.3    2e-17   Triticum urartu
ref|NP_850932.2|  protein ECERIFERUM 1                                90.5    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118866.1|  PREDICTED: protein ECERIFERUM 1                  90.1    9e-17   Brassica rapa
ref|NP_171723.2|  protein ECERIFERUM 1                                89.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KDO85390.1|  hypothetical protein CISIN_1g006590mg                 87.4    1e-16   Citrus sinensis [apfelsine]
ref|XP_006418509.1|  hypothetical protein EUTSA_v10009534mg           89.0    2e-16   
emb|CDY38059.1|  BnaCnng09200D                                        89.4    2e-16   Brassica napus [oilseed rape]
gb|AHD24918.1|  CER1                                                  89.0    2e-16   Brassica napus [oilseed rape]
gb|KFK27321.1|  hypothetical protein AALP_AA8G367700                  81.3    3e-16   Arabis alpina [alpine rockcress]
ref|XP_006306971.1|  hypothetical protein CARUB_v10008547mg           88.2    4e-16   
emb|CDP09364.1|  unnamed protein product                              87.8    4e-16   Coffea canephora [robusta coffee]
gb|KDO85389.1|  hypothetical protein CISIN_1g006590mg                 86.7    6e-16   Citrus sinensis [apfelsine]
gb|KDO85388.1|  hypothetical protein CISIN_1g006590mg                 86.7    7e-16   Citrus sinensis [apfelsine]
gb|AAB87721.1|  maize gl1 homolog                                     87.0    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006464363.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  86.7    1e-15   
ref|XP_006445499.1|  hypothetical protein CICLE_v10019265mg           86.7    1e-15   Citrus clementina [clementine]
ref|XP_006464361.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  86.7    1e-15   Citrus sinensis [apfelsine]
ref|XP_008804903.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  71.2    1e-15   
gb|KDO85387.1|  hypothetical protein CISIN_1g006590mg                 86.7    1e-15   Citrus sinensis [apfelsine]
ref|NP_001184890.1|  protein ECERIFERUM 1                             86.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KJB23545.1|  hypothetical protein B456_004G104100                  84.7    3e-15   Gossypium raimondii
gb|KFK42594.1|  hypothetical protein AALP_AA1G015600                  84.7    4e-15   Arabis alpina [alpine rockcress]
ref|XP_006464362.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  84.7    4e-15   Citrus sinensis [apfelsine]
ref|XP_007219469.1|  hypothetical protein PRUPE_ppa021389mg           81.3    5e-15   Prunus persica
ref|XP_010496698.1|  PREDICTED: protein ECERIFERUM 1-like             83.2    5e-15   
ref|XP_010512796.1|  PREDICTED: protein ECERIFERUM 1-like             82.4    6e-15   
ref|XP_008223563.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       84.0    7e-15   
gb|EEC81004.1|  hypothetical protein OsI_23762                        78.6    1e-14   Oryza sativa Indica Group [Indian rice]
gb|AIE57503.1|  CER1                                                  82.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008232261.1|  PREDICTED: protein ECERIFERUM 1-like             82.4    2e-14   Prunus mume [ume]
ref|XP_010920316.1|  PREDICTED: protein ECERIFERUM 1-like             82.0    3e-14   Elaeis guineensis
ref|XP_003530144.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  82.0    3e-14   Glycine max [soybeans]
ref|XP_002528208.1|  sterol desaturase, putative                      81.3    5e-14   
gb|KJB67450.1|  hypothetical protein B456_010G191300                  81.6    5e-14   Gossypium raimondii
ref|XP_010097746.1|  Protein WAX2                                     80.9    7e-14   
ref|XP_010535406.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  80.9    8e-14   Tarenaya hassleriana [spider flower]
ref|XP_010535407.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  80.9    8e-14   
ref|XP_004307280.1|  PREDICTED: protein ECERIFERUM 1-like             80.9    9e-14   Fragaria vesca subsp. vesca
ref|XP_007015845.1|  CER1 protein                                     80.5    1e-13   
ref|XP_007015842.1|  CER1 protein isoform 1                           80.5    1e-13   
ref|XP_004253517.1|  PREDICTED: protein CER1-like 1                   77.0    1e-13   Solanum lycopersicum
ref|XP_011469549.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  80.1    1e-13   Fragaria vesca subsp. vesca
gb|KDO42773.1|  hypothetical protein CISIN_1g041887mg                 76.6    2e-13   Citrus sinensis [apfelsine]
ref|XP_007218863.1|  hypothetical protein PRUPE_ppa002893mg           79.7    2e-13   Prunus persica
ref|XP_010496480.1|  PREDICTED: protein ECERIFERUM 1-like             79.3    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010496714.1|  PREDICTED: protein ECERIFERUM 1 isoform X2       79.3    3e-13   
ref|XP_010496713.1|  PREDICTED: protein ECERIFERUM 1 isoform X1       79.3    3e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010545442.1|  PREDICTED: protein ECERIFERUM 3 isoform X2       79.0    3e-13   
ref|XP_004308720.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  79.0    3e-13   Fragaria vesca subsp. vesca
ref|XP_010276564.1|  PREDICTED: protein ECERIFERUM 1-like             79.0    3e-13   Nelumbo nucifera [Indian lotus]
gb|KJB67446.1|  hypothetical protein B456_010G191100                  78.6    4e-13   Gossypium raimondii
ref|XP_010255638.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  78.6    5e-13   
ref|XP_006583526.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  78.2    6e-13   
gb|KJB67445.1|  hypothetical protein B456_010G191100                  78.2    6e-13   Gossypium raimondii
ref|XP_009384064.1|  PREDICTED: protein ECERIFERUM 1-like             77.8    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006410962.1|  hypothetical protein EUTSA_v10016375mg           77.8    8e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010505369.1|  PREDICTED: protein CER1-like 2                   77.8    8e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008438264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X3  77.4    9e-13   Cucumis melo [Oriental melon]
ref|XP_010520222.1|  PREDICTED: protein ECERIFERUM 1-like             77.8    9e-13   Tarenaya hassleriana [spider flower]
ref|XP_010517047.1|  PREDICTED: protein CER1-like 2 isoform X2        77.4    9e-13   
ref|XP_010517046.1|  PREDICTED: protein CER1-like 2 isoform X1        77.4    1e-12   Camelina sativa [gold-of-pleasure]
gb|KJB83321.1|  hypothetical protein B456_013G242200                  77.4    1e-12   Gossypium raimondii
ref|XP_009143457.1|  PREDICTED: protein CER1-like 2                   77.4    1e-12   Brassica rapa
emb|CDX74937.1|  BnaA05g06830D                                        77.4    1e-12   
ref|XP_008438262.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  77.4    1e-12   Cucumis melo [Oriental melon]
gb|KJB83322.1|  hypothetical protein B456_013G242200                  77.0    1e-12   Gossypium raimondii
ref|XP_010509285.1|  PREDICTED: protein CER1-like 2                   77.4    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010929211.1|  PREDICTED: protein ECERIFERUM 3-like isoform X2  77.0    1e-12   
gb|KHG03871.1|  Protein WAX2 -like protein                            77.0    1e-12   Gossypium arboreum [tree cotton]
gb|EMS58603.1|  hypothetical protein TRIUR3_05201                     76.6    1e-12   Triticum urartu
emb|CDX93352.1|  BnaC04g45440D                                        77.0    1e-12   
emb|CDX91381.1|  BnaC04g07690D                                        77.0    1e-12   
ref|XP_004307281.1|  PREDICTED: protein ECERIFERUM 1-like             77.0    1e-12   Fragaria vesca subsp. vesca
dbj|BAA11025.1|  CER1-like                                            72.8    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009586962.1|  PREDICTED: protein ECERIFERUM 1-like             77.0    2e-12   Nicotiana tomentosiformis
gb|EMT06855.1|  Protein WAX2                                          77.0    2e-12   
ref|XP_008364777.1|  PREDICTED: protein ECERIFERUM 1-like             76.3    3e-12   
ref|XP_009600723.1|  PREDICTED: protein ECERIFERUM 1-like             75.9    3e-12   Nicotiana tomentosiformis
ref|XP_008344085.1|  PREDICTED: protein ECERIFERUM 1-like             75.9    3e-12   Malus domestica [apple tree]
ref|XP_006445500.1|  hypothetical protein CICLE_v10019279mg           75.9    3e-12   Citrus clementina [clementine]
gb|EMS51791.1|  hypothetical protein TRIUR3_23680                     73.2    3e-12   Triticum urartu
ref|XP_006480707.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  75.9    4e-12   
ref|XP_004510148.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  75.5    4e-12   
ref|XP_006428971.1|  hypothetical protein CICLE_v10011291mg           75.5    4e-12   Citrus clementina [clementine]
ref|XP_009141683.1|  PREDICTED: protein CER1-like 2                   75.5    4e-12   Brassica rapa
ref|XP_003574039.1|  PREDICTED: protein ECERIFERUM 1-like             75.5    4e-12   
ref|XP_009376850.1|  PREDICTED: protein ECERIFERUM 1-like             75.5    5e-12   
emb|CDY55893.1|  BnaA04g29140D                                        75.5    5e-12   Brassica napus [oilseed rape]
ref|XP_009793428.1|  PREDICTED: protein ECERIFERUM 1-like             75.5    5e-12   Nicotiana sylvestris
ref|XP_009141689.1|  PREDICTED: protein CER1-like 2 isoform X2        75.5    5e-12   Brassica rapa
ref|XP_004510147.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  75.1    5e-12   Cicer arietinum [garbanzo]
emb|CDY55894.1|  BnaA04g29150D                                        75.1    5e-12   
ref|XP_009787252.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  75.1    6e-12   
ref|XP_009787251.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  75.1    6e-12   
ref|XP_003626834.1|  gl1-like protein                                 75.1    6e-12   
emb|CDX93353.1|  BnaC04g45430D                                        75.1    6e-12   
ref|XP_009141688.1|  PREDICTED: protein CER1-like 2 isoform X1        75.1    6e-12   
ref|XP_006354678.1|  PREDICTED: protein ECERIFERUM 1-like             74.7    7e-12   
ref|XP_006375527.1|  hypothetical protein POPTR_0014s15110g           74.7    7e-12   
ref|XP_004253318.1|  PREDICTED: protein CER1-like 2                   74.7    7e-12   
gb|KJB67449.1|  hypothetical protein B456_010G191200                  74.7    7e-12   
ref|XP_004982905.1|  PREDICTED: protein ECERIFERUM 1-like             74.7    8e-12   
ref|XP_009625188.1|  PREDICTED: protein ECERIFERUM 1-like             74.7    9e-12   
gb|KJB09060.1|  hypothetical protein B456_001G122000                  74.7    9e-12   
ref|XP_006354617.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  74.3    9e-12   
gb|AAC23640.1|  CER1-like protein                                     74.3    9e-12   
ref|XP_009797701.1|  PREDICTED: protein ECERIFERUM 1-like             74.3    9e-12   
emb|CBI16758.3|  unnamed protein product                              72.8    1e-11   
ref|XP_009337262.1|  PREDICTED: protein ECERIFERUM 1-like             74.3    1e-11   
ref|XP_007220541.1|  hypothetical protein PRUPE_ppa002903mg           74.3    1e-11   
gb|EEE56435.1|  hypothetical protein OsJ_05611                        73.9    1e-11   
ref|XP_007218858.1|  hypothetical protein PRUPE_ppa002770mg           74.3    1e-11   
ref|XP_009779400.1|  PREDICTED: protein ECERIFERUM 1-like             73.9    2e-11   
ref|XP_002881545.1|  hypothetical protein ARALYDRAFT_321478           73.6    2e-11   
ref|XP_009612940.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  73.2    2e-11   
ref|XP_009141690.1|  PREDICTED: protein CER1-like 2 isoform X3        73.6    2e-11   
gb|KDO85382.1|  hypothetical protein CISIN_1g006590mg                 73.2    2e-11   
ref|XP_008232308.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    2e-11   
gb|AFW64032.1|  hypothetical protein ZEAMMB73_844277                  72.8    2e-11   
gb|KJB76251.1|  hypothetical protein B456_012G081600                  73.2    2e-11   
ref|XP_004229696.2|  PREDICTED: protein ECERIFERUM 1-like             73.6    2e-11   
ref|XP_004976194.1|  PREDICTED: protein ECERIFERUM 1-like             73.2    3e-11   
ref|XP_007041185.1|  Fatty acid hydroxylase superfamily isoform 1     73.2    3e-11   
ref|XP_010496479.1|  PREDICTED: protein CER1-like 1                   72.4    3e-11   
gb|KJB76256.1|  hypothetical protein B456_012G081600                  73.2    3e-11   
gb|KHG12604.1|  Protein WAX2 -like protein                            73.2    3e-11   
ref|XP_007041186.1|  Fatty acid hydroxylase superfamily isoform 2     73.2    3e-11   
gb|ACG47659.1|  CER1                                                  73.2    3e-11   
gb|AFK43395.1|  unknown                                               68.9    3e-11   
gb|KJB76257.1|  hypothetical protein B456_012G081600                  73.2    3e-11   
ref|XP_002263787.2|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   
ref|XP_008438263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  72.8    3e-11   
ref|XP_007041192.1|  CER1 protein                                     72.8    3e-11   
ref|XP_007041194.1|  CER1 protein                                     72.8    3e-11   
ref|XP_008438253.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   
ref|XP_008245904.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  72.8    3e-11   
ref|XP_004133955.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    3e-11   
ref|XP_009612939.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  72.8    3e-11   
gb|AFW64026.1|  hypothetical protein ZEAMMB73_844277                  72.8    4e-11   
ref|XP_007008729.1|  Fatty acid hydroxylase superfamily isoform 1     72.8    4e-11   
gb|KFK36660.1|  hypothetical protein AALP_AA4G153400                  72.8    4e-11   
ref|XP_008676840.1|  PREDICTED: uncharacterized protein LOC100273...  72.8    4e-11   
gb|AFW64028.1|  hypothetical protein ZEAMMB73_844277                  72.8    4e-11   
ref|XP_006354616.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    4e-11   
ref|XP_009376851.1|  PREDICTED: protein ECERIFERUM 1-like             72.8    4e-11   
ref|XP_008245903.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  72.4    4e-11   
ref|NP_001141595.1|  uncharacterized protein LOC100273712             72.4    4e-11   
ref|XP_008232283.1|  PREDICTED: protein ECERIFERUM 1-like             72.4    4e-11   
ref|XP_008676841.1|  PREDICTED: uncharacterized protein LOC100273...  72.4    4e-11   
ref|XP_010042043.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    4e-11   
ref|XP_006857475.1|  hypothetical protein AMTR_s00067p00190600        72.4    4e-11   
gb|KCW76791.1|  hypothetical protein EUGRSUZ_D011442                  71.6    5e-11   
ref|XP_009410811.1|  PREDICTED: protein ECERIFERUM 1-like             72.4    5e-11   
ref|XP_010324966.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  72.4    5e-11   
ref|XP_004229695.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  72.0    5e-11   
ref|NP_973742.1|  protein CER1-like 1                                 72.0    5e-11   
ref|XP_007220536.1|  hypothetical protein PRUPE_ppa002824mg           72.0    5e-11   
ref|NP_171721.3|  protein CER1-like 1                                 72.0    5e-11   
gb|AAC24373.1|  CER1-like protein                                     72.0    5e-11   
emb|CAA65200.1|  CER1-like                                            72.0    6e-11   
ref|XP_009614034.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    6e-11   
ref|XP_008338420.1|  PREDICTED: protein ECERIFERUM 1-like             72.0    6e-11   
gb|EPS71900.1|  hypothetical protein M569_02856                       72.0    6e-11   
gb|ACA14353.1|  TCER1                                                 72.0    6e-11   
ref|NP_001047459.1|  Os02g0621300                                     72.0    6e-11   
gb|EEC73617.1|  hypothetical protein OsI_08114                        72.0    7e-11   
gb|EEE57393.1|  hypothetical protein OsJ_07566                        72.0    7e-11   
gb|KHG15491.1|  Protein WAX2 -like protein                            72.0    7e-11   
emb|CAN63491.1|  hypothetical protein VITISV_032726                   71.2    7e-11   
ref|XP_004510150.1|  PREDICTED: protein ECERIFERUM 1-like             71.6    7e-11   
gb|KGN56666.1|  hypothetical protein Csa_3G127770                     71.6    9e-11   
ref|XP_010496697.1|  PREDICTED: protein CER1-like 1                   71.6    9e-11   
ref|XP_011005107.1|  PREDICTED: protein ECERIFERUM 1-like             71.6    9e-11   
gb|KHN30013.1|  Protein WAX2                                          71.2    9e-11   
ref|NP_181306.3|  protein CER1-like 2                                 71.2    9e-11   
gb|EPS60467.1|  hypothetical protein M569_14337                       71.2    1e-10   
ref|XP_010493027.1|  PREDICTED: protein CER1-like 1                   71.2    1e-10   
ref|XP_007041184.1|  Fatty acid hydroxylase superfamily               71.6    1e-10   
ref|XP_002265685.2|  PREDICTED: protein ECERIFERUM 1-like             71.2    1e-10   
ref|XP_010052726.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   
ref|XP_008375723.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   
ref|XP_007041196.1|  CER1 protein                                     70.9    1e-10   
ref|XP_002262785.1|  PREDICTED: protein ECERIFERUM 1                  70.9    1e-10   
gb|EMT07276.1|  Protein WAX2                                          70.9    1e-10   
gb|EYU42308.1|  hypothetical protein MIMGU_mgv1a002931mg              70.9    1e-10   
ref|XP_011093465.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    1e-10   
ref|XP_006857470.1|  hypothetical protein AMTR_s00067p00188650        70.9    2e-10   
ref|XP_010054531.1|  PREDICTED: protein ECERIFERUM 1-like             70.9    2e-10   
ref|XP_004164810.1|  PREDICTED: LOW QUALITY PROTEIN: protein CER1...  66.2    2e-10   
ref|XP_002265189.2|  PREDICTED: protein ECERIFERUM 1                  70.5    2e-10   
gb|KEH17984.1|  fatty acid hydroxylase superfamily protein            70.5    2e-10   
ref|XP_002464501.1|  hypothetical protein SORBIDRAFT_01g019590        70.5    2e-10   
emb|CDP09363.1|  unnamed protein product                              70.5    2e-10   
ref|XP_004171948.1|  PREDICTED: protein ECERIFERUM 1-like             70.1    2e-10   
gb|KCW76795.1|  hypothetical protein EUGRSUZ_D01146                   68.2    2e-10   
emb|CDY07774.1|  BnaA03g17370D                                        70.1    3e-10   
gb|EYU40308.1|  hypothetical protein MIMGU_mgv1a002952mg              70.1    3e-10   
emb|CAA65199.1|  CER1-like                                            70.1    3e-10   
emb|CAN83072.1|  hypothetical protein VITISV_026148                   68.9    3e-10   
emb|CDX79754.1|  BnaC03g20900D                                        70.1    3e-10   
ref|XP_006306552.1|  hypothetical protein CARUB_v10012639mg           70.1    3e-10   
ref|XP_002320584.1|  ECERIFERUM 1 family protein                      69.7    3e-10   
ref|XP_006375524.1|  hypothetical protein POPTR_0014s15080g           69.7    3e-10   
ref|XP_009760057.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  69.7    3e-10   
ref|XP_002448160.1|  hypothetical protein SORBIDRAFT_06g022320        69.7    3e-10   
ref|XP_011012757.1|  PREDICTED: protein ECERIFERUM 1-like             69.7    3e-10   
ref|XP_009760058.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  69.7    3e-10   
ref|XP_009337264.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  69.7    3e-10   
ref|XP_009133199.1|  PREDICTED: protein CER1-like 2                   69.7    3e-10   
ref|XP_009337263.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  69.7    4e-10   
ref|XP_010479268.1|  PREDICTED: protein CER1-like 1                   69.7    4e-10   
ref|XP_006295717.1|  hypothetical protein CARUB_v10024836mg           69.3    4e-10   
ref|XP_004134362.1|  PREDICTED: protein ECERIFERUM 1-like             69.3    4e-10   
ref|XP_006361513.1|  PREDICTED: protein ECERIFERUM 1-like             69.3    4e-10   
gb|EMT33049.1|  Protein WAX2                                          69.3    4e-10   
gb|KGN56664.1|  hypothetical protein Csa_3G127750                     69.3    4e-10   
ref|XP_006375521.1|  hypothetical protein POPTR_0014s15050g           69.3    4e-10   
gb|EYU42307.1|  hypothetical protein MIMGU_mgv1a003396mg              69.3    5e-10   
ref|XP_007134354.1|  hypothetical protein PHAVU_010G040500g           69.3    5e-10   
gb|KFK42593.1|  hypothetical protein AALP_AA1G015500                  68.9    6e-10   
ref|XP_002262647.1|  PREDICTED: protein ECERIFERUM 1                  68.9    6e-10   
ref|XP_002892019.1|  hypothetical protein ARALYDRAFT_470048           68.9    6e-10   
ref|XP_006357723.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    7e-10   
ref|XP_006354618.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  68.6    7e-10   
ref|XP_010054530.1|  PREDICTED: protein ECERIFERUM 1-like             68.2    8e-10   
gb|AFV29806.1|  sterol desaturase-like protein                        65.5    9e-10   
ref|XP_004252845.1|  PREDICTED: protein ECERIFERUM 1                  68.6    9e-10   
ref|XP_011085147.1|  PREDICTED: protein ECERIFERUM 1-like             68.6    9e-10   
ref|XP_010691969.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  68.2    1e-09   
gb|EMS48099.1|  Protein WAX2                                          68.2    1e-09   
gb|ACG35856.1|  CER1                                                  68.2    1e-09   
gb|KHN13741.1|  Protein WAX2                                          67.8    1e-09   
ref|XP_010539481.1|  PREDICTED: protein CER1-like 2                   68.2    1e-09   
ref|XP_006647531.1|  PREDICTED: protein ECERIFERUM 1-like             68.2    1e-09   
ref|XP_003633900.1|  PREDICTED: protein ECERIFERUM 1-like             68.2    1e-09   
ref|XP_008438252.1|  PREDICTED: protein ECERIFERUM 1-like             68.2    1e-09   
emb|CBI16761.3|  unnamed protein product                              68.2    1e-09   
ref|XP_011093466.1|  PREDICTED: protein ECERIFERUM 1-like             67.4    2e-09   
ref|XP_010255640.1|  PREDICTED: protein ECERIFERUM 1-like             67.4    2e-09   
ref|XP_009337266.1|  PREDICTED: protein ECERIFERUM 1-like             67.0    2e-09   
ref|NP_001146661.1|  uncharacterized protein LOC100280261             67.4    2e-09   
ref|XP_010691968.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  67.4    2e-09   
ref|XP_002443045.1|  hypothetical protein SORBIDRAFT_08g006850        67.0    2e-09   
gb|AFV29804.1|  sterol desaturase-like protein                        64.3    3e-09   
ref|XP_002526511.1|  sterol desaturase, putative                      66.6    3e-09   
ref|XP_010511349.1|  PREDICTED: protein CER1-like 1                   66.6    3e-09   
ref|XP_004234847.1|  PREDICTED: protein ECERIFERUM 1-like             66.6    3e-09   
ref|XP_010052731.1|  PREDICTED: protein ECERIFERUM 1-like             66.6    4e-09   
ref|XP_004953128.1|  PREDICTED: protein ECERIFERUM 1-like             66.6    4e-09   
gb|EMS58051.1|  Protein WAX2                                          66.2    4e-09   
ref|XP_010276559.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    4e-09   
ref|XP_008232262.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    4e-09   
ref|XP_009586975.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    5e-09   
gb|AFV29812.1|  sterol desaturase-like protein                        63.5    5e-09   
ref|XP_010480305.1|  PREDICTED: protein CER1-like 1 isoform X1        66.2    5e-09   
ref|XP_008796440.1|  PREDICTED: uncharacterized protein LOC103711898  66.6    5e-09   
ref|XP_010480306.1|  PREDICTED: protein CER1-like 1 isoform X2        66.2    5e-09   
gb|KJB76287.1|  hypothetical protein B456_012G081500                  65.9    6e-09   
ref|XP_010255641.1|  PREDICTED: protein ECERIFERUM 1-like             65.9    6e-09   
gb|KJB76286.1|  hypothetical protein B456_012G081500                  65.9    6e-09   
ref|XP_006306997.1|  hypothetical protein CARUB_v10008574mg           65.9    7e-09   
gb|EEC77626.1|  hypothetical protein OsI_16615                        65.9    7e-09   
tpg|DAA60918.1|  TPA: putative ribosomal protein S4 (RPS4A) famil...  65.5    7e-09   
gb|EEE61327.1|  hypothetical protein OsJ_15439                        65.5    8e-09   
ref|XP_006354620.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  65.5    8e-09   
ref|XP_006354619.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  65.5    8e-09   
ref|XP_007134355.1|  hypothetical protein PHAVU_010G040600g           65.5    9e-09   
ref|XP_006652506.1|  PREDICTED: protein ECERIFERUM 1-like             65.1    9e-09   
ref|XP_003575378.1|  PREDICTED: protein ECERIFERUM 1-like             65.1    1e-08   
emb|CAE03390.2|  OSJNBa0004N05.14                                     65.1    1e-08   
ref|XP_002454767.1|  hypothetical protein SORBIDRAFT_04g036940        64.7    2e-08   
gb|KDP28917.1|  hypothetical protein JCGZ_14688                       64.3    2e-08   
gb|AFV29820.1|  sterol desaturase-like protein                        62.0    2e-08   
ref|XP_011466122.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  64.3    2e-08   
ref|XP_011466125.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  64.3    2e-08   
ref|XP_010414810.1|  PREDICTED: protein CER1-like 1 isoform X1        64.3    2e-08   
gb|EYU40310.1|  hypothetical protein MIMGU_mgv1a003047mg              63.9    3e-08   
ref|XP_010414811.1|  PREDICTED: protein CER1-like 1 isoform X2        63.9    3e-08   
gb|EYU40309.1|  hypothetical protein MIMGU_mgv1a003047mg              63.9    3e-08   
ref|XP_010936011.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  63.9    3e-08   
gb|ABD28318.1|  Sterol desaturase, putative                           60.5    3e-08   
gb|EMT04955.1|  Protein WAX2                                          63.5    3e-08   
ref|XP_002454185.1|  hypothetical protein SORBIDRAFT_04g026320        63.5    3e-08   
gb|ABG66132.1|  CER1 protein, putative, expressed                     63.5    4e-08   
emb|CBI16760.3|  unnamed protein product                              63.9    4e-08   
ref|XP_010936012.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  63.5    4e-08   
gb|EEC67150.1|  hypothetical protein OsI_33995                        63.5    4e-08   
gb|KCW76761.1|  hypothetical protein EUGRSUZ_D01120                   63.5    4e-08   
ref|NP_001064826.1|  Os10g0471100                                     63.2    4e-08   
ref|XP_010247895.1|  PREDICTED: protein ECERIFERUM 1-like             63.2    6e-08   
gb|ACR38546.1|  unknown                                               62.8    7e-08   
gb|ACN31737.1|  unknown                                               62.8    7e-08   
ref|XP_009788099.1|  PREDICTED: protein CER1-like 1                   59.3    7e-08   
ref|NP_001048490.1|  Os02g0814200                                     62.8    8e-08   
gb|EAY87991.1|  hypothetical protein OsI_09413                        62.8    8e-08   
ref|XP_010052747.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  62.4    8e-08   
ref|XP_010052746.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  62.4    8e-08   
gb|AAC24374.1|  CER1 protein                                          62.4    9e-08   
gb|ABG47420.1|  putative CER1                                         62.4    1e-07   
dbj|BAJ85488.1|  predicted protein                                    62.4    1e-07   
gb|EMS68717.1|  Protein WAX2                                          62.0    1e-07   
gb|KDO85383.1|  hypothetical protein CISIN_1g006590mg                 62.0    1e-07   
ref|XP_006418508.1|  hypothetical protein EUTSA_v10007056mg           62.0    1e-07   
ref|XP_004145021.1|  PREDICTED: protein ECERIFERUM 1-like             62.0    1e-07   
ref|XP_004168237.1|  PREDICTED: protein ECERIFERUM 1-like             61.6    1e-07   
emb|CBI16765.3|  unnamed protein product                              58.2    2e-07   
ref|XP_006365794.1|  PREDICTED: protein ECERIFERUM 1-like             61.6    2e-07   
gb|EMS58604.1|  Protein WAX2                                          61.6    2e-07   
ref|XP_003574037.1|  PREDICTED: protein ECERIFERUM 1-like             61.6    2e-07   
ref|XP_007041187.1|  Fatty acid hydroxylase superfamily isoform 3     61.6    2e-07   
ref|XP_003529007.1|  PREDICTED: protein ECERIFERUM 1-like             60.8    3e-07   
ref|XP_008779294.1|  PREDICTED: protein ECERIFERUM 1-like             59.7    3e-07   



>ref|XP_004169575.1| PREDICTED: protein ECERIFERUM 3-like, partial [Cucumis sativus]
Length=218

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAPVDCQ +L
Sbjct  34   LNEIPKDVKEVFLTGATSKLGRAIALYLCRRKVRVLMLTLSTERFEKIQKEAPVDCQNYL  93

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  94   VQVTKYQAARNCKTWIVGKWITPREQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  153

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+ID+VWEAALK+GLK
Sbjct  154  PEDVQGLGNCEYTMSRGVVHACHAGGVVHHLEGWTHHEVGALDVDRIDLVWEAALKHGLK  213

Query  237  PL  232
            P+
Sbjct  214  PV  215



>ref|XP_009609207.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Nicotiana tomentosiformis]
Length=640

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYLARRRVRVLMLTQSTERF+KIQ EAP DCQKFL
Sbjct  455  LNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTQSTERFMKIQREAPADCQKFL  514

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQV+KYQ AK CKTWI+GKWATPREQSWAPSGTHF+QFVVPP+I FRRD TYGKLAAM+L
Sbjct  515  VQVSKYQGAKQCKTWILGKWATPREQSWAPSGTHFYQFVVPPVIPFRRDSTYGKLAAMRL  574

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEYTMGRGVVHACHAGG+VH LEGWTHHEVGAI+VDQIDVVWEAALK+GLK
Sbjct  575  PKDVTGLGTCEYTMGRGVVHACHAGGLVHHLEGWTHHEVGAIDVDQIDVVWEAALKHGLK  634

Query  237  PL  232
            PL
Sbjct  635  PL  636



>ref|XP_009609208.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Nicotiana tomentosiformis]
Length=638

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYLARRRVRVLMLTQSTERF+KIQ EAP DCQKFL
Sbjct  453  LNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTQSTERFMKIQREAPADCQKFL  512

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQV+KYQ AK CKTWI+GKWATPREQSWAPSGTHF+QFVVPP+I FRRD TYGKLAAM+L
Sbjct  513  VQVSKYQGAKQCKTWILGKWATPREQSWAPSGTHFYQFVVPPVIPFRRDSTYGKLAAMRL  572

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEYTMGRGVVHACHAGG+VH LEGWTHHEVGAI+VDQIDVVWEAALK+GLK
Sbjct  573  PKDVTGLGTCEYTMGRGVVHACHAGGLVHHLEGWTHHEVGAIDVDQIDVVWEAALKHGLK  632

Query  237  PL  232
            PL
Sbjct  633  PL  634



>ref|XP_009788358.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=638

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYLARRRVRVLMLTQSTERF+KI+ EAP DCQKFL
Sbjct  453  LNEIPRDVHEVFLTGATSKLGRAIALYLARRRVRVLMLTQSTERFMKIRREAPADCQKFL  512

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQV KYQ AK CKTWI+GKWATPREQSWAPSGTHF+QFVVPP+I FRRDCTYGKLAAM+L
Sbjct  513  VQVPKYQGAKQCKTWILGKWATPREQSWAPSGTHFYQFVVPPVIPFRRDCTYGKLAAMRL  572

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLGSCEYTMGRGVVHACHAGG++H LEGWTHHEVGAI+VDQIDVVWEAALK+G K
Sbjct  573  PKDVTGLGSCEYTMGRGVVHACHAGGLLHLLEGWTHHEVGAIDVDQIDVVWEAALKHGFK  632

Query  237  PL  232
            PL
Sbjct  633  PL  634



>ref|XP_011082697.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=635

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYLAR++V+VLMLT STERF KIQ EAP DCQK+L
Sbjct  454  LNEIPQDVGEVFLTGATSKLGRAIALYLARQKVKVLMLTLSTERFAKIQKEAPADCQKYL  513

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWIIGKW  PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  514  VQVTKYQAAQHCKTWIIGKWLMPREQYWAPSGTHFHQFVVPPIIPFRRDCTYGKLAAMRL  573

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLG+CEYTM RGVVHACHAGG+VH LEGW HHEVGAINVDQIDVVWEAAL++GLK
Sbjct  574  PDDVEGLGTCEYTMERGVVHACHAGGLVHFLEGWKHHEVGAINVDQIDVVWEAALRHGLK  633

Query  237  PL  232
            PL
Sbjct  634  PL  635



>gb|KJB23542.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=384

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  200  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  259

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+QSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  260  VQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  319

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+GL+
Sbjct  320  PDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVGAIDVDRIDIVWKAALKHGLR  379

Query  237  PL*RM  223
            P+  M
Sbjct  380  PVSSM  384



>ref|XP_006341693.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=646

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYLARRRVRVLMLT+STERF+KIQ EAPV+CQK+L
Sbjct  461  LNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTKSTERFMKIQREAPVECQKYL  520

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVT  + AK CKTWIIGKW+TPREQSWAPSGTHF+QFVVPPII FRRDCTYGKLAAM+L
Sbjct  521  VQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVVPPIIPFRRDCTYGKLAAMRL  580

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEYTMGR +VHACHAGG+VH LEGWTHHEVGAI+VDQIDVVWEAALK+GLK
Sbjct  581  PKDVTGLGTCEYTMGRDIVHACHAGGLVHLLEGWTHHEVGAIDVDQIDVVWEAALKHGLK  640

Query  237  PL  232
            PL
Sbjct  641  PL  642



>ref|XP_011073242.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Sesamum indicum]
Length=641

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DVDEVFLTGATSKLGRAIALYLARR+V+VLMLT S ERF+KIQ EAPVDCQK+L
Sbjct  460  LNEIPKDVDEVFLTGATSKLGRAIALYLARRKVKVLMLTLSKERFLKIQEEAPVDCQKYL  519

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAKHCKTWIIGKW TPR+Q  APSGTHFHQFVVPPII FRRDC YGKLAAM+L
Sbjct  520  VQVTKYQAAKHCKTWIIGKWTTPRQQYHAPSGTHFHQFVVPPIIPFRRDCKYGKLAAMRL  579

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VDQIDVVWEAAL++GLK
Sbjct  580  PEDVEGLGSCEYTMERGVVHACHAGGVVHLLEGWKHHEVGAIDVDQIDVVWEAALRHGLK  639

Query  237  PL  232
            PL
Sbjct  640  PL  641



>ref|XP_011073241.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Sesamum indicum]
Length=643

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DVDEVFLTGATSKLGRAIALYLARR+V+VLMLT S ERF+KIQ EAPVDCQK+L
Sbjct  462  LNEIPKDVDEVFLTGATSKLGRAIALYLARRKVKVLMLTLSKERFLKIQEEAPVDCQKYL  521

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAKHCKTWIIGKW TPR+Q  APSGTHFHQFVVPPII FRRDC YGKLAAM+L
Sbjct  522  VQVTKYQAAKHCKTWIIGKWTTPRQQYHAPSGTHFHQFVVPPIIPFRRDCKYGKLAAMRL  581

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VDQIDVVWEAAL++GLK
Sbjct  582  PEDVEGLGSCEYTMERGVVHACHAGGVVHLLEGWKHHEVGAIDVDQIDVVWEAALRHGLK  641

Query  237  PL  232
            PL
Sbjct  642  PL  643



>ref|XP_010318689.1| PREDICTED: protein ECERIFERUM 3 isoform X3 [Solanum lycopersicum]
Length=607

 Score =   261 bits (668),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYLARRRVRVLMLT+STERF+KIQ EA V+CQK+L
Sbjct  422  LNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTKSTERFMKIQREATVECQKYL  481

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVT  + AK CKTWIIGKW+TPREQSWAPSGTHF+QFVVPPII FRRDCTYGKLAAM+L
Sbjct  482  VQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVVPPIIPFRRDCTYGKLAAMRL  541

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEYTMGRG+VHACHAGG+VH LEGWTHHEVGAI+VDQIDVVWEAALK+GLK
Sbjct  542  PKDVTGLGTCEYTMGRGIVHACHAGGLVHLLEGWTHHEVGAIDVDQIDVVWEAALKHGLK  601

Query  237  PL  232
            PL
Sbjct  602  PL  603



>ref|XP_010318688.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Solanum lycopersicum]
Length=641

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYLARRRVRVLMLT+STERF+KIQ EA V+CQK+L
Sbjct  456  LNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTKSTERFMKIQREATVECQKYL  515

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVT  + AK CKTWIIGKW+TPREQSWAPSGTHF+QFVVPPII FRRDCTYGKLAAM+L
Sbjct  516  VQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVVPPIIPFRRDCTYGKLAAMRL  575

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEYTMGRG+VHACHAGG+VH LEGWTHHEVGAI+VDQIDVVWEAALK+GLK
Sbjct  576  PKDVTGLGTCEYTMGRGIVHACHAGGLVHLLEGWTHHEVGAIDVDQIDVVWEAALKHGLK  635

Query  237  PL  232
            PL
Sbjct  636  PL  637



>ref|XP_004235875.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Solanum lycopersicum]
Length=643

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYLARRRVRVLMLT+STERF+KIQ EA V+CQK+L
Sbjct  458  LNEIPRDVNEVFLTGATSKLGRAIALYLARRRVRVLMLTKSTERFMKIQREATVECQKYL  517

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVT  + AK CKTWIIGKW+TPREQSWAPSGTHF+QFVVPPII FRRDCTYGKLAAM+L
Sbjct  518  VQVTNCKEAKQCKTWIIGKWSTPREQSWAPSGTHFYQFVVPPIIPFRRDCTYGKLAAMRL  577

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEYTMGRG+VHACHAGG+VH LEGWTHHEVGAI+VDQIDVVWEAALK+GLK
Sbjct  578  PKDVTGLGTCEYTMGRGIVHACHAGGLVHLLEGWTHHEVGAIDVDQIDVVWEAALKHGLK  637

Query  237  PL  232
            PL
Sbjct  638  PL  639



>ref|XP_011079338.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=625

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LNDIP DV EVFLTGATSKLGRAIALYL R+RVRVLMLT STERF KIQ+EAP DCQK+L
Sbjct  440  LNDIPKDVSEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFRKIQTEAPADCQKYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQ++AP+GTHFHQFVVPPI+QFRRDCTYG LAAMKL
Sbjct  500  VQVTKYQAAQNCKTWIVGKWITPREQNFAPAGTHFHQFVVPPILQFRRDCTYGDLAAMKL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGVVHACHAGGVVHALEGW+HHEVGAI+VD+ID+VW+AALKNGLK
Sbjct  560  PEDVEGLGCCEYTMERGVVHACHAGGVVHALEGWSHHEVGAIDVDRIDLVWKAALKNGLK  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>gb|EYU24562.1| hypothetical protein MIMGU_mgv1a002930mg [Erythranthe guttata]
Length=624

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L++IP +VDEVFLTGATSKLGRAIALYLARR V+VLMLT STERF KIQ EAP++CQK+L
Sbjct  443  LHEIPQNVDEVFLTGATSKLGRAIALYLARRNVKVLMLTLSTERFTKIQKEAPIECQKYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCK WIIGKW TPREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAMKL
Sbjct  503  VQVTKYQAAQHCKNWIIGKWTTPREQYWAPKGTHFHQFVVPPIIPFRRDCTYGKLAAMKL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P D++GLGSCEYTM RGVVHACHAGGV+H LEGW H+EVGAINVDQIDVVW+AALK+GLK
Sbjct  563  PNDIQGLGSCEYTMERGVVHACHAGGVIHFLEGWKHNEVGAINVDQIDVVWKAALKHGLK  622

Query  237  PL  232
            P+
Sbjct  623  PI  624



>ref|XP_004149879.1| PREDICTED: protein ECERIFERUM 3-like [Cucumis sativus]
 gb|KGN65271.1| hypothetical protein Csa_1G294020 [Cucumis sativus]
Length=625

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAPVDCQ +L
Sbjct  441  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRKVRVLMLTLSTERFEKIQKEAPVDCQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  501  VQVTKYQAARNCKTWIVGKWITPREQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+ID+VWEAALK+GLK
Sbjct  561  PEDVQGLGNCEYTMSRGVVHACHAGGVVHHLEGWTHHEVGALDVDRIDLVWEAALKHGLK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_008443806.1| PREDICTED: protein ECERIFERUM 3 [Cucumis melo]
Length=611

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAP DCQ +L
Sbjct  427  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRKVRVLMLTLSTERFEKIQKEAPADCQNYL  486

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  487  VQVTKYQAARNCKTWIVGKWITPREQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  546

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+ID+VWEAALK+GLK
Sbjct  547  PEDVQGLGNCEYTMSRGVVHACHAGGVVHHLEGWTHHEVGALDVDRIDLVWEAALKHGLK  606

Query  237  PL  232
            P+
Sbjct  607  PV  608



>emb|CDO98263.1| unnamed protein product [Coffea canephora]
Length=675

 Score =   260 bits (664),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DVDEVFLTG+TSKLGRAIALYLARRRVRVLMLTQSTERF+KIQ EAP + QKFL
Sbjct  486  LNEIPRDVDEVFLTGSTSKLGRAIALYLARRRVRVLMLTQSTERFLKIQKEAPEELQKFL  545

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAK CKTWIIGKW TP EQSWAPSGTHFHQFVVPP+I FRRDCT+GKLAAM+L
Sbjct  546  VQVTKYQAAKQCKTWIIGKWTTPGEQSWAPSGTHFHQFVVPPVIPFRRDCTFGKLAAMRL  605

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VDQIDVVW+AAL++GLK
Sbjct  606  PEDVEGLGSCEYTMERGVVHACHAGGVVHFLEGWKHHEVGAIDVDQIDVVWKAALRHGLK  665

Query  237  PL  232
            P+
Sbjct  666  PM  667



>gb|KJB23543.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=611

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  427  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  486

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+QSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  487  VQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  546

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+GL+
Sbjct  547  PDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVGAIDVDRIDIVWKAALKHGLR  606

Query  237  PL*RM  223
            P+  M
Sbjct  607  PVSSM  611



>gb|KJB23541.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=624

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  440  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+QSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+GL+
Sbjct  560  PDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVGAIDVDRIDIVWKAALKHGLR  619

Query  237  PL*RM  223
            P+  M
Sbjct  620  PVSSM  624



>gb|KJB23544.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=625

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  441  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+QSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  501  VQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+GL+
Sbjct  561  PDDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVGAIDVDRIDIVWKAALKHGLR  620

Query  237  PL*RM  223
            P+  M
Sbjct  621  PVSSM  625



>ref|XP_007013964.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
 gb|EOY31583.1| Fatty acid hydroxylase superfamily [Theobroma cacao]
Length=632

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  440  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQKEAPADCQNYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQSWAPSG HFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYQAAQNCKTWIVGKWITPREQSWAPSGAHFHQFVVPPILAFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VWEAALK+GL+
Sbjct  560  PDDVEGLGSCEYTMERGVVHACHAGGVVHKLEGWTHHEVGAIDVDRIDLVWEAALKHGLR  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>gb|KDP38762.1| hypothetical protein JCGZ_04115 [Jatropha curcas]
Length=628

 Score =   256 bits (654),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL +RRVRVLMLT STERF KIQ EAP+DCQ +L
Sbjct  443  LNEIPKDVKEVFLTGATSKLGRAIALYLCQRRVRVLMLTLSTERFHKIQKEAPLDCQSYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQSWAP G HFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  503  VQVTKYQAAQNCKTWIVGKWITPREQSWAPKGAHFHQFVVPPILSFRRDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW AALKNGLK
Sbjct  563  PEDVQGLGSCEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDRIDLVWNAALKNGLK  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>gb|KHG27245.1| Protein WAX2 [Gossypium arboreum]
Length=624

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  440  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+QSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+GL+
Sbjct  560  PDDVKGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVGAIDVDRIDIVWKAALKHGLR  619

Query  237  PL*RM  223
            P+  M
Sbjct  620  PVSSM  624



>ref|XP_010687696.1| PREDICTED: protein ECERIFERUM 3 [Beta vulgaris subsp. vulgaris]
Length=623

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V+EVFLTGATSKLGRAIALYL+R+ VRVLMLT STERF KIQ EAPVDCQK+L
Sbjct  442  LNEIPDNVEEVFLTGATSKLGRAIALYLSRKHVRVLMLTLSTERFQKIQKEAPVDCQKYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAK+CK WI+GKW TPREQSWAP G HFHQFVVPPI+ FRRDCTYG LAAMKL
Sbjct  502  VQVTKYQAAKNCKAWIVGKWITPREQSWAPRGAHFHQFVVPPILHFRRDCTYGDLAAMKL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+VD+IDVVW+AA+K G K
Sbjct  562  PQDVQGLGSCEYTMDRGVVHACHAGGVVHSLEGWTHHEVGAIDVDRIDVVWKAAMKYGFK  621

Query  237  PL  232
            P+
Sbjct  622  PV  623



>gb|KDO62363.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62364.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62365.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=567

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P DV EVFLTGATSKLGRAIALYL R+RVRVLMLT STERF KIQ EAP+DCQ +L
Sbjct  376  LNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYL  435

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+H KTWI+GKW TPREQ+WAP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  436  VQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRL  495

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLG CEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VWEAALK+G K
Sbjct  496  PDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFK  555

Query  237  PL  232
            P+
Sbjct  556  PV  557



>ref|XP_008223562.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Prunus mume]
Length=638

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFL+GATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAP DCQ +L
Sbjct  443  LNEIPKDVEEVFLSGATSKLGRAIALYLCRRKVRVLMLTLSTERFQKIQKEAPADCQHYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CK WI+GKW TPREQ WAPSG HFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  503  VQVTKYQAARNCKAWIVGKWITPREQRWAPSGAHFHQFVVPPILHFRRDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+IDVVW+AALK+GLK
Sbjct  563  PDDVQGLGSCEYTMDRGVVHACHAGGVVHLLEGWTHHEVGALDVDRIDVVWKAALKHGLK  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>gb|KDO62360.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
 gb|KDO62361.1| hypothetical protein CISIN_1g006768mg [Citrus sinensis]
Length=632

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P DV EVFLTGATSKLGRAIALYL R+RVRVLMLT STERF KIQ EAP+DCQ +L
Sbjct  441  LNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+H KTWI+GKW TPREQ+WAP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  501  VQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLG CEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VWEAALK+G K
Sbjct  561  PDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_006453492.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
 ref|XP_006474093.1| PREDICTED: protein ECERIFERUM 3-like [Citrus sinensis]
 gb|ESR66732.1| hypothetical protein CICLE_v10007738mg [Citrus clementina]
Length=632

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P DV EVFLTGATSKLGRAIALYL R+RVRVLMLT STERF KIQ EAP+DCQ +L
Sbjct  441  LNELPKDVKEVFLTGATSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPIDCQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+H KTWI+GKW TPREQ+WAP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  501  VQVTKYQAAQHSKTWIVGKWITPREQNWAPPGTHFHQFVVPPILHFRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLG CEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VWEAALK+G K
Sbjct  561  PDDVEGLGICEYTMDRGVVHACHAGGVVHLLEGWTHHEVGAIDVDKIDLVWEAALKHGFK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|NP_001146749.1| uncharacterized protein LOC100280351 [Zea mays]
 gb|ACL54673.1| unknown [Zea mays]
 gb|AFW70400.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=440

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLM T S+ERFVKIQ EAP + Q++L
Sbjct  259  LNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMFTVSSERFVKIQREAPPEYQQYL  318

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  319  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  378

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GL SCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  379  PKDVQGLSSCEYTMERGVVHACHAGGVVHFLEGWGHHEVGAIDVDRIDVVWKAALKHGLA  438

Query  237  PL  232
            P+
Sbjct  439  PV  440



>gb|ACN25216.1| unknown [Zea mays]
 gb|AFW87580.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=361

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT STERF+KIQ EAP + Q+++
Sbjct  180  LNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTLSTERFLKIQREAPPEFQQYI  239

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  240  VQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  299

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA+ VD+IDVVWEAALK+GL 
Sbjct  300  PKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGALEVDRIDVVWEAALKHGLT  359

Query  237  P  235
            P
Sbjct  360  P  360



>ref|XP_002270033.2| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +  +VFLTGATSKLG AI+LYL R+++ VLMLTQS+ERF  IQ EAP+DCQ+FL
Sbjct  439  LKEIPQNATQVFLTGATSKLGTAISLYLCRKKIFVLMLTQSSERFESIQREAPIDCQQFL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWIIGKW TPREQSWAP GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  499  VQVTKYQAAQHCKTWIIGKWCTPREQSWAPPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGV+HACHAGGVVH L+GWTHHEVGAI+VDQIDV W AAL +G K
Sbjct  559  PEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVGAIDVDQIDVAWTAALSHGFK  618

Query  237  PL  232
            P+
Sbjct  619  PV  620



>ref|XP_007221983.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
 gb|EMJ23182.1| hypothetical protein PRUPE_ppa002836mg [Prunus persica]
Length=629

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFL+GATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAP DCQ +L
Sbjct  443  LNEIPKDVEEVFLSGATSKLGRAIALYLCRRKVRVLMLTMSTERFQKIQKEAPADCQHYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CK WI+GKW TPREQ WAPSG HFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  503  VQVTKYQAARNCKAWIVGKWITPREQRWAPSGAHFHQFVVPPILHFRRDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLG CEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+IDVVW+AALK+GLK
Sbjct  563  PDDVQGLGCCEYTMDRGVVHACHAGGVVHLLEGWTHHEVGALDVDRIDVVWKAALKHGLK  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>emb|CBI25242.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +  +VFLTGATSKLG AI+LYL R+++ VLMLTQS+ERF  IQ EAP+DCQ+FL
Sbjct  441  LKEIPQNATQVFLTGATSKLGTAISLYLCRKKIFVLMLTQSSERFESIQREAPIDCQQFL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWIIGKW TPREQSWAP GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  501  VQVTKYQAAQHCKTWIIGKWCTPREQSWAPPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGV+HACHAGGVVH L+GWTHHEVGAI+VDQIDV W AAL +G K
Sbjct  561  PEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVGAIDVDQIDVAWTAALSHGFK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>gb|AFW87579.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=436

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT STERF+KIQ EAP + Q+++
Sbjct  255  LNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTLSTERFLKIQREAPPEFQQYI  314

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  315  VQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  374

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA+ VD+IDVVWEAALK+GL 
Sbjct  375  PKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGALEVDRIDVVWEAALKHGLT  434

Query  237  P  235
            P
Sbjct  435  P  435



>ref|XP_011016520.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=227

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV EVFLTGATSKLGRAIALYL +RRVRVLMLT S ERF K+Q EAP++ Q +L
Sbjct  36   LNEIREDVKEVFLTGATSKLGRAIALYLCQRRVRVLMLTSSKERFRKVQKEAPLEYQSYL  95

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW TP EQSWAP+GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  96   VQVTKYQAARGCKTWIVGKWITPGEQSWAPTGTHFHQFVVPPILSFRRDCTYGDLAAMRL  155

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P +V+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VW AALK+GLK
Sbjct  156  PDEVQGLGNCEYTMDRGVVHACHAGGVVHLLEGWAHHEVGAIDVDRIDLVWNAALKHGLK  215

Query  237  PL  232
            P+
Sbjct  216  PV  217



>ref|NP_001131238.1| gl1 protein [Zea mays]
Length=361

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT STERF+KIQ EAP + Q+++
Sbjct  180  LNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTLSTERFLKIQREAPPEFQQYI  239

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAA +L
Sbjct  240  VQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAATRL  299

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA+ VD+IDVVWEAALK+GL 
Sbjct  300  PKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGALEVDRIDVVWEAALKHGLT  359

Query  237  P  235
            P
Sbjct  360  P  360



>gb|KHG27244.1| Protein WAX2 [Gossypium arboreum]
Length=666

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  440  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+QSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYQAAQNCKTWIVGKWITPRQQSWAPSGTHFHQFVVPPILAFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNG  244
            P DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+G
Sbjct  560  PDDVKGLGSCEYTMERGVVHACHAGGVVHQLEGWTHHEVGAIDVDRIDIVWKAALKHG  617



>ref|XP_010047031.1| PREDICTED: protein ECERIFERUM 3 [Eucalyptus grandis]
 gb|KCW78780.1| hypothetical protein EUGRSUZ_C00214 [Eucalyptus grandis]
Length=624

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LND+P DV EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KI+ EAP DCQ +L
Sbjct  440  LNDLPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFEKIKKEAPADCQNYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW TPREQSWAP G  FHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYQAARTCKTWIVGKWITPREQSWAPPGARFHQFVVPPILPFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+VD+ID+VW AALK+GLK
Sbjct  560  PDDVQGLGSCEYTMDRGVVHACHAGGVVHSLEGWTHHEVGAIDVDRIDLVWNAALKHGLK  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>ref|XP_009400348.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL ++ +RVLMLT STERF+KIQ EAP DCQ  L
Sbjct  436  LNEIPRDVKEVFLTGATSKLGRAIALYLCKKNIRVLMLTLSTERFLKIQKEAPEDCQHHL  495

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWI+GKW + REQ WAP GTHFHQFVVPPII FRRDCTYG LAAM+L
Sbjct  496  VQVTKYQAAQHCKTWIVGKWLSLREQRWAPPGTHFHQFVVPPIIGFRRDCTYGSLAAMRL  555

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW AALK+GL 
Sbjct  556  PKDVRGLGSCEYTMERGVVHACHAGGVVHCLEGWMHHEVGAIDVDRIDVVWRAALKHGLT  615

Query  237  PL  232
            P+
Sbjct  616  PV  617



>gb|KJB83325.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=527

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+   DV EVFLTGATSKLGRA ALYL R+RVRVLMLT STERF KI  E PVDCQ +L
Sbjct  341  LNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTSSTERFQKILKETPVDCQNYL  400

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  401  VQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVVPPILPIRRDCTYGDLAAMRL  460

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGW+HHEVGAI+VD+ID+VWEAALK+GLK
Sbjct  461  PPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVGAIDVDRIDLVWEAALKHGLK  520

Query  237  PL  232
            P+
Sbjct  521  PV  522



>ref|XP_002325096.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
 gb|EEF03661.1| hypothetical protein POPTR_0018s10830g [Populus trichocarpa]
Length=652

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL++RRVRVLMLT STERF KIQ EAP++ Q + 
Sbjct  462  LNEIPEDVKEVFLTGATSKLGRAIALYLSQRRVRVLMLTSSTERFEKIQKEAPLEYQSYF  521

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW TPREQSWAP+GTHFHQFVVPPI  FRRDCTYG LAAM+L
Sbjct  522  VQVTKYQAARSCKTWIVGKWITPREQSWAPTGTHFHQFVVPPIFSFRRDCTYGDLAAMRL  581

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLG+CEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+IDVVW AALK+GLK
Sbjct  582  PDDVQGLGNCEYTMDRGVVHACHAGGVVHLLEGWTHHEVGALDVDRIDVVWNAALKHGLK  641

Query  237  PL  232
            P+
Sbjct  642  PV  643



>ref|XP_004965700.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=622

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLMLT STERF+KIQ EAP + Q+FL
Sbjct  441  LNEIPSNVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTVSTERFLKIQREAPAESQQFL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  501  VQVTKYQAAQSCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLG CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  561  PKDVEGLGCCEYTMERGVVHACHAGGVVHCLEGWEHHEVGAIDVDRIDVVWKAALKHGLT  620

Query  237  P  235
            P
Sbjct  621  P  621



>gb|AAB87722.1| glossy1 homolog, partial [Oryza sativa Japonica Group]
Length=555

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALY  R+++RVLMLT STERF+ IQ EAP + Q++L
Sbjct  374  LNEIPGDVAEVFLTGATSKLGRAIALYFCRKKIRVLMLTLSTERFMNIQREAPAEFQQYL  433

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  434  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  493

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG+CEYTMGRGVVHACHAGGVVH LEGW HHEVGAI+VD+ID VW AAL++GL 
Sbjct  494  PEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWDHHEVGAIDVDRIDAVWNAALRHGLT  553

Query  237  P  235
            P
Sbjct  554  P  554



>ref|XP_002451653.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
 gb|EES04629.1| hypothetical protein SORBIDRAFT_04g005330 [Sorghum bicolor]
Length=630

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVF+TGATSKLGRAIALYL R+++RVLM T S+ERFVKIQ EAP + Q++L
Sbjct  449  LNEIPSNVKEVFMTGATSKLGRAIALYLCRKKIRVLMFTMSSERFVKIQREAPPEFQQYL  508

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  509  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  568

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW AALK+GL 
Sbjct  569  PKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWDHHEVGAIDVDRIDVVWNAALKHGLA  628

Query  237  PL  232
            P+
Sbjct  629  PV  630



>gb|KEH32582.1| fatty acid hydroxylase superfamily protein [Medicago truncatula]
Length=633

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL +++VRVLMLT ST+RF KIQ EAP++ Q +L
Sbjct  443  LNEIPQDVEEVFLTGATSKLGRAIALYLCQKKVRVLMLTISTDRFQKIQKEAPLEYQSYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CK WI+GKW TPREQSWAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  503  VQVTKYQAAQNCKAWIVGKWITPREQSWAPSGTHFHQFVVPPILSFRRDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGVVHACHAGGVVH+LEGWTHHEVGA++V++ID+VWEAALK+GL+
Sbjct  563  PEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWTHHEVGALDVNRIDLVWEAALKHGLR  622

Query  237  PL*RMP  220
            P+   P
Sbjct  623  PVSSSP  628



>gb|EAZ01917.1| hypothetical protein OsI_23945 [Oryza sativa Indica Group]
Length=631

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+++RVLMLT STERF+ IQ EAP + Q++L
Sbjct  450  LNEIPGDVAEVFLTGATSKLGRAIALYLCRKKIRVLMLTLSTERFMNIQREAPAEFQQYL  509

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  510  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  569

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG+CEYTMGRGVVHACHAGGVVH LEGW HHEVGAI+VD+ID VW AAL++GL 
Sbjct  570  PEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWDHHEVGAIDVDRIDAVWNAALRHGLT  629

Query  237  P  235
            P
Sbjct  630  P  630



>gb|ACF79426.1| unknown [Zea mays]
Length=404

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVFLTGATSKLGRAIALYL ++RVRV+M+T STERF KIQ EAP + Q++L
Sbjct  223  LNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTLSTERFQKIQKEAPAEFQQYL  282

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HC+TWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  283  VQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  342

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAALK+GL+
Sbjct  343  PKDVRGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALKHGLR  402

Query  237  P  235
            P
Sbjct  403  P  403



>ref|XP_002437383.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
 gb|EER88750.1| hypothetical protein SORBIDRAFT_10g025920 [Sorghum bicolor]
Length=623

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLMLT STERF+KIQ EAP + Q+FL
Sbjct  442  LNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMLTLSTERFLKIQKEAPSEFQQFL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  502  VQVTKYQAAQSCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  562  PKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGAIDVDRIDVVWKAALKHGLT  621

Query  237  P  235
            P
Sbjct  622  P  622



>ref|NP_001058237.1| Os06g0653000 [Oryza sativa Japonica Group]
 dbj|BAD37412.1| putative Gl1 [Oryza sativa Japonica Group]
 dbj|BAF20151.1| Os06g0653000 [Oryza sativa Japonica Group]
 gb|EEE66138.1| hypothetical protein OsJ_22195 [Oryza sativa Japonica Group]
Length=627

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+++RVLMLT STERF+ IQ EAP + Q++L
Sbjct  446  LNEIPGDVAEVFLTGATSKLGRAIALYLCRKKIRVLMLTLSTERFMNIQREAPAEFQQYL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  506  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG+CEYTMGRGVVHACHAGGVVH LEGW HHEVGAI+VD+ID VW AAL++GL 
Sbjct  566  PEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWDHHEVGAIDVDRIDAVWNAALRHGLT  625

Query  237  P  235
            P
Sbjct  626  P  626



>emb|CDP02895.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFL+G+TSKLGRAIALYL R+RVRVLMLT STERF KIQ EAP + QK+L
Sbjct  441  LNEIPDDVTEVFLSGSTSKLGRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPTEYQKYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQV+KYQAA++CKTWI+GKW TPREQ +AP GTHFHQFVVPPI++FRRDCTYG LAAMKL
Sbjct  501  VQVSKYQAAQNCKTWIVGKWITPREQRFAPPGTHFHQFVVPPILRFRRDCTYGDLAAMKL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGVVHACHAGG+VH+LEGWTHHEVGAI+VD+IDVVWEAALK+GLK
Sbjct  561  PEDVEGLGCCEYTMDRGVVHACHAGGLVHSLEGWTHHEVGAIDVDRIDVVWEAALKHGLK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>gb|KHG30512.1| Protein WAX2 -like protein [Gossypium arboreum]
Length=627

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+   DV EVFLTGATSKLGRA ALYL R+RVRVLMLT STERF KI  EAPVDCQ +L
Sbjct  441  LNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTSSTERFQKILKEAPVDCQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  501  VQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVVPPILPIRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGW+HHEVGAI+VD+ID+VWEAALK+GLK
Sbjct  561  PPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVGAIDVDRIDLVWEAALKHGLK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_008794400.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=619

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL ++++RVLMLT S ERF KIQ EAP +CQ +L
Sbjct  438  LNEIPKDVEEVFLTGATSKLGRAIALYLCQKKIRVLMLTLSAERFQKIQKEAPPECQHYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW++PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  498  VQVTKYQAAQNCKTWIVGKWSSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+ LGSCEYT+ RGVVHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW AALK+GL 
Sbjct  558  PQDVQALGSCEYTLERGVVHACHAGGVVHLLEGWTHHEVGAIDVDRIDVVWRAALKHGLT  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>ref|XP_002270075.1| PREDICTED: protein ECERIFERUM 3-like [Vitis vinifera]
Length=620

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +  +VFLTGATSKLGRAI+LYL R+++ VLMLTQS+ERF  IQ EAP+DCQ+FL
Sbjct  439  LKEIPQNATQVFLTGATSKLGRAISLYLCRKKIFVLMLTQSSERFESIQREAPIDCQQFL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWIIGKW TP EQSWAP GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  499  VQVTKYQAAQYCKTWIIGKWCTPSEQSWAPPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGV+HACHAGGVVH L+GWTHHEVGAI+VDQIDV W AAL +G K
Sbjct  559  PEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVGAIDVDQIDVAWTAALSHGFK  618

Query  237  PL  232
            P+
Sbjct  619  PV  620



>emb|CBI25244.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +  +VFLTGATSKLGRAI+LYL R+++ VLMLTQS+ERF  IQ EAP+DCQ+FL
Sbjct  441  LKEIPQNATQVFLTGATSKLGRAISLYLCRKKIFVLMLTQSSERFESIQREAPIDCQQFL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWIIGKW TP EQSWAP GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  501  VQVTKYQAAQYCKTWIIGKWCTPSEQSWAPPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGV+HACHAGGVVH L+GWTHHEVGAI+VDQIDV W AAL +G K
Sbjct  561  PEDVEGLGYCEYTMERGVLHACHAGGVVHLLQGWTHHEVGAIDVDQIDVAWTAALSHGFK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_010278025.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
 ref|XP_010278026.1| PREDICTED: protein ECERIFERUM 3 [Nelumbo nucifera]
Length=619

 Score =   245 bits (626),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV EVFLTGATSKLGRAIALYL R+ VRVLMLTQ+TERF KIQ EAP++CQ FL
Sbjct  438  LNEIGKDVKEVFLTGATSKLGRAIALYLCRKGVRVLMLTQATERFQKIQKEAPLECQNFL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK+QA ++CK WI+GKW TPREQ WAP GTHFHQFVVPPI QFRRDCTYG LAAM+L
Sbjct  498  VQVTKHQAGQNCKAWIVGKWLTPREQRWAPPGTHFHQFVVPPIFQFRRDCTYGDLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLG CEYTM RGVVHACHAGG+VH LEGWTHHEVGAI+VD+ID+VW AALK+GL 
Sbjct  558  PKDVEGLGCCEYTMDRGVVHACHAGGLVHCLEGWTHHEVGAIDVDKIDMVWNAALKHGLT  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>gb|KJB83324.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=595

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+   DV EVFLTGATSKLGRA ALYL R+RVRVLMLT STERF KI  E PVDCQ +L
Sbjct  409  LNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTSSTERFQKILKETPVDCQNYL  468

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  469  VQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVVPPILPIRRDCTYGDLAAMRL  528

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGW+HHEVGAI+VD+ID+VWEAALK+GLK
Sbjct  529  PPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVGAIDVDRIDLVWEAALKHGLK  588

Query  237  PL  232
            P+
Sbjct  589  PV  590



>ref|XP_011018104.1| PREDICTED: protein ECERIFERUM 3 [Populus euphratica]
Length=632

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP++ Q + 
Sbjct  442  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTSSTERFEKIQKEAPLEYQSYF  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW TPREQSWAP+GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  502  VQVTKYQAARSCKTWIVGKWITPREQSWAPTGTHFHQFVVPPILSFRRDCTYGDLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+G G+CEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+IDVVW AALK+GLK
Sbjct  562  PDDVQGRGNCEYTMDRGVVHACHAGGVVHLLEGWTHHEVGALDVDRIDVVWNAALKHGLK  621

Query  237  PL  232
            P+
Sbjct  622  PV  623



>gb|ACN25333.1| unknown [Zea mays]
 gb|ACN28101.1| unknown [Zea mays]
 gb|AFW70399.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=627

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLM T S+ERFVKIQ EAP + Q++L
Sbjct  446  LNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMFTVSSERFVKIQREAPPEYQQYL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  506  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GL SCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  566  PKDVQGLSSCEYTMERGVVHACHAGGVVHFLEGWGHHEVGAIDVDRIDVVWKAALKHGLA  625

Query  237  PL  232
            P+
Sbjct  626  PV  627



>ref|XP_006401167.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
 dbj|BAJ33654.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42620.1| hypothetical protein EUTSA_v10012960mg [Eutrema salsugineum]
Length=631

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIAL+L RR VRVLMLT S ERF KIQ EAP + Q +L
Sbjct  445  LNEIPKDVKEVFLTGATSKLGRAIALHLCRRGVRVLMLTLSVERFQKIQREAPAEFQNYL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI+ FRR+CTYG LAAM+L
Sbjct  505  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILNFRRNCTYGDLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL+
Sbjct  565  PKDVQGLGHCEYTMDRGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMKYGLR  624

Query  237  PL  232
            P+
Sbjct  625  PV  626



>ref|XP_004309858.1| PREDICTED: protein ECERIFERUM 3 [Fragaria vesca subsp. vesca]
Length=630

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  EVFLTGATSKLGRAIALYL RR+VRVLMLT STERF K+Q EAP + Q +L
Sbjct  441  LNEIPKDCQEVFLTGATSKLGRAIALYLCRRKVRVLMLTLSTERFQKVQKEAPAEFQSYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW TPREQ WAPSG HFHQFVVPPI  FRRDCTYG LAAM+L
Sbjct  501  VQVTKYQAAQTCKTWIVGKWITPREQRWAPSGAHFHQFVVPPIFHFRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+ID+VW+AALK+GLK
Sbjct  561  PDDVEGLGSCEYTMDRGVVHACHAGGVVHFLEGWTHHEVGAIDVDRIDLVWDAALKHGLK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_002864528.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40787.1| hypothetical protein ARALYDRAFT_495876 [Arabidopsis lyrata subsp. 
lyrata]
Length=632

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ER+ KIQ EAPV+ Q +L
Sbjct  446  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSVERYQKIQKEAPVEFQNYL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAMKL
Sbjct  506  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMKL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  566  PKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMKYGLS  625



>ref|XP_006657201.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=623

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+ ++VLMLT STERF+ IQ EAP + Q++L
Sbjct  442  LNEIPGDVAEVFLTGATSKLGRAIALYLCRKNIKVLMLTLSTERFMTIQREAPAEFQQYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP+GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  502  VQVTKYQAAQKCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIMGFRRDCTYGKLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG+CEYTMGRGVVHACHAGGVVH LEGW HHE GAI+VD+IDVVW AALK+GL 
Sbjct  562  PEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWEHHEXGAIDVDRIDVVWNAALKHGLT  621

Query  237  P  235
            P
Sbjct  622  P  622



>gb|KJB83323.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=624

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+   DV EVFLTGATSKLGRA ALYL R+RVRVLMLT STERF KI  E PVDCQ +L
Sbjct  438  LNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTSSTERFQKILKETPVDCQNYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  498  VQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVVPPILPIRRDCTYGDLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGW+HHEVGAI+VD+ID+VWEAALK+GLK
Sbjct  558  PPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVGAIDVDRIDLVWEAALKHGLK  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>gb|KJB83318.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=627

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+   DV EVFLTGATSKLGRA ALYL R+RVRVLMLT STERF KI  E PVDCQ +L
Sbjct  441  LNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTSSTERFQKILKETPVDCQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  501  VQVTKYQAAQNCKTWIVGKWITPWEQSWAPSGTHFHQFVVPPILPIRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLGSCEYTM RGVVHACHAGGVVH LEGW+HHEVGAI+VD+ID+VWEAALK+GLK
Sbjct  561  PPDVEGLGSCEYTMERGVVHACHAGGVVHQLEGWSHHEVGAIDVDRIDLVWEAALKHGLK  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_009587593.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana tomentosiformis]
Length=628

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP DV E FL+GATSKLGR IALYL RR+VRVLMLT STERF KIQ EAP + QK+L
Sbjct  440  LKEIPEDVTEAFLSGATSKLGRVIALYLCRRQVRVLMLTSSTERFQKIQKEAPAEYQKYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY+AA++CKTWI+GKW TPREQS+AP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYEAARNCKTWIVGKWITPREQSYAPKGTHFHQFVVPPILSFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+VD+ID+VWEAA+K+GLK
Sbjct  560  PEDVQGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVDRIDLVWEAAMKHGLK  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>ref|XP_009387454.1| PREDICTED: protein ECERIFERUM 3-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  EVFLTGATSKLGRAIALYL R+ +RVLMLT S ERF+ IQ EAP DCQ  L
Sbjct  436  LNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTLSAERFLNIQKEAPADCQHHL  495

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK QAA++CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYG LAAM+L
Sbjct  496  VQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGSLAAMRL  555

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  556  PKDVQGLGSCEYTMERGVVHACHAGGVVHYLEGWTHHEVGAIDVDRIDVVWKAALKHGLT  615

Query  237  PL  232
            P+
Sbjct  616  PV  617



>ref|XP_004951702.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Setaria italica]
Length=626

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLM T S+ERFVKIQ EAP + Q++L
Sbjct  445  LNEIPSNVKEVFLTGATSKLGRAIALYLCRKKIRVLMFTMSSERFVKIQREAPPEFQQYL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  505  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GL SCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW AALK+GL 
Sbjct  565  PKDVRGLSSCEYTMERGVVHACHAGGVVHFLEGWDHHEVGAIDVDRIDVVWRAALKHGLA  624

Query  237  PL  232
            P+
Sbjct  625  PV  626



>ref|XP_008804902.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Phoenix dactylifera]
Length=619

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  E+FLTGATSKLGRAIALYL R+++RVLMLT S ERF KIQ EAP +CQ +L
Sbjct  438  LNEIPKDAKEIFLTGATSKLGRAIALYLCRKKIRVLMLTLSAERFQKIQKEAPPECQHYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  498  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG CEYTM RG+VHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW AALK+GL 
Sbjct  558  PQDVQGLGMCEYTMDRGMVHACHAGGVVHFLEGWTHHEVGAIDVDRIDVVWRAALKHGLA  617

Query  237  P  235
            P
Sbjct  618  P  618



>ref|XP_003570600.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  +VFLTGATSKLGRAIALYL R+++RV+MLT S+ERF+KIQ EAP + Q++L
Sbjct  445  LNEIPSNAKDVFLTGATSKLGRAIALYLCRKKIRVMMLTMSSERFLKIQREAPAEFQQYL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  505  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA++VD+IDVVW+AALK+GL 
Sbjct  565  PKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWEHHEVGALDVDRIDVVWKAALKHGLT  624

Query  237  P  235
            P
Sbjct  625  P  625



>ref|NP_001266321.1| gl1 protein [Zea mays]
 gb|ACG43105.1| gl1 protein [Zea mays]
Length=622

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT STERF+KIQ EAP + Q+++
Sbjct  441  LNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTLSTERFLKIQREAPPEFQQYI  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  501  VQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA+ VD+IDVVWEAALK+GL 
Sbjct  561  PKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGALEVDRIDVVWEAALKHGLT  620

Query  237  P  235
            P
Sbjct  621  P  621



>ref|XP_008658046.1| PREDICTED: uncharacterized protein LOC100192547 isoform X1 [Zea 
mays]
 gb|AFW87577.1| gl1 protein [Zea mays]
Length=622

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT STERF+KIQ EAP + Q+++
Sbjct  441  LNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTLSTERFLKIQREAPPEFQQYI  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  501  VQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA+ VD+IDVVWEAALK+GL 
Sbjct  561  PKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGALEVDRIDVVWEAALKHGLT  620

Query  237  P  235
            P
Sbjct  621  P  621



>gb|EYU21788.1| hypothetical protein MIMGU_mgv1a025856mg [Erythranthe guttata]
Length=633

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D+DEVFLTGATSKLGRAIALYLARR+V+V+MLT S ERF+KI+ EAP+  + +L
Sbjct  452  LNEIPRDIDEVFLTGATSKLGRAIALYLARRKVKVMMLTPSEERFLKIKKEAPLGFENYL  511

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAK+CKTWIIGKW TPR+Q +APSGTHFHQFVVPPII FR DC+YGKLAAMKL
Sbjct  512  VQVTKYQAAKNCKTWIIGKWTTPRQQYYAPSGTHFHQFVVPPIIPFRLDCSYGKLAAMKL  571

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEYTM RGVVHACHAGGVVH LEGW H+EVGAI+VDQIDVVW+AAL++G K
Sbjct  572  PEDVEGLGSCEYTMERGVVHACHAGGVVHLLEGWKHNEVGAIDVDQIDVVWKAALRHGFK  631

Query  237  PL  232
            PL
Sbjct  632  PL  633



>gb|ACN25689.1| unknown [Zea mays]
 gb|AFW87576.1| hypothetical protein ZEAMMB73_499314 [Zea mays]
Length=635

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT STERF+KIQ EAP + Q+++
Sbjct  454  LNEIPSSVREVFLTGATSKLGRAIALYLCRKRIRVLMLTLSTERFLKIQREAPPEFQQYI  513

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  514  VQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  573

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA+ VD+IDVVWEAALK+GL 
Sbjct  574  PKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGALEVDRIDVVWEAALKHGLT  633

Query  237  P  235
            P
Sbjct  634  P  634



>ref|XP_006845484.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
 gb|ERN07159.1| hypothetical protein AMTR_s00019p00142280 [Amborella trichopoda]
Length=555

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P  V EVFLTG+TSKLGRAIALYLAR+ VRVLMLT S ERF  IQ EAPV+ QK L
Sbjct  374  LNELPNGVKEVFLTGSTSKLGRAIALYLARKGVRVLMLTLSQERFQIIQKEAPVEYQKNL  433

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQA ++CKTWI+GKW  PREQ WAPSGTHFHQFVVPPI++ RRDCTYGKLAAM L
Sbjct  434  VQVTKYQAGQNCKTWIVGKWILPREQKWAPSGTHFHQFVVPPILRLRRDCTYGKLAAMHL  493

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DVEGLG+CEYTMGRG+VHACHAGGVVH LEGWTHHEVGAI+VD+ID+VWEAALK+GLK
Sbjct  494  PDDVEGLGTCEYTMGRGIVHACHAGGVVHLLEGWTHHEVGAISVDRIDLVWEAALKHGLK  553

Query  237  PL  232
            P+
Sbjct  554  PV  555



>dbj|BAJ85039.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  EVFLTGATSKLGRAIALYL R+R+RV+MLT S+ERF+KIQ EAP + Q++L
Sbjct  443  LNEIPSNTKEVFLTGATSKLGRAIALYLCRKRIRVIMLTMSSERFLKIQREAPAEFQQYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTW++GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  503  VQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA++VD+IDVVW+AALK+GL 
Sbjct  563  PKDVQGLGSCEYTMERGVVHACHAGGVVHFLEGWQHHEVGALDVDRIDVVWKAALKHGLT  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>ref|XP_009387453.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=647

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  EVFLTGATSKLGRAIALYL R+ +RVLMLT S ERF+ IQ EAP DCQ  L
Sbjct  466  LNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTLSAERFLNIQKEAPADCQHHL  525

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK QAA++CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYG LAAM+L
Sbjct  526  VQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGSLAAMRL  585

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  586  PKDVQGLGSCEYTMERGVVHACHAGGVVHYLEGWTHHEVGAIDVDRIDVVWKAALKHGLT  645

Query  237  PL  232
            P+
Sbjct  646  PV  647



>ref|XP_009798188.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP D+ EVFLTGATSKLGRAIALYL  ++VRVLMLT STERF KIQ EAP + QK+L
Sbjct  440  LKEIPNDITEVFLTGATSKLGRAIALYLCTKQVRVLMLTSSTERFQKIQKEAPAEYQKYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAK+CKTWI+GKW TPREQ++AP+G HFHQFVVPP++ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYQAAKNCKTWIVGKWITPREQNFAPTGAHFHQFVVPPVLPFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+V++ID+VWEAALK+GLK
Sbjct  560  PLDVQGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVNRIDLVWEAALKHGLK  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>dbj|BAB08850.1| lipid transfer protein; glossy1 homolog [Arabidopsis thaliana]
Length=566

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP DV+EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q  L
Sbjct  380  LYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSMERFQKIQKEAPVEFQNNL  439

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAMKL
Sbjct  440  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMKL  499

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  500  PKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMKYGLS  559



>ref|XP_009390985.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+ +RVLMLT STERFVKIQ E P D Q  L
Sbjct  436  LNEIPMDVKEVFLTGATSKLGRAIALYLCRKNIRVLMLTLSTERFVKIQKEVPADYQHHL  495

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW   REQ WAP GTHFHQFVVPP+I FRRDCTYG LAAM+L
Sbjct  496  VQVTKYQAAQNCKTWIVGKWLLLREQRWAPPGTHFHQFVVPPVIGFRRDCTYGNLAAMRL  555

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RG+VHACHAGG+VH LEGWTHHEVGAI+VD+IDVVW AALK+GL+
Sbjct  556  PKDVQGLGSCEYTMERGIVHACHAGGIVHCLEGWTHHEVGAIDVDRIDVVWNAALKHGLQ  615

Query  237  PL  232
            P+
Sbjct  616  PV  617



>ref|XP_008643558.1| PREDICTED: uncharacterized protein LOC100280351 isoform X1 [Zea 
mays]
Length=747

 Score =   245 bits (626),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLM T S+ERFVKIQ EAP + Q++L
Sbjct  566  LNEIPSNVREVFLTGATSKLGRAIALYLCRKKIRVLMFTVSSERFVKIQREAPPEYQQYL  625

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW +PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  626  VQVTKYQAAQNCKTWIVGKWLSPREQRWAPSGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  685

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GL SCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  686  PKDVQGLSSCEYTMERGVVHACHAGGVVHFLEGWGHHEVGAIDVDRIDVVWKAALKHGLA  745

Query  237  PL  232
            P+
Sbjct  746  PV  747



>ref|XP_002270946.1| PREDICTED: protein ECERIFERUM 3 [Vitis vinifera]
 emb|CBI36611.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   243 bits (620),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L++IP  V EVFLTGATSKLGRAIALYL +R+VRVLMLT STERF KIQ EAPV+ Q +L
Sbjct  442  LHEIPQGVKEVFLTGATSKLGRAIALYLCQRKVRVLMLTLSTERFQKIQREAPVEFQNYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPR+Q+WAPSG HFHQFVVPPI+ FRRDCTYG LAA+KL
Sbjct  502  VQVTKYQAAQNCKTWIVGKWITPRQQNWAPSGAHFHQFVVPPILPFRRDCTYGDLAALKL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHEVGA++VD+IDVVW+AALK+GLK
Sbjct  562  PEDVQGLGSCEYTMERGVVHACHAGGVVHVLEGWTHHEVGALDVDRIDVVWKAALKHGLK  621

Query  237  PL  232
            P+
Sbjct  622  PV  623



>ref|XP_006646964.1| PREDICTED: protein ECERIFERUM 3-like [Oryza brachyantha]
Length=633

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V +VFLTGATSKLGRAIALYL R+++RVLMLT S+ERF+KIQ EAP + Q++L
Sbjct  452  LNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTLSSERFLKIQREAPAEFQQYL  511

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQ A++CKTW++GKW +PREQ WAP+GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  512  VQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVVPPIMGFRRDCTYGKLAAMRL  571

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG+CEYTMGRGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  572  PEDVEGLGTCEYTMGRGVVHACHAGGVVHFLEGWEHHEVGAIDVDRIDVVWKAALKHGLT  631

Query  237  P  235
            P
Sbjct  632  P  632



>emb|CDX88639.1| BnaA03g10100D [Brassica napus]
Length=631

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT STERF KIQ EAP + Q  L
Sbjct  445  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSTERFQKIQKEAPAEFQNHL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ FRR CTYG LAAM+L
Sbjct  505  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPEGTHFHQFVVPPILNFRRKCTYGDLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+G+G+CEYTM RGVVHACHAGG+VH LEGW HHEVGAI+VD+ID+VWEAA++NGL 
Sbjct  565  PKDVQGVGTCEYTMERGVVHACHAGGLVHMLEGWEHHEVGAIDVDRIDIVWEAAMRNGLS  624



>dbj|BAK04216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=545

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT S+ERF+KIQ EAP + Q++L
Sbjct  364  LNEIPGSVKEVFLTGATSKLGRAIALYLCRKRIRVLMLTLSSERFLKIQREAPAEFQQYL  423

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AAK  KTW++GKW +PREQ WAP+GTHFHQFVVPP+I+FRRDCTYGKLAAM+L
Sbjct  424  VQVTKYHAAKTVKTWLVGKWLSPREQRWAPAGTHFHQFVVPPVIEFRRDCTYGKLAAMRL  483

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AAL++GL 
Sbjct  484  PKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGAIDVDRIDVVWKAALRHGLS  543

Query  237  P  235
            P
Sbjct  544  P  544



>ref|XP_010483318.1| PREDICTED: protein ECERIFERUM 3 [Camelina sativa]
 gb|AIE57504.1| CER3 [Camelina sativa]
Length=632

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTG+TSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  446  LNEIPKDVKEVFLTGSTSKLGRAIALYLCRRGVRVLMLTLSVERFQKIQKEAPVEFQNYL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  506  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGL +CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  566  PKDVEGLATCEYTMERGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  625



>dbj|BAJ87617.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=624

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  EVFLTGATSKLGRAIALYL R+R+RV+MLT S+ERF+KIQ EAP + Q++L
Sbjct  443  LNEIPSNTKEVFLTGATSKLGRAIALYLCRKRIRVIMLTMSSERFLKIQREAPAEFQQYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTW++GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  503  VQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKD +GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGA++VD+IDVVW+AALK+GL 
Sbjct  563  PKDAQGLGSCEYTMERGVVHACHAGGVVHFLEGWQHHEVGALDVDRIDVVWKAALKHGLT  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>ref|XP_010443488.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  446  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSVERFQKIQKEAPVEFQNYL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  506  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK+VEGL +CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  566  PKNVEGLATCEYTMERGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  625



>ref|NP_200588.2| protein ECERIFERUM 3 [Arabidopsis thaliana]
 sp|Q8H1Z0.1|CER3_ARATH RecName: Full=Protein ECERIFERUM 3; AltName: Full=Protein FACELESS 
POLLEN 1; AltName: Full=Protein WAX2; AltName: Full=Protein 
YORE-YORE [Arabidopsis thaliana]
 gb|AAN06975.1| cuticle protein [Arabidopsis thaliana]
 dbj|BAC81644.1| YORE-YORE protein [Arabidopsis thaliana]
 dbj|BAD06945.1| faceless pollen-1 [Arabidopsis thaliana]
 gb|AED96953.1| protein ECERIFERUM 3 [Arabidopsis thaliana]
Length=632

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP DV+EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q  L
Sbjct  446  LYEIPKDVNEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSMERFQKIQKEAPVEFQNNL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAMKL
Sbjct  506  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMKL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDVEGLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  566  PKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMKYGLS  625



>gb|EMS67420.1| Protein WAX2 [Triticum urartu]
Length=697

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  EVFLTGATSKLGRAIALYL R+++RV+MLT S+ERF+KIQ EAP + Q++L
Sbjct  397  LNEIPSNTKEVFLTGATSKLGRAIALYLCRKKIRVIMLTMSSERFLKIQREAPAEFQQYL  456

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTW++GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  457  VQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  516

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEY+M RGVVHACHAGGVVH LEGW HHEVGA++VD+IDVVW+AALK+GL 
Sbjct  517  PKDVQGLGSCEYSMERGVVHACHAGGVVHFLEGWEHHEVGALDVDRIDVVWKAALKHGLT  576

Query  237  P  235
            P
Sbjct  577  P  577



>ref|XP_009766364.1| PREDICTED: protein ECERIFERUM 3-like [Nicotiana sylvestris]
Length=628

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +V E FL+GATSKLGR IALYL RR+VRVLMLT STERF KIQ EAP + QK+L
Sbjct  440  LKEIPENVTEAFLSGATSKLGRVIALYLCRRQVRVLMLTSSTERFQKIQKEAPAEYQKYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY+AA++CKTWI+GKW TPREQS+AP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  500  VQVTKYEAARNCKTWIVGKWITPREQSYAPKGTHFHQFVVPPILSFRRDCTYGDLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+VD+ID+VW AA+K+GLK
Sbjct  560  PEDVQGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVDRIDLVWAAAMKHGLK  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>gb|EEC72610.1| hypothetical protein OsI_06088 [Oryza sativa Indica Group]
Length=628

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V +VFLTGATSKLGRAIALYL R+++RVLMLT S+ERF+KIQ EAP + Q++L
Sbjct  447  LNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTLSSERFLKIQREAPAEFQQYL  506

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQ A++CKTW++GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  507  VQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  566

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  567  PKDVQGLGYCEYTMERGVVHACHAGGVVHFLEGWEHHEVGAIDVDRIDVVWKAALKHGLT  626

Query  237  P  235
            P
Sbjct  627  P  627



>ref|XP_009132107.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=631

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGAT KLGRAIALYL RR VRVLMLT STERF KIQ EAP + Q +L
Sbjct  445  LNEIPKDVKEVFLTGATFKLGRAIALYLCRRGVRVLMLTLSTERFQKIQKEAPAEFQNYL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCK+WI+GKW TPREQSWAP GTHFHQFVVPPI+ FRR CTYG LAAM+L
Sbjct  505  VQVTKYNAAQHCKSWIVGKWLTPREQSWAPEGTHFHQFVVPPILNFRRKCTYGDLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+G+G+CEYTM RGVVHACHAGG+VH LEGW HHEVGAI+VD+ID+VWEAA++NGL 
Sbjct  565  PKDVQGVGTCEYTMERGVVHACHAGGLVHMLEGWEHHEVGAIDVDRIDIVWEAAMRNGLS  624



>ref|NP_001046080.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAD28002.1| putative glossy1 protein [Oryza sativa Japonica Group]
 dbj|BAF07994.1| Os02g0178800 [Oryza sativa Japonica Group]
 dbj|BAG90034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=628

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V +VFLTGATSKLGRAIALYL R+++RVLMLT S+ERF+KIQ EAP + Q++L
Sbjct  447  LNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIRVLMLTLSSERFLKIQREAPAEFQQYL  506

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQ A++CKTW++GKW +PREQ WAP+GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  507  VQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  566

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AALK+GL 
Sbjct  567  PKDVQGLGYCEYTMERGVVHACHAGGVVHFLEGWEHHEVGAIDVDRIDVVWKAALKHGLT  626

Query  237  P  235
            P
Sbjct  627  P  627



>emb|CDY11848.1| BnaC03g12740D [Brassica napus]
Length=631

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P DV EVFLTGATSKLGRAIALYL RR VRVLMLT STERF KIQ EAP + Q +L
Sbjct  445  LNEVPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSTERFQKIQKEAPAEFQNYL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ F R CTYG LAAM+L
Sbjct  505  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPEGTHFHQFVVPPILNFTRKCTYGDLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+G+G+CEYTM RGVVHACHAGG+VH LEGW HHEVGAI+VD+ID+VWEAA++NGL 
Sbjct  565  PKDVQGVGTCEYTMERGVVHACHAGGLVHMLEGWEHHEVGAIDVDRIDIVWEAAMRNGLS  624



>ref|XP_003549515.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
Length=632

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL +++V+VLMLT ST+RF +IQ EAP + Q +L
Sbjct  443  LNEIPQDVKEVFLTGATSKLGRAIALYLCQKKVKVLMLTLSTDRFQRIQKEAPPENQSYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQ WAP GTHFHQFVVPPI+ FR+DCTYG LAAM+L
Sbjct  503  VQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQFVVPPILSFRKDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGVVHACHAGGVVH+LEGW+HHEVGAI+V++ID+VWEAALK+GL+
Sbjct  563  PEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWSHHEVGAIDVNRIDLVWEAALKHGLR  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>ref|XP_006279594.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
 gb|EOA12492.1| hypothetical protein CARUB_v10026077mg [Capsella rubella]
Length=629

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  443  LYEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSVERFQKIQKEAPVEFQNYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  503  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK+VEGLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  563  PKNVEGLGTCEYTMERGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  622



>emb|CDY32747.1| BnaA02g08090D [Brassica napus]
Length=630

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAP + Q +L
Sbjct  444  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTMSIERFQKIQKEAPAEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+++GL 
Sbjct  564  PKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMRHGLS  623



>gb|AAR90847.1| glossy1 protein [Zea mays]
Length=621

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVFLTGATSKLGRAIALYL ++RVRV+M+T STERF KIQ EAP + Q++L
Sbjct  440  LNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTLSTERFQKIQKEAPAEFQQYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HC+TWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  500  VQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAALK+GL+
Sbjct  560  PKDVRGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALKHGLR  619

Query  237  P  235
            P
Sbjct  620  P  620



>ref|XP_009120300.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Brassica rapa]
Length=630

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+ VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  444  LNEIPKDVKEVFLTGATSKLGRAIALYLCRQGVRVLMLTLSVERFQKIQKEAPVEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVVPPILNFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+++GL+
Sbjct  564  PEDVQGLGTCEYTMDRGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMRHGLR  623



>tpg|DAA61563.1| TPA: glossy1 [Zea mays]
Length=621

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVFLTGATSKLGRAIALYL ++RVRV+M+T STERF KIQ EAP + Q++L
Sbjct  440  LNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTLSTERFQKIQKEAPAEFQQYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HC+TWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  500  VQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAALK+GL+
Sbjct  560  PKDVRGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALKHGLR  619

Query  237  P  235
            P
Sbjct  620  P  620



>emb|CDY51280.1| BnaA10g11680D [Brassica napus]
Length=630

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+ VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  444  LNEIPKDVKEVFLTGATSKLGRAIALYLCRQGVRVLMLTLSVERFQKIQKEAPVEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVVPPILNFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+++GL+
Sbjct  564  PEDVQGLGTCEYTMDRGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMRHGLR  623



>ref|NP_001105247.1| glossy1 [Zea mays]
 gb|AAR97643.1| Gl1 protein [Zea mays]
Length=621

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVFLTGATSKLGRAIALYL ++RVRV+M+T STERF KIQ EAP + Q++L
Sbjct  440  LNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTLSTERFQKIQKEAPAEFQQYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HC+TWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  500  VQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV GLG+CEY++ RG+VHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAALK+GL+
Sbjct  560  PKDVRGLGACEYSLERGLVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALKHGLR  619

Query  237  P  235
            P
Sbjct  620  P  620



>ref|XP_004242647.1| PREDICTED: protein ECERIFERUM 3 [Solanum lycopersicum]
Length=630

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +V EVFLTGATSKLGR IALYL RR+VRVLMLT STERF KIQ EAPV+ QK+L
Sbjct  442  LKEIPQNVSEVFLTGATSKLGRVIALYLCRRQVRVLMLTMSTERFQKIQKEAPVEYQKYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY+AAK+CKTWI+GKW TPREQS+AP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  502  VQVTKYEAAKNCKTWIVGKWITPREQSYAPKGTHFHQFVVPPILAFRRDCTYGDLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+G+ +CEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+V++ID+VW+AA+K+GLK
Sbjct  562  PEDVQGVSTCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVNRIDLVWDAAMKHGLK  621

Query  237  PL  232
            P+
Sbjct  622  PV  623



>ref|XP_003563334.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=626

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKLGRAIALYL R+++RVLMLT S+ERF+KIQ EAP + Q FL
Sbjct  445  LNEIPSNVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTLSSERFLKIQREAPAEFQPFL  504

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAAK+CKTW++GKW +PREQ WA +GTHFHQFVVPP+++FRRDC+YGKLAAM+L
Sbjct  505  VQVTKYQAAKNCKTWLVGKWLSPREQRWAAAGTHFHQFVVPPVMEFRRDCSYGKLAAMRL  564

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID VW AALK+GL 
Sbjct  565  PKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGAIDVDRIDQVWHAALKHGLS  624

Query  237  P  235
            P
Sbjct  625  P  625



>emb|CDY50795.1| BnaCnng19590D [Brassica napus]
Length=630

 Score =   240 bits (613),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  444  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSMERFQKIQKEAPVEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVVPPILNFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+++GL+
Sbjct  564  PEDVQGLGTCEYTMDRGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMRHGLR  623



>emb|CDY11847.1| BnaC03g12730D [Brassica napus]
Length=635

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAP   QK+L
Sbjct  449  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSVERFQKIQKEAPSKFQKYL  508

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY +A+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTY +LAAM+L
Sbjct  509  VQVTKYNSAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYDELAAMRL  568

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEYTM RGVVHACHAGG+VH LEGW HHEVGA++VD+ID+VWEAA+++GL 
Sbjct  569  PKDVQGLGTCEYTMDRGVVHACHAGGLVHMLEGWEHHEVGAVDVDRIDIVWEAAMRHGLS  628



>ref|XP_009417462.1| PREDICTED: protein ECERIFERUM 3-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +V EVFLTGATSKL RAIALYL R+RVRVLMLT STERF KIQ EAPV+CQ++L
Sbjct  439  LNEIPLNVPEVFLTGATSKLSRAIALYLCRKRVRVLMLTLSTERFQKIQKEAPVECQEYL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQA ++CKTWI+GKW + REQ  AP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  499  VQVTKYQAGQNCKTWIVGKWISLREQRCAPPGTHFHQFVVPPIISFRRDCTYGKLAAMRL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG CEYT+ RG+VHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW AALK+GL 
Sbjct  559  PQDVQGLGMCEYTLERGIVHACHAGGVVHLLEGWTHHEVGAIDVDRIDVVWRAALKHGLT  618

Query  237  PL  232
            P+
Sbjct  619  PV  620



>gb|KHN17538.1| Protein WAX2 [Glycine soja]
Length=632

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL +++V+VLMLT ST+RF +IQ EAP + Q +L
Sbjct  443  LNEIPQDVKEVFLTGATSKLGRAIALYLCQKKVKVLMLTLSTDRFQRIQKEAPPENQSYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQ WAP GTHFHQFVVPPI+ FR+DCTYG LAAM+L
Sbjct  503  VQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQFVVPPILSFRKDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGVVHACHAGGVVH+LEGW HHEVGAI+V++ID+VWEAALK+GL+
Sbjct  563  PEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWPHHEVGAIDVNRIDLVWEAALKHGLR  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>emb|CDY02769.1| BnaC02g11200D [Brassica napus]
Length=630

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V+EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAP + Q +L
Sbjct  444  LNEIPKGVEEVFLTGATSKLGRAIALYLCRRGVRVLMLTMSIERFQKIQKEAPAEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+++GL 
Sbjct  564  PKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMRHGLS  623



>ref|XP_009126813.1| PREDICTED: protein ECERIFERUM 3 [Brassica rapa]
Length=630

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V+EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAP + Q +L
Sbjct  444  LNEIPKGVEEVFLTGATSKLGRAIALYLCRRGVRVLMLTMSIERFQKIQKEAPAEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+++GL 
Sbjct  564  PKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLVWEAAMRHGLS  623



>gb|AGT16346.1| glossy1 protein [Saccharum hybrid cultivar R570]
 gb|AGT16349.1| glossy1 protein [Saccharum hybrid cultivar R570]
Length=622

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVFLTGATSKLGRAIALYL ++RVRV+M+T STERF KIQ EAP + Q++L
Sbjct  441  LNEIPKGTAEVFLTGATSKLGRAIALYLCKKRVRVMMMTLSTERFQKIQKEAPAEFQQYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HC+TWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  501  VQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+I VVWEAALK+GL+
Sbjct  561  PKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIGVVWEAALKHGLR  620

Query  237  P  235
            P
Sbjct  621  P  621



>dbj|BAJ85064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=660

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP  V EVFLTGATSKLGRAIALYL R+R+RVLMLT S+ERF+KIQ EAP + Q++L
Sbjct  479  LNEIPGSVKEVFLTGATSKLGRAIALYLCRKRIRVLMLTLSSERFLKIQREAPAEFQQYL  538

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AAK  KTW++GKW +PREQ WAP+GTHFHQFVVPP+I+FRRDCTYGKLAAM+L
Sbjct  539  VQVTKYHAAKTVKTWLVGKWLSPREQRWAPAGTHFHQFVVPPVIEFRRDCTYGKLAAMRL  598

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLGSCEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+IDVVW+AAL++GL 
Sbjct  599  PKDVQGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHEVGAIDVDRIDVVWKAALRHGLS  658

Query  237  P  235
            P
Sbjct  659  P  659



>ref|XP_003542310.1| PREDICTED: protein ECERIFERUM 3-like [Glycine max]
 gb|KHN34764.1| Protein WAX2 [Glycine soja]
Length=629

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL +++V+VLMLT ST+RF +IQ EAP + Q +L
Sbjct  443  LNEIPQDVKEVFLTGATSKLGRAIALYLCQKKVKVLMLTLSTDRFQRIQKEAPPEYQSYL  502

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQ WAP GTHFHQFVVPPI+ FR+DCTYG LAAM+L
Sbjct  503  VQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQFVVPPILPFRKDCTYGDLAAMRL  562

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CEYTM RGVVHACHAGGVVH+LEGW HHEVGAI+V++ID+VWEAALK+GL+
Sbjct  563  PEDVEGLGCCEYTMDRGVVHACHAGGVVHSLEGWPHHEVGAIDVNRIDLVWEAALKHGLR  622

Query  237  PL  232
            P+
Sbjct  623  PV  624



>ref|XP_010452800.1| PREDICTED: protein ECERIFERUM 3-like [Camelina sativa]
Length=632

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L ++P DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  446  LYELPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSVERFQKIQKEAPVEFQNYL  505

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTYG LAAM+L
Sbjct  506  VQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYGDLAAMRL  565

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK+VEGL +CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K GL 
Sbjct  566  PKNVEGLATCEYTMERGVVHACHAGGVVHMLEGWEHHEVGAIDVDRIDLVWEAAMKYGLS  625



>ref|XP_002308430.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
 gb|EEE91953.2| hypothetical protein POPTR_0006s19140g [Populus trichocarpa]
Length=633

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV EVFLTGATSKLGRAIALYL +RRVRVLMLT S ERF K+Q EAP++ Q +L
Sbjct  442  LNEIREDVKEVFLTGATSKLGRAIALYLCQRRVRVLMLTSSKERFQKVQKEAPLEYQSYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW TP EQSWAP+GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  502  VQVTKYQAARGCKTWIVGKWITPGEQSWAPTGTHFHQFVVPPILSFRRDCTYGDLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLG+CEYTM RGVVHACHAGG+VH LEGW HHEVGAI+VD+ID+VW AALK+GLK
Sbjct  562  PVDVQGLGNCEYTMDRGVVHACHAGGMVHLLEGWAHHEVGAIDVDRIDLVWNAALKHGLK  621

Query  237  PL  232
            P+
Sbjct  622  PV  623



>ref|XP_004507787.1| PREDICTED: protein ECERIFERUM 3-like [Cicer arietinum]
Length=633

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P DV+EVFLTGATSKLGRAIALYL +++VRVLMLT S +RF KI  EAPV+ Q +L
Sbjct  444  LNELPQDVEEVFLTGATSKLGRAIALYLCQKKVRVLMLTISNDRFQKILKEAPVEYQSYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++CKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  504  VQVTKYQAAQNCKTWIVGKWITPREQSWAPRGTHFHQFVVPPILSFRRDCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEG+G CEYTM RGVVHACHAGGVVH+LEGW+HHEVGAI+V++ID+VW+AALK+GL+
Sbjct  564  PEDVEGIGCCEYTMDRGVVHACHAGGVVHSLEGWSHHEVGAIDVNRIDLVWQAALKHGLR  623



>ref|XP_004956872.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=620

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R+RVRV+M+T S+ERF +IQ EAP + Q++L
Sbjct  439  LNEIPKGTSEVFMTGATSKLGRAIALYLCRKRVRVMMMTLSSERFQRIQKEAPPEFQQYL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HC+TWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  499  VQVTKYRSAQHCRTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAAL++GL+
Sbjct  559  PKDVQGLGTCEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALRHGLR  618

Query  237  P  235
            P
Sbjct  619  P  619



>emb|CDX88640.1| BnaA03g10090D [Brassica napus]
Length=600

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN +P DV EVFL GATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAP + QK+L
Sbjct  414  LNGVPKDVKEVFLIGATSKLGRAIALYLCRRGVRVLMLTLSVERFQKIQKEAPSEFQKYL  473

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY  A+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTY +LAAM+L
Sbjct  474  VQVTKYNFAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYDELAAMRL  533

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEYTM RGVVHACHAGG+VH LEGW HHEVGAI+VD+ID+VWEAA+++GL 
Sbjct  534  PKDVQGLGTCEYTMDRGVVHACHAGGLVHMLEGWEHHEVGAIDVDRIDLVWEAAMRHGLS  593



>ref|XP_010904609.1| PREDICTED: protein ECERIFERUM 3-like [Elaeis guineensis]
Length=617

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+++RV+MLT STERF+KIQ EA  +CQ +L
Sbjct  436  LNEIPKDVKEVFLTGATSKLGRAIALYLCRKKIRVMMLTLSTERFLKIQKEASPECQHYL  495

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK QAA+ CKTWI+GKW +PREQ WA SGTHFHQFVVPPII FRRDCTY KLAAM+L
Sbjct  496  VQVTKCQAAQSCKTWIVGKWLSPREQHWASSGTHFHQFVVPPIIGFRRDCTYWKLAAMRL  555

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH LEGW+HHEVGAI VD+IDVVW AA+K+GL 
Sbjct  556  PQDVQGLGTCEYTMERGVVHACHAGGVVHCLEGWSHHEVGAIAVDRIDVVWRAAMKHGLT  615

Query  237  PL  232
            P+
Sbjct  616  PV  617



>ref|XP_006343719.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=630

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +V EVFLTGATSKLGR IALYL RR+VRVLMLT STERF KIQ EAPV+ +K+L
Sbjct  442  LKEIPENVSEVFLTGATSKLGRVIALYLCRRQVRVLMLTMSTERFQKIQKEAPVEYKKYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ+TKYQAAK+CK WI+GKW TPREQS+AP GTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  502  VQITKYQAAKNCKAWIVGKWITPREQSYAPKGTHFHQFVVPPILAFRRDCTYGDLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+G+ SCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+V +ID+VW+AA+K+G K
Sbjct  562  PEDVQGVSSCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVHRIDLVWDAAMKHGFK  621

Query  237  PL  232
            P+
Sbjct  622  PV  623



>ref|NP_001063227.1| Os09g0426800 [Oryza sativa Japonica Group]
 dbj|BAD33619.1| putative Gl1 protein [Oryza sativa Japonica Group]
 dbj|BAF25141.1| Os09g0426800 [Oryza sativa Japonica Group]
 gb|EAZ09166.1| hypothetical protein OsI_31436 [Oryza sativa Indica Group]
Length=619

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R++VRV+M+T STERF KIQ EA  + Q++L
Sbjct  438  LNEIPQGTTEVFMTGATSKLGRAIALYLCRKKVRVMMMTLSTERFQKIQREATPEHQQYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HCKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  498  VQVTKYRSAQHCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAAL++GL+
Sbjct  558  PKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALRHGLR  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>ref|XP_010914062.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Elaeis guineensis]
Length=619

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV E+FLTGATSKLGRAIALYL R+R+RVLMLT S ERF KIQ EAP +CQ +L
Sbjct  438  LNEIHKDVKEIFLTGATSKLGRAIALYLCRKRIRVLMLTLSAERFQKIQKEAPPECQHYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+ CKTWI+GKW +P EQ+WAP GT FHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  498  VQVTKYQAAQSCKTWIVGKWLSPWEQTWAPPGTQFHQFVVPPIIGFRRDCTYGKLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG CEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW AALK+GL 
Sbjct  558  PQDVQGLGMCEYTMDRGVVHACHAGGVVHFLEGWTHHEVGAIDVDRIDVVWRAALKHGLT  617

Query  237  P  235
            P
Sbjct  618  P  618



>gb|EAZ44800.1| hypothetical protein OsJ_29433 [Oryza sativa Japonica Group]
Length=621

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 139/182 (76%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R++VRV+M+T STERF KIQ EA  + Q++L
Sbjct  440  LNEIPQGTTEVFMTGATSKLGRAIALYLCRKKVRVMMMTLSTERFQKIQREATPEHQQYL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A+HCKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+L
Sbjct  500  VQVTKYRSAQHCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKDV+GLG+CEY++ RGVVHACHAGGVVH LEG+THHEVGAI+VD+IDVVWEAAL++GL+
Sbjct  560  PKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVDRIDVVWEAALRHGLR  619

Query  237  PL  232
            P+
Sbjct  620  PV  621



>gb|AFK49575.1| unknown [Lotus japonicus]
Length=153

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T S +RF +IQ EAP + Q +LVQVTKYQAA+HCKTWI GKW TPREQSWAP GTHFHQF
Sbjct  3    TLSADRFKRIQKEAPQEYQSYLVQVTKYQAAQHCKTWIAGKWITPREQSWAPRGTHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPI+ FRRDCTYG+LAAM+LP+DVEGLGSCEYTM RGVVHACHAGGVVH+LEGWTHHE
Sbjct  63   VVPPILPFRRDCTYGELAAMRLPEDVEGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHE  122

Query  303  VGAINVDQIDVVWEAALKNGLKPL  232
            VGAI+VD+IDVVW+AALK+GL+P+
Sbjct  123  VGAIDVDRIDVVWKAALKHGLRPV  146



>emb|CAN69291.1| hypothetical protein VITISV_043141 [Vitis vinifera]
Length=155

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T STERF KIQ EAPV+ Q +LVQVTKYQAA++CKTWI+GKW TPR+Q+WAPSG HFHQF
Sbjct  3    TLSTERFQKIQREAPVEFQNYLVQVTKYQAAQNCKTWIVGKWITPRQQNWAPSGAHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPI+ FRRDCTYG LAA+KLP+DV+GLGSCEYTM RGVVHACHAGGVVH LEGWTHHE
Sbjct  63   VVPPILPFRRDCTYGDLAALKLPEDVQGLGSCEYTMERGVVHACHAGGVVHVLEGWTHHE  122

Query  303  VGAINVDQIDVVWEAALKNGLKPL  232
            VGA++VD+IDVVW+AALK+GLKP+
Sbjct  123  VGALDVDRIDVVWKAALKHGLKPV  146



>gb|KJB27033.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=610

 Score =   234 bits (598),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N+IP DV EVFLTG+TSKLGRAIALYL RRR+RVLMLT STERF KIQ EAP D Q +L
Sbjct  426  VNEIPKDVKEVFLTGSTSKLGRAIALYLCRRRIRVLMLTLSTERFQKIQKEAPADTQNYL  485

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V VTKYQAA++CKTWI GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  486  VHVTKYQAAQNCKTWIAGKWITPWEQSWAPSGTHFHQFVVPPILASRRDCTYGDLAAMRL  545

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEY + RGVVHACHAGG VH LEGWTHHE+G I+VD+ID+VWEAALK+G +
Sbjct  546  PEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIGPIDVDRIDLVWEAALKHGFR  605

Query  237  PL  232
            P+
Sbjct  606  PV  607



>ref|XP_010929210.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Elaeis guineensis]
Length=619

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 161/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+++RVLMLT S ERF KIQ EAP +CQ +L
Sbjct  438  LNEIPKDVKEVFLTGATSKLGRAIALYLCRKKIRVLMLTLSAERFQKIQKEAPPECQHYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA++C+TWI+GKW +P EQ  AP GTHFHQFVVPPII FRRDCTYG LAAM+L
Sbjct  498  VQVTKYQAAQNCETWIVGKWLSPLEQRCAPPGTHFHQFVVPPIIGFRRDCTYGNLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG CEYTM RGVVHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW AALK+GL 
Sbjct  558  PQDVQGLGMCEYTMQRGVVHACHAGGVVHFLEGWTHHEVGAIDVDRIDVVWRAALKHGLT  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>gb|KJB27032.1| hypothetical protein B456_004G273200 [Gossypium raimondii]
Length=625

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N+IP DV EVFLTG+TSKLGRAIALYL RRR+RVLMLT STERF KIQ EAP D Q +L
Sbjct  441  VNEIPKDVKEVFLTGSTSKLGRAIALYLCRRRIRVLMLTLSTERFQKIQKEAPADTQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V VTKYQAA++CKTWI GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  501  VHVTKYQAAQNCKTWIAGKWITPWEQSWAPSGTHFHQFVVPPILASRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEY + RGVVHACHAGG VH LEGWTHHE+G I+VD+ID+VWEAALK+G +
Sbjct  561  PEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIGPIDVDRIDLVWEAALKHGFR  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_010536953.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 3-like [Tarenaya 
hassleriana]
Length=621

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EA V  Q +L
Sbjct  435  LNEVPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQKEAAVGHQNYL  494

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWI+GKW TPREQ WAP GTHFHQFVVPPI++FR++C+YG LAAM+L
Sbjct  495  VQVTKYQAAQHCKTWIVGKWLTPREQRWAPKGTHFHQFVVPPILRFRKNCSYGDLAAMRL  554

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VW AAL+ G  
Sbjct  555  PPDVNGLGTCEYTMERGVVHACHAGGVVHMLEGWDHHEVGAIDVDRIDIVWSAALRLGFA  614

Query  237  P  235
            P
Sbjct  615  P  615



>gb|ACF79563.1| unknown [Zea mays]
Length=146

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T STERF+KIQ EAP + Q+++VQVTKYQAA+ CKTWI+GKW +PREQ WAP GTHFHQF
Sbjct  3    TLSTERFLKIQREAPPEFQQYIVQVTKYQAAQGCKTWIVGKWLSPREQRWAPPGTHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPII FRRDCTYGKLAAM+LPKDVEGLGSCEYTM RGVVHACHAGGVVH LEGW HHE
Sbjct  63   VVPPIIGFRRDCTYGKLAAMRLPKDVEGLGSCEYTMERGVVHACHAGGVVHCLEGWEHHE  122

Query  303  VGAINVDQIDVVWEAALKNGLKP  235
            VGA+ VD+IDVVWEAALK+GL P
Sbjct  123  VGALEVDRIDVVWEAALKHGLTP  145



>gb|KHG04939.1| Protein WAX2 [Gossypium arboreum]
Length=625

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            + +IP DV EVFLTG+TSKLGRAIALYL+RR VRVLMLT STERF KIQ EAP D Q +L
Sbjct  441  VKEIPKDVKEVFLTGSTSKLGRAIALYLSRRHVRVLMLTSSTERFQKIQKEAPTDTQNYL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V VTKYQAA++CKTWI GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  501  VHVTKYQAAQNCKTWIAGKWITPWEQSWAPSGTHFHQFVVPPILASRRDCTYGDLAAMRL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEY + RGVVHACHAGG VH LEGWTHHE+G I+VD+ID+VWEAALK+G +
Sbjct  561  PEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIGPIDVDRIDLVWEAALKHGFR  620

Query  237  PL  232
            P+
Sbjct  621  PV  622



>ref|XP_010545441.1| PREDICTED: protein ECERIFERUM 3 isoform X1 [Tarenaya hassleriana]
Length=629

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 161/187 (86%), Gaps = 0/187 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EA V+ Q +L
Sbjct  442  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQKEAAVEDQNYL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWI+GKW TPREQ WAP G HFHQFVVPP+I+FR++C+YG LAAM+L
Sbjct  502  VQVTKYQAAQHCKTWIVGKWMTPREQRWAPPGAHFHQFVVPPVIRFRKNCSYGDLAAMRL  561

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWE+AL+ G  
Sbjct  562  PVDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWDHHEVGAIDVDRIDLVWESALRLGFT  621

Query  237  PL*RMPF  217
             L   P 
Sbjct  622  SLSSSPL  628



>gb|AEW67744.1| WAX2 protein [Eutrema halophilum]
Length=157

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T S ERF +IQ EAP + Q +LVQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQF
Sbjct  9    TLSVERFQRIQREAPAEFQNYLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQF  68

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPI+ FRR+CTYG LAAM+LPKDV+GLG CEYTM RGVVHACHAGGVVH LEGW HHE
Sbjct  69   VVPPILNFRRNCTYGDLAAMRLPKDVQGLGHCEYTMDRGVVHACHAGGVVHMLEGWEHHE  128

Query  303  VGAINVDQIDVVWEAALKNGLKPL  232
            VGAI+VD+ID+VWEAA+K GL+P+
Sbjct  129  VGAIDVDRIDLVWEAAMKYGLRPV  152



>ref|XP_011070158.1| PREDICTED: protein ECERIFERUM 3-like [Sesamum indicum]
Length=626

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV EVFLTGATSKLGRAIALYL ++ VRVLMLT STERF  IQ EAP DCQK L
Sbjct  440  LNEI-KDVTEVFLTGATSKLGRAIALYLCKKGVRVLMLTLSTERFRMIQKEAPADCQKNL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + VTKYQAA++CKTWI+GKW TPREQS+APSGT FHQFVVPP+   RRDCTYG LAAMKL
Sbjct  499  IHVTKYQAAQNCKTWIVGKWITPREQSFAPSGTQFHQFVVPPVSPSRRDCTYGNLAAMKL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P D EGLG CEYTM RGVVHACHAGG+VH+LEGWTHHEVGAI VD+ID+VWEAAL++GLK
Sbjct  559  PDDAEGLGCCEYTMERGVVHACHAGGMVHSLEGWTHHEVGAIEVDRIDLVWEAALRHGLK  618

Query  237  PL  232
            P+
Sbjct  619  PV  620



>gb|AAK68765.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72130.1| Unknown protein [Arabidopsis thaliana]
Length=151

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T S ERF KIQ EAPV+ Q  LVQVTKY AA+HCKTWI+GKW TPREQSWAP+GTHFHQF
Sbjct  3    TLSMERFQKIQKEAPVEFQNNLVQVTKYNAAQHCKTWIVGKWLTPREQSWAPAGTHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPI++FRR+CTYG LAAMKLPKDVEGLG+CEYTM RGVVHACHAGGVVH LEGW HHE
Sbjct  63   VVPPILKFRRNCTYGDLAAMKLPKDVEGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHE  122

Query  303  VGAINVDQIDVVWEAALKNGLKPL  232
            VGAI+VD+ID+VWEAA+K GL  +
Sbjct  123  VGAIDVDRIDLVWEAAMKYGLSAV  146



>ref|XP_002460243.1| hypothetical protein SORBIDRAFT_02g025230 [Sorghum bicolor]
 gb|EER96764.1| hypothetical protein SORBIDRAFT_02g025230 [Sorghum bicolor]
Length=146

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T STERF KIQ EAP + Q++LVQVTKY+AA+HC+TWI+GKW +PREQ WAP GTHFHQF
Sbjct  3    TLSTERFQKIQKEAPAEFQQYLVQVTKYRAAQHCRTWIVGKWLSPREQRWAPPGTHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPII FRRDCTYGKLAAM+LPKDV+GLG+CEY++ RGVVHACHAGGVVH LEG+THHE
Sbjct  63   VVPPIIGFRRDCTYGKLAAMRLPKDVQGLGACEYSLERGVVHACHAGGVVHFLEGYTHHE  122

Query  303  VGAINVDQIDVVWEAALKNGLKP  235
            VGAI+V +IDVVWEAALK+GL+P
Sbjct  123  VGAIDVHRIDVVWEAALKHGLRP  145



>ref|XP_008775261.1| PREDICTED: protein ECERIFERUM 3-like [Phoenix dactylifera]
Length=441

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L+ IP DV EVFLTGATSKLGRAIALYL R+++RVLMLT S ERF+KIQ EA  +CQ +L
Sbjct  260  LDKIPKDVTEVFLTGATSKLGRAIALYLCRKKIRVLMLTLSPERFLKIQKEASPECQHYL  319

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK +AA++CKTWI GKW + REQ  APSGTHFHQFVVPPII FR+DCTYGKLAAM+L
Sbjct  320  VQVTKCEAAQNCKTWIAGKWLSAREQRCAPSGTHFHQFVVPPIINFRKDCTYGKLAAMRL  379

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CE+ M RGVVHACH+GGVVH LEGW+HHEVGAI+VDQIDVVW AA+K+GL 
Sbjct  380  PQDVQGLGTCEHAMERGVVHACHSGGVVHCLEGWSHHEVGAIDVDQIDVVWRAAMKHGLT  439

Query  237  PL  232
            P+
Sbjct  440  PV  441



>ref|XP_009120299.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Brassica rapa]
Length=630

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+ VRVLMLT S ERF KIQ EAPV+ Q +L
Sbjct  444  LNEIPKDVKEVFLTGATSKLGRAIALYLCRQGVRVLMLTLSVERFQKIQKEAPVEFQNYL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY AA++CKTWI+GKW TPREQSWAP GTHFHQFVVPPI+ FRR+CTYG LAAM+L
Sbjct  504  VQVTKYNAAQNCKTWIVGKWLTPREQSWAPKGTHFHQFVVPPILNFRRNCTYGDLAAMRL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLG+CEYTM RGVVHACHAGGVVH  EG  H EVGAI+VD+ID+VWEAA+++GL+
Sbjct  564  PEDVQGLGTCEYTMDRGVVHACHAGGVVHMREGGEHQEVGAIDVDRIDLVWEAAMRHGLR  623



>ref|XP_007154832.1| hypothetical protein PHAVU_003G1516001g [Phaseolus vulgaris]
 gb|ESW26826.1| hypothetical protein PHAVU_003G1516001g [Phaseolus vulgaris]
Length=151

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T ST+RF +IQ EAPV+ Q +LVQVTKYQAA++CKTWI+GKW TPREQ WAP GTHFHQF
Sbjct  3    TLSTDRFQRIQKEAPVEYQNYLVQVTKYQAAQNCKTWIVGKWITPREQYWAPRGTHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPPI+ FR+DCTYG LAAM+LP+DVEGLG CEYTM RGVVHACHAGGVVH+LEGW HHE
Sbjct  63   VVPPILSFRKDCTYGDLAAMRLPEDVEGLGCCEYTMERGVVHACHAGGVVHSLEGWDHHE  122

Query  303  VGAINVDQIDVVWEAALKNGLKPL*RM  223
            VGA++V++ID+VWEAALK+GL+P+ R 
Sbjct  123  VGALDVNRIDLVWEAALKHGLRPVSRF  149



>dbj|BAK04110.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 166/215 (77%), Gaps = 33/215 (15%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  EVFLTGATSKLGRAIALYL R+R+RV+MLT S+ERF+KIQ EAP + Q++L
Sbjct  352  LNEIPSNTKEVFLTGATSKLGRAIALYLCRKRIRVIMLTMSSERFLKIQREAPAEFQQYL  411

Query  597  VQVTKYQAAKHCK---------------------------------TWIIGKWATPREQS  517
            VQVTKYQAA++CK                                 TW++GKW +PREQ 
Sbjct  412  VQVTKYQAAQNCKVSPAFSHPIADQSVVLYRPCMMMCYMMVTLGVQTWLVGKWLSPREQR  471

Query  516  WAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggv  337
            WAP GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GLGSCEYTM RGVVHACHAGGV
Sbjct  472  WAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGSCEYTMERGVVHACHAGGV  531

Query  336  vhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
            VH LEGW HHEVGA++VD+IDVVW+AALK+GL P+
Sbjct  532  VHFLEGWQHHEVGALDVDRIDVVWKAALKHGLTPV  566



>ref|XP_003578148.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
 ref|XP_010238185.1| PREDICTED: protein ECERIFERUM 3-like [Brachypodium distachyon]
Length=619

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R+++RV+M+T STERF KIQ EA  + Q++L
Sbjct  438  LNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTLSTERFQKIQKEAAAEHQQYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY++A  CKTWI+GKW +PREQ WAP GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  498  VQVTKYRSAGQCKTWIVGKWLSPREQRWAPPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKD  GLGSCE+++ RGVVHACHAGGVVH LEG+THHEVGAI+V +IDVVWEAALK+GL+
Sbjct  558  PKDARGLGSCEFSLERGVVHACHAGGVVHFLEGYTHHEVGAIDVGRIDVVWEAALKHGLR  617

Query  237  P  235
            P
Sbjct  618  P  618



>ref|XP_006350059.1| PREDICTED: protein ECERIFERUM 3-like [Solanum tuberosum]
Length=629

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  777  LNDIPX-DVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKF  601
            LN IP  DV+EVFLTGATSKLGRAIALYL  ++VRVLMLT STERF KI  EAP + QK+
Sbjct  440  LNQIPKHDVNEVFLTGATSKLGRAIALYLCTKQVRVLMLTSSTERFQKILKEAPYEYQKY  499

Query  600  LVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMK  421
            LV VTKYQAA++CKTWI+GKW TPREQ +AP G HFHQFVVPP++ +R DCTYG LAAM+
Sbjct  500  LVHVTKYQAARNCKTWIVGKWITPREQKFAPVGAHFHQFVVPPVLPYRSDCTYGDLAAMR  559

Query  420  LPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            LP  V+GLGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+V +ID+VWEAALK+GL
Sbjct  560  LPPHVKGLGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVQRIDLVWEAALKHGL  619

Query  240  KPL  232
             P+
Sbjct  620  MPV  622



>dbj|BAK02959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R+++RV+M+T STERF KIQ EA  + Q++L
Sbjct  438  LNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTLSTERFQKIQKEAAAEHQQYL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK+Q+A+ C+TWI+GKW +PREQ WA  GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  498  VQVTKFQSAEQCRTWIVGKWLSPREQRWASPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKD  GLGSCE+++ RGVVHACHAGGVVH LEG+ HHEVGAI+VD+IDVVWEAALK+G++
Sbjct  558  PKDARGLGSCEFSLERGVVHACHAGGVVHFLEGYAHHEVGAIDVDRIDVVWEAALKHGIR  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>emb|CDX88642.1| BnaA03g10070D [Brassica napus]
Length=637

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 160/184 (87%), Gaps = 2/184 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN +P DV EVFLTGATSKLGRAIALYL RR VRVLMLT S ERF  IQ EAP + Q +L
Sbjct  449  LNGVPKDVKEVFLTGATSKLGRAIALYLCRRGVRVLMLTLSAERFQNIQKEAPAEFQNYL  508

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY +A+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+ TY +LAA++L
Sbjct  509  VQVTKYNSAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNYTYDELAAVRL  568

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVD--QIDVVWEAALKNG  244
            PKDV+GLG+CEYTM RGVVHACHAGG+VH LEGW HHEVGA++V+  +ID+VWEAA+++G
Sbjct  569  PKDVQGLGTCEYTMDRGVVHACHAGGLVHMLEGWEHHEVGAVDVEPLRIDLVWEAAMRHG  628

Query  243  LKPL  232
            L  L
Sbjct  629  LSSL  632



>gb|ADE77418.1| unknown [Picea sitchensis]
Length=283

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++  DV EVFLTGATSKLGR IALYL R+ +RV+MLT S ERF  IQSEAP + Q FL
Sbjct  101  LNELNPDVKEVFLTGATSKLGRVIALYLCRKGIRVMMLTYSKERFKSIQSEAPPEFQNFL  160

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY+AA++CKTWI+GKW   +EQ+WAP G H HQFVVPPI + R+DCTYGKLA M+L
Sbjct  161  VQVTKYEAAQNCKTWIVGKWIAYKEQTWAPVGCHLHQFVVPPIFELRKDCTYGKLAGMQL  220

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  VEGL +CEYTM R  VHACHAGG++H+LEGW HHEVGAI+V++ID+VWEAAL +G K
Sbjct  221  PDAVEGLSTCEYTMPRRCVHACHAGGILHSLEGWEHHEVGAIDVNKIDMVWEAALNHGFK  280

Query  237  PL  232
            P+
Sbjct  281  PM  282



>ref|XP_004973574.1| PREDICTED: protein ECERIFERUM 3-like [Setaria italica]
Length=618

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP    EVFLTGATSKLGRAIALYL R+RVRV+MLT S ERF K+Q EAP + +++L
Sbjct  437  LREIPEGTAEVFLTGATSKLGRAIALYLCRKRVRVMMLTASEERFQKVQEEAPPEARQYL  496

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V+VTKYQ+A+HCKTWI GKW +P +Q WAP+GTHFHQFVVPPI++FRRDCTYG LAAM+L
Sbjct  497  VRVTKYQSAQHCKTWIAGKWLSPGDQRWAPAGTHFHQFVVPPILRFRRDCTYGDLAAMRL  556

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P DV+GLG CEYT+GRGVVHACHAGGVVH LEG+  HEVGAI+VD+IDVVWEAAL++GL+
Sbjct  557  PDDVQGLGVCEYTLGRGVVHACHAGGVVHFLEGYEGHEVGAIDVDRIDVVWEAALRHGLR  616

Query  237  P  235
            P
Sbjct  617  P  617



>emb|CAN62442.1| hypothetical protein VITISV_009194 [Vitis vinifera]
Length=459

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 140/182 (77%), Gaps = 13/182 (7%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +IP +  +VFLTGATSKLGRAI+LYL R+++ VLMLTQS+ERF  IQ EAP+DCQ+FL
Sbjct  291  LKEIPQNATQVFLTGATSKLGRAISLYLCRKKIXVLMLTQSSERFESIQREAPIDCQQFL  350

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQAA+HCKTWIIGKW TPREQSWAP GTHFHQFVVPPI+ FRRDCTYGKLAAM+L
Sbjct  351  VQVTKYQAAQHCKTWIIGKWCTPREQSWAPPGTHFHQFVVPPILGFRRDCTYGKLAAMRL  410

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLG CE  +                  G T    GAI+VDQIDV W AAL +G K
Sbjct  411  PEDVEGLGXCEVVLFISYKV------------GLT-MRFGAIDVDQIDVAWTAALSHGFK  457

Query  237  PL  232
            P+
Sbjct  458  PV  459



>gb|EYU37115.1| hypothetical protein MIMGU_mgv1a021583mg [Erythranthe guttata]
Length=609

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -1

Query  759  DVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFLVQVTKY  580
            DV EV LTGATSKLGRAIALYL R+ VRVLMLT S ERF  IQ EAP + Q  LVQVTKY
Sbjct  430  DVTEVSLTGATSKLGRAIALYLCRKGVRVLMLTLSAERFKNIQIEAPAEFQNNLVQVTKY  489

Query  579  QAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEG  400
            QAA++CKTWI+GKW TPREQ +AP G HFHQFVVPP+ QFRRDCTYG LAAM+LP+DV+G
Sbjct  490  QAAQNCKTWIVGKWITPREQKFAPPGAHFHQFVVPPVFQFRRDCTYGDLAAMRLPEDVQG  549

Query  399  LGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
            LG CEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+V++ID VWEAA+K G KP+
Sbjct  550  LGVCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVERIDPVWEAAMKYGFKPI  605



>ref|XP_010914063.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Elaeis guineensis]
Length=596

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = -1

Query  735  GATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKT  556
            GATSKLGRAIALYL R+R+RVLMLT S ERF KIQ EAP +CQ +LVQVTKYQAA+ CKT
Sbjct  429  GATSKLGRAIALYLCRKRIRVLMLTLSAERFQKIQKEAPPECQHYLVQVTKYQAAQSCKT  488

Query  555  WIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTM  376
            WI+GKW +P EQ+WAP GT FHQFVVPPII FRRDCTYGKLAAM+LP+DV+GLG CEYTM
Sbjct  489  WIVGKWLSPWEQTWAPPGTQFHQFVVPPIIGFRRDCTYGKLAAMRLPQDVQGLGMCEYTM  548

Query  375  GRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKP  235
             RGVVHACHAGGVVH LEGWTHHEVGAI+VD+IDVVW AALK+GL P
Sbjct  549  DRGVVHACHAGGVVHFLEGWTHHEVGAIDVDRIDVVWRAALKHGLTP  595



>gb|ADE75704.1| unknown [Picea sitchensis]
Length=623

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++  DV EVFLTGATSKLGR IALYL R+ +RV+MLT S ERF  IQSEAP + Q FL
Sbjct  441  LNELNPDVKEVFLTGATSKLGRVIALYLCRKGIRVMMLTYSKERFKSIQSEAPPEFQNFL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY+AA++CKTWI+GKW   +EQ+WAP G H HQFVVPPI + R+DCTYGKLA M+L
Sbjct  501  VQVTKYEAAQNCKTWIVGKWIAYKEQTWAPVGCHLHQFVVPPIFELRKDCTYGKLAGMQL  560

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  VEGL +CEYTM R  VHACHAGG++H+LEGW HHEVGAI+V++ID+VWEAALK+G K
Sbjct  561  PDAVEGLSTCEYTMPRRCVHACHAGGILHSLEGWEHHEVGAIDVNKIDMVWEAALKHGFK  620

Query  237  PL  232
            P+
Sbjct  621  PM  622



>ref|XP_002961424.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
 gb|EFJ36684.1| hypothetical protein SELMODRAFT_164680 [Selaginella moellendorffii]
Length=620

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L ++P +  EVFLTG+TSK+GRAIALYL RR VR++MLT S ER+  I  EAP DC+  L
Sbjct  438  LRELPAETSEVFLTGSTSKIGRAIALYLCRRNVRIMMLTTSRERYQSIVDEAPADCRHNL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQA + CKTWI+GKWAT ++QSWAP G+HFHQFVVPP+ ++R+DCTYGKLA MKL
Sbjct  498  VQVTKYQAGQTCKTWIVGKWATSQDQSWAPHGSHFHQFVVPPVHEYRKDCTYGKLAGMKL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+ VEG+ SCEYT  RGVV ACHAGG+VHALE WTHHEVG+I++D ID+VWEAALK+GL+
Sbjct  558  PQSVEGVHSCEYTFDRGVVAACHAGGLVHALENWTHHEVGSIDIDHIDLVWEAALKHGLE  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>ref|XP_002990278.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
 gb|EFJ08693.1| hypothetical protein SELMODRAFT_185167 [Selaginella moellendorffii]
Length=620

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L ++P +  EVFLTG+TSK+GRAIALYL RR VR++MLT S ER+  I  EAP DC+  L
Sbjct  438  LRELPAETSEVFLTGSTSKIGRAIALYLCRRNVRIMMLTTSRERYQSIVDEAPADCRHNL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQA + CKTWI+GKWAT ++QSWAP G+HFHQFVVPP+ ++R+DCTYGKLA MKL
Sbjct  498  VQVTKYQAGQTCKTWIVGKWATSQDQSWAPHGSHFHQFVVPPVHEYRKDCTYGKLAGMKL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+ VEG+ SCEYT  RGVV ACHAGG+VHALE WTHHEVG+I++D ID+VWEAALK+GL+
Sbjct  558  PQSVEGVHSCEYTFDRGVVAACHAGGLVHALENWTHHEVGSIDIDHIDLVWEAALKHGLE  617

Query  237  PL  232
            P+
Sbjct  618  PV  619



>ref|XP_006836672.1| hypothetical protein AMTR_s00088p00066300 [Amborella trichopoda]
 gb|ERM99525.1| hypothetical protein AMTR_s00088p00066300 [Amborella trichopoda]
Length=364

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L +I   VD+VFLTGATSKLGRAIA+YL  R+VRVLMLT S +RF  I  EAPV+ +KFL
Sbjct  181  LREINEKVDDVFLTGATSKLGRAIAIYLCIRKVRVLMLTNSKKRFESILHEAPVEYRKFL  240

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V VT+Y   K+CKTWI+GKW + R+Q WAP GT+FHQF +P I + RRDC YGK+AA++L
Sbjct  241  VHVTRYDEGKNCKTWIVGKWMSARDQRWAPPGTYFHQFAIPVITESRRDCKYGKMAAIRL  300

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DV+GLGSCEY MGRGVVHACHAGG+VH LEGW HHEVGAI+VD IDVVW  ALK+G K
Sbjct  301  PEDVQGLGSCEYVMGRGVVHACHAGGMVHLLEGWKHHEVGAIDVDMIDVVWNKALKHGFK  360

Query  237  PL  232
            P+
Sbjct  361  PV  362



>ref|XP_004252089.1| PREDICTED: protein ECERIFERUM 3-like [Solanum lycopersicum]
Length=248

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 7/168 (4%)
 Frame = -1

Query  759  DVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFLVQVTKY  580
            DV+EVFL+GA +       LYL  ++VRVLM T S+ERF KI  EAP + QK+LV VTKY
Sbjct  88   DVNEVFLSGAIA-------LYLCTKQVRVLMSTSSSERFQKILKEAPYEYQKYLVHVTKY  140

Query  579  QAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEG  400
            QAAK+CKT I+GKW TPREQ +AP G HFHQFVVPPI+ +R DCTYG LAAM+LP  V+G
Sbjct  141  QAAKNCKTCIVGKWITPREQKFAPVGAHFHQFVVPPILPYRNDCTYGDLAAMRLPPHVKG  200

Query  399  LGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAA  256
            LGSCEYTM RGVVHACHAGGVVH+LEGWTHHEVGAI+V +ID+VWEAA
Sbjct  201  LGSCEYTMERGVVHACHAGGVVHSLEGWTHHEVGAIDVQRIDLVWEAA  248



>gb|EMT23422.1| Protein WAX2 [Aegilops tauschii]
Length=694

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 137/238 (58%), Positives = 162/238 (68%), Gaps = 56/238 (24%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  EVFLTGATSKLGRAIALYL R+++RV+MLT S+ERF+KIQ EAP + Q++L
Sbjct  457  LNEIPSNTKEVFLTGATSKLGRAIALYLCRKKIRVVMLTMSSERFLKIQREAPAEFQQYL  516

Query  597  VQVTK----------------------------------------------YQAAKH---  565
            VQVTK                                              Y+ + H   
Sbjct  517  VQVTKYQAAQNCKTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYRRSNHPIA  576

Query  564  -------CKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDV  406
                     TW++GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV
Sbjct  577  HQFVPLCYDTWLVGKWLSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDV  636

Query  405  EGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
            +GLGSCEY+M RGVVHACHAGGVVH LEGW HHEVGA++VD+IDVVW+AALK+GL P+
Sbjct  637  QGLGSCEYSMERGVVHACHAGGVVHFLEGWEHHEVGALDVDRIDVVWKAALKHGLTPV  694



>ref|XP_001781794.1| predicted protein [Physcomitrella patens]
 gb|EDQ53442.1| predicted protein [Physcomitrella patens]
Length=625

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 148/183 (81%), Gaps = 1/183 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +  +P DV EVF+TGATSKLGRAIALYL  R +RVLMLT STERF  IQ EAP DC+  L
Sbjct  441  IKTLPPDVKEVFMTGATSKLGRAIALYLCARGIRVLMLTTSTERFDAIQREAPADCRNNL  500

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + VTKYQA K+CKTWI+GKW   ++Q WAP GT FHQFVVP I + R+DCTYG+LA M L
Sbjct  501  IHVTKYQAGKNCKTWIVGKWTFAKDQQWAPPGTFFHQFVVPVISEVRKDCTYGQLAGMVL  560

Query  417  PKD-VEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            PK+ V+GL +CE+TM RG VHACHAGG++H LEGWTHHEVG+I+V +IDVVWEAA+++G 
Sbjct  561  PKEGVKGLRTCEFTMERGAVHACHAGGMIHTLEGWTHHEVGSIDVSRIDVVWEAAMRHGF  620

Query  240  KPL  232
             P+
Sbjct  621  API  623



>ref|XP_001783415.1| predicted protein [Physcomitrella patens]
 gb|EDQ51755.1| predicted protein [Physcomitrella patens]
Length=626

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV E+FLTGATSKLGRAIALY   R VRVLMLT S +RF  IQSE     ++ +
Sbjct  444  LNEIPKDVKEIFLTGATSKLGRAIALYFCHRGVRVLMLTTSRDRFEMIQSELAPQHRENM  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +QVTKYQA ++CK W++GKWATP EQ WAP GTHFHQFVVPP+++ R+DCTYGKL+AM++
Sbjct  504  IQVTKYQAGQNCKRWVLGKWATPSEQKWAPPGTHFHQFVVPPVMECRKDCTYGKLSAMQV  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK+++GL SCE TM RGVVHACHAGG+VHALEGW  HEVGAI+V +ID  W AALK G K
Sbjct  564  PKEMKGLRSCEMTMPRGVVHACHAGGLVHALEGWEFHEVGAIDVGRIDETWAAALKQGFK  623

Query  237  PL  232
            P+
Sbjct  624  PV  625



>ref|XP_002975687.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
 gb|EFJ23316.1| hypothetical protein SELMODRAFT_103982 [Selaginella moellendorffii]
Length=628

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 143/179 (80%), Gaps = 0/179 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN++P +V+EVFLTGATSKLGRAIALYL R+ VRVLMLT S  R+  I SEA  + ++ L
Sbjct  447  LNELPAEVEEVFLTGATSKLGRAIALYLCRKGVRVLMLTSSRSRYESILSEAAAEHRRNL  506

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V VTKYQA ++CK WIIGKW T REQ +AP GTHFHQFVVPP+ + R DCTYGKL  MKL
Sbjct  507  VHVTKYQAGQYCKRWIIGKWVTEREQGFAPVGTHFHQFVVPPVQEVRSDCTYGKLVGMKL  566

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            PKDV G+ +CEY   RGVV ACHAGG++HALE W+HHEVG+I+V++ID VW+AAL  G 
Sbjct  567  PKDVAGVHTCEYINDRGVVAACHAGGLLHALEEWSHHEVGSIDVERIDTVWQAALSRGF  625



>ref|XP_002960347.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
 gb|EFJ37886.1| hypothetical protein SELMODRAFT_437448 [Selaginella moellendorffii]
Length=626

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N++  D  EVFLTG+TSK+GRA+ALYL RR VRVLMLT S ER+  +  +APV+ QK L
Sbjct  444  INELRPDAKEVFLTGSTSKIGRALALYLCRRGVRVLMLTNSRERYEAVVKDAPVEFQKNL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQA ++CKTWI+GKW   ++QSWAP GT FHQFVVPP+ + R+D TYGKL+ M L
Sbjct  504  VQVTKYQAGQNCKTWIVGKWIFAKDQSWAPPGTFFHQFVVPPVAEIRKDVTYGKLSGMYL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK+ EGL  CE+TM RGVVHACHAGG++HALEGW HHE+G+I+++ ID VW+AAL+ G  
Sbjct  564  PKNHEGLHFCEFTMPRGVVHACHAGGLLHALEGWDHHEIGSIDIENIDKVWQAALRQGFA  623

Query  237  P  235
            P
Sbjct  624  P  624



>ref|XP_002967368.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
 gb|EFJ31967.1| hypothetical protein SELMODRAFT_408343 [Selaginella moellendorffii]
Length=626

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N++  D  EVFLTG+TSK+GRA+ALYL RR VRVLMLT S ER+  +  +APV+ QK L
Sbjct  444  INELRPDAKEVFLTGSTSKIGRALALYLCRRGVRVLMLTNSRERYEAVVKDAPVEFQKNL  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKYQA ++CKTWI+GKW   ++QSWAP GT FHQFVVPP+ + R+D TYGKL+ M L
Sbjct  504  VQVTKYQAGQNCKTWIVGKWIFAKDQSWAPPGTFFHQFVVPPVAEIRKDVTYGKLSGMYL  563

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK+ EGL  CE+TM RGVVHACHAGG++HALEGW HHE+G+I+++ ID VW+AAL+ G  
Sbjct  564  PKNHEGLHFCEFTMPRGVVHACHAGGLLHALEGWDHHEIGSIDIENIDKVWQAALRQGFA  623

Query  237  P  235
            P
Sbjct  624  P  624



>ref|XP_009387452.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  EVFLTGATSKLGRAIALYL R+ +RVLMLT S ERF+ IQ EAP DCQ  L
Sbjct  436  LNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTLSAERFLNIQKEAPADCQHHL  495

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK QAA++CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYG LAAM+L
Sbjct  496  VQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGSLAAMRL  555

Query  417  PKDVEGLGSCE  385
            PKDV+GLGSCE
Sbjct  556  PKDVQGLGSCE  566



>ref|XP_009132284.1| PREDICTED: protein ECERIFERUM 3-like [Brassica rapa]
Length=580

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN +P DV EVFL GATSKLGRAIALYL RR VRVLMLT S ERF KIQ EAP + QK+L
Sbjct  449  LNGVPKDVKEVFLIGATSKLGRAIALYLCRRGVRVLMLTLSVERFEKIQKEAPSEFQKYL  508

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTKY +A+HCKTWI+GKW TPREQSWAP+GTHFHQFVVPPI++FRR+CTY +LAAM+L
Sbjct  509  VQVTKYNSAQHCKTWIVGKWLTPREQSWAPAGTHFHQFVVPPILKFRRNCTYDELAAMRL  568

Query  417  PKDVEGLGSCE  385
            PKDV+GLG+CE
Sbjct  569  PKDVQGLGTCE  579



>ref|XP_009387450.1| PREDICTED: protein ECERIFERUM 3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  EVFLTGATSKLGRAIALYL R+ +RVLMLT S ERF+ IQ EAP DCQ  L
Sbjct  466  LNEIPRDAKEVFLTGATSKLGRAIALYLCRKNIRVLMLTLSAERFLNIQKEAPADCQHHL  525

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQVTK QAA++CKTWI+GKW +PREQ WAP GTHFHQFVVPPII FRRDCTYG LAAM+L
Sbjct  526  VQVTKCQAAQNCKTWIVGKWMSPREQRWAPPGTHFHQFVVPPIIGFRRDCTYGSLAAMRL  585

Query  417  PKDVEGLGSCE  385
            PKDV+GLGSCE
Sbjct  586  PKDVQGLGSCE  596



>ref|XP_001782380.1| predicted protein [Physcomitrella patens]
 gb|EDQ52834.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 142/183 (78%), Gaps = 1/183 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +  +P DV EVF+ GATSKLGRAIALYL  R +RV+MLT S +RF  IQ EAP + +  L
Sbjct  438  IKTLPSDVKEVFMNGATSKLGRAIALYLCSRGIRVMMLTTSKDRFDTIQREAPGEFKNNL  497

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + VTKYQA   CKTWI+GKW   ++Q WAP GTHFHQFVVP I ++R+DCTYG+LA MKL
Sbjct  498  IHVTKYQAGSKCKTWIVGKWTWQKDQQWAPPGTHFHQFVVPAIGEWRKDCTYGRLAGMKL  557

Query  417  P-KDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            P + V+GL +CE  M R  VHACHAGG+VHALEGWTHHEVGAI+VD+IDVVW AA+++G 
Sbjct  558  PDRGVKGLRTCEMNMERRAVHACHAGGLVHALEGWTHHEVGAIDVDRIDVVWAAAMRHGF  617

Query  240  KPL  232
              +
Sbjct  618  AAI  620



>ref|XP_002993505.1| hypothetical protein SELMODRAFT_137211 [Selaginella moellendorffii]
 gb|EFJ05397.1| hypothetical protein SELMODRAFT_137211 [Selaginella moellendorffii]
Length=146

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T S  R+  I SEA  + ++ LV VTKYQA ++CK WIIGKW T REQ +AP GTHFHQF
Sbjct  3    TSSRSRYESILSEAAAEHRRNLVHVTKYQAGQYCKRWIIGKWVTEREQGFAPVGTHFHQF  62

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
            VVPP+ + R DCTYGKL  M+LPKDV G+ +CEY   RGVV ACHAGG++HALE W+HHE
Sbjct  63   VVPPVQEVRSDCTYGKLVGMRLPKDVAGVHTCEYINDRGVVAACHAGGLLHALEEWSHHE  122

Query  303  VGAINVDQIDVVWEAALKNGL  241
            VG+I+V++ID VW+AAL  G 
Sbjct  123  VGSIDVERIDTVWQAALSRGF  143



>ref|XP_011012180.1| PREDICTED: protein ECERIFERUM 3-like [Populus euphratica]
Length=527

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 2/132 (2%)
 Frame = -1

Query  627  EAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDC  448
            EA +   +  V+V    A    KTWI+GKW TP EQSWAP+GTHFHQFVVPPI+ FRRDC
Sbjct  388  EAILRANRLGVKVISLAALN--KTWIVGKWITPGEQSWAPTGTHFHQFVVPPILSFRRDC  445

Query  447  TYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVV  268
            TYG LAAM+LP +V+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+V
Sbjct  446  TYGDLAAMRLPDEVQGLGNCEYTMDRGVVHACHAGGVVHLLEGWAHHEVGAIDVDRIDLV  505

Query  267  WEAALKNGLKPL  232
            W AALK+GLKP+
Sbjct  506  WNAALKHGLKPV  517



>ref|XP_010103144.1| Protein WAX2 [Morus notabilis]
 gb|EXB94909.1| Protein WAX2 [Morus notabilis]
Length=623

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 93/135 (69%), Gaps = 26/135 (19%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV E+                           T STERF KIQ EAP DCQ +L
Sbjct  443  LNEIPKDVTEML--------------------------TISTERFQKIQKEAPADCQSYL  476

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ+TKY AA++CKTWI+GKW TPREQ WAPSGTHFHQFVVPPI+ FRRDCTYG LAAM+L
Sbjct  477  VQITKYHAAQNCKTWIVGKWITPREQGWAPSGTHFHQFVVPPILSFRRDCTYGDLAAMRL  536

Query  417  PKDVEGLGSCEYTMG  373
            P+DVEGLGSCE   G
Sbjct  537  PEDVEGLGSCEEING  551



>gb|KHG04940.1| Protein WAX2 [Gossypium arboreum]
Length=571

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 121/182 (66%), Gaps = 41/182 (23%)
 Frame = -1

Query  771  DIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFLVQ  592
            +IP DV EVFLTG+TSKLGR                                        
Sbjct  426  EIPKDVKEVFLTGSTSKLGR---------------------------------------A  446

Query  591  VTKYQAAKHCK--TWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  Y + +H +  TWI GKW TP EQSWAPSGTHFHQFVVPPI+  RRDCTYG LAAM+L
Sbjct  447  IALYLSRRHVRVLTWIAGKWITPWEQSWAPSGTHFHQFVVPPILASRRDCTYGDLAAMRL  506

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+DVEGLGSCEY + RGVVHACHAGG VH LEGWTHHE+G I+VD+ID+VWEAALK+G +
Sbjct  507  PEDVEGLGSCEYKLERGVVHACHAGGAVHQLEGWTHHEIGPIDVDRIDLVWEAALKHGFR  566

Query  237  PL  232
            P+
Sbjct  567  PV  568



>ref|XP_005822223.1| hypothetical protein GUITHDRAFT_158756 [Guillardia theta CCMP2712]
 gb|EKX35243.1| hypothetical protein GUITHDRAFT_158756 [Guillardia theta CCMP2712]
Length=538

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 125/180 (69%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L+ IP  V+E F+ GATSKLGRAI+LYLAR+ V+V M+TQS ERF  I+S+ P   +  L
Sbjct  351  LHKIPRGVEEAFVVGATSKLGRAISLYLARKGVKVTMMTQSRERFEGIRSDCPAAYRGNL  410

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
                  +  ++C  W++G++ TP EQ  AP GT FHQFVVPP+ + R+DC+Y  L A  L
Sbjct  411  KHSLSIEDGRNCSCWVVGRFLTPAEQKVAPRGTTFHQFVVPPLPELRKDCSYTSLPAFTL  470

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P    G  SCE TM R  VHACHAG +VH LEGWTHHEVGAI+ D+IDV WEAA ++G +
Sbjct  471  PDSATGFRSCEMTMERRNVHACHAGALVHLLEGWTHHEVGAIDPDRIDVTWEAAERHGFR  530



>ref|XP_003061467.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54097.1| predicted protein [Micromonas pusilla CCMP1545]
Length=628

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 127/180 (71%), Gaps = 0/180 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L  IP DV E+FLTGATSKLGRAIALYL+ + VRV+M T S ERF KI+ EA    QK +
Sbjct  439  LQKIPDDVREIFLTGATSKLGRAIALYLSAKGVRVVMYTTSKERFEKIRGEARRQDQKNI  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ T  +  +  K W++GK  +P++Q  AP    FHQFVVPPI + RRDC Y  L A  L
Sbjct  499  VQATTLEEGRGIKDWVVGKHCSPKDQEKAPKHATFHQFVVPPIPETRRDCVYTNLPAFAL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PKD +   SCE TM RG VHACHAG +VHALEGWT++EVGAI+  +ID  WEAA+K+G K
Sbjct  559  PKDAKDFRSCEMTMERGHVHACHAGALVHALEGWTYNEVGAIDHTRIDSTWEAAMKHGFK  618



>ref|XP_003081883.1| faceless pollen-1 (ISS) [Ostreococcus tauri]
Length=675

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 123/179 (69%), Gaps = 0/179 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L  IP D  E+FLTGATSKLGRAIALY A R VRV+M T S ERF  I++EAP   Q   
Sbjct  494  LQKIPNDCKEIFLTGATSKLGRAIALYCAERGVRVVMYTTSEERFEMIRAEAPKKDQHLF  553

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ T      + K W+IGK  + ++Q  AP G  FHQFVVPPI + R+DC Y  L A KL
Sbjct  554  VQSTSLTDGANIKDWVIGKHCSMKDQKSAPRGATFHQFVVPPIPESRKDCVYTDLPAFKL  613

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            P++ +   SCE TM RG VHACHAG +VHALEGW HHEVGAI+  +ID+ WEAALK+G 
Sbjct  614  PRESKDFRSCEMTMPRGHVHACHAGALVHALEGWDHHEVGAIDHTRIDLTWEAALKHGF  672



>emb|CEF99557.1| Uncharacterised domain Wax2, C-terminal [Ostreococcus tauri]
Length=621

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 123/179 (69%), Gaps = 0/179 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L  IP D  E+FLTGATSKLGRAIALY A R VRV+M T S ERF  I++EAP   Q   
Sbjct  440  LQKIPNDCKEIFLTGATSKLGRAIALYCAERGVRVVMYTTSEERFEMIRAEAPKKDQHLF  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ T      + K W+IGK  + ++Q  AP G  FHQFVVPPI + R+DC Y  L A KL
Sbjct  500  VQSTSLTDGANIKDWVIGKHCSMKDQKSAPRGATFHQFVVPPIPESRKDCVYTDLPAFKL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            P++ +   SCE TM RG VHACHAG +VHALEGW HHEVGAI+  +ID+ WEAALK+G 
Sbjct  560  PRESKDFRSCEMTMPRGHVHACHAGALVHALEGWDHHEVGAIDHTRIDLTWEAALKHGF  618



>ref|XP_001420263.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98556.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=621

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 121/179 (68%), Gaps = 0/179 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L  IP +  E+FLTGATSKLGRAIALY   R +RV+M T S ERF KI++EA    Q  L
Sbjct  440  LQKIPSECKEIFLTGATSKLGRAIALYCVERGMRVVMYTTSEERFEKIRNEAAKKDQHLL  499

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ T        K W+IGK    ++Q+ AP G  FHQFVVPPI + R+DC Y  L A KL
Sbjct  500  VQSTSLSDGAKIKDWVIGKHCPEKDQNMAPRGAIFHQFVVPPIPETRKDCVYTDLPAFKL  559

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            PK+ +   SCE TM RG +HACHAG +VH+LEGW HHEVGAI+  +ID  WEAALK+G 
Sbjct  560  PKEAKDFRSCEMTMKRGHIHACHAGALVHSLEGWDHHEVGAIDHTRIDTTWEAALKHGF  618



>ref|XP_002509294.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70552.1| predicted protein [Micromonas sp. RCC299]
Length=620

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L  IP DV E+FLTG+TSKLGRAIALYL+ R VRV+M T + +RF KI++EA  + ++ L
Sbjct  439  LKKIPADVKEIFLTGSTSKLGRAIALYLSARGVRVVMYTTAKDRFEKIKAEAREEHRELL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            VQ T  +     K W++GK+ + R+Q+ AP    FHQFVVPP+ + RRDC Y  L A KL
Sbjct  499  VQATTLEEGSGIKDWVVGKFCSARDQAKAPKHATFHQFVVPPLEESRRDCAYTDLPAFKL  558

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            PK+ +   SCE TM RG VHACHAG +VHALEGWT++EVGAI+  +IDV W+AA+K+G 
Sbjct  559  PKEAKDFRSCEMTMERGHVHACHAGALVHALEGWTYNEVGAIDHTKIDVTWDAAVKHGF  617



>gb|AAA33934.1| lipid transfer protein, partial [Senecio odorus]
Length=524

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV EVFLTGATSKLGRAIALYL RR V VLMLT STERF  IQ EAP  C+K L
Sbjct  408  LNEINEDVKEVFLTGATSKLGRAIALYLCRRGVHVLMLTLSTERFQNIQEEAPSKCRKNL  467

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRR  454
            VQVTKYQAAK+CKTW+IGKW TP +Q WAPSGTHFHQFVVPPI+ FRR
Sbjct  468  VQVTKYQAAKNCKTWVIGKWITPGQQRWAPSGTHFHQFVVPPILAFRR  515



>gb|AFW70401.1| hypothetical protein ZEAMMB73_833522 [Zea mays]
Length=90

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  561  KTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  385
            +TWI+GKW +PREQ WAPSGTHFHQFVVPPII FRRDCTYGKLAAM+LPKDV+GL SCE
Sbjct  8    QTWIVGKWLSPREQRWAPSGTHFHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLSSCE  66



>gb|EPS58637.1| hypothetical protein M569_16175, partial [Genlisea aurea]
Length=320

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP +V EVFLTGATSKLGRAIALYL ++RV VLMLT STERF  IQ EA  D +KFL
Sbjct  206  LNKIPAEVTEVFLTGATSKLGRAIALYLCKKRVTVLMLTASTERFRDIQKEAAADGRKFL  265

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPI  469
            VQVT ++AA++CKTWI+GKW T  +Q WAP+GTHFHQFVVPPI
Sbjct  266  VQVTGHEAAQNCKTWIMGKWITQEQQRWAPAGTHFHQFVVPPI  308



>ref|XP_007509665.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19468.1| predicted protein [Bathycoccus prasinos]
Length=681

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 128/236 (54%), Gaps = 54/236 (23%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmL-TQSTERFVKIQSEAPVDCQKF  601
            ++ IP +V E+FLTGATSKLGRAIALY+A ++   +++ T S ERF KI+ E P   +  
Sbjct  446  IDKIPENVKEIFLTGATSKLGRAIALYMATKKNCRVLMCTTSEERFEKIKMECPEKFRHL  505

Query  600  LVQV----------------------------------------------------TKYQ  577
            L +V                                                    T Y 
Sbjct  506  LFRVNNANEKVEITQESTSNVLKKSGSFLLSRLGSLKNNNNNNNREVETEEKNDTKTNYS  565

Query  576  AAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLP-KDVEG  400
            + + C+ W++G+     EQS APS T FHQFVVPPI + R DC Y  L A +LP K+ + 
Sbjct  566  SGRTCRNWVVGRHCDKNEQSLAPSKTTFHQFVVPPIPETRSDCAYTDLPAFRLPEKEAKD  625

Query  399  LGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
              +CE TM RG VHACHAG ++HALEGW HHEVGAI+ ++IDV W+A+ K+G   L
Sbjct  626  FKTCEMTMERGCVHACHAGALIHALEGWQHHEVGAIDPEKIDVTWKASKKHGFACL  681



>ref|XP_001756318.1| predicted protein [Physcomitrella patens]
 gb|EDQ78714.1| predicted protein [Physcomitrella patens]
Length=628

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 113/182 (62%), Gaps = 3/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P    EVFL G +S L R++ +YL RR VRVL+LT S   F   Q +     Q+ +
Sbjct  445  INRLPKQTKEVFLVG-SSDLIRSVEIYLVRRGVRVLVLTNSPRYFGSTQPKVTKVNQQLI  503

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFV--VPPIIQFRRDCTYGKLAAM  424
            V V  +Q  +HC+ WI+ ++   ++  WAP G   H       P+ + R+DCTY    AM
Sbjct  504  VNVMSFQEGQHCREWILDEYVEGKDLKWAPPGADLHHVCQGSKPLPRTRKDCTYAMYPAM  563

Query  423  KLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNG  244
             +PK ++GL SCE  + RGV+ A HA GVVH+LE WTH+EVG I+V++ID VW AALK+G
Sbjct  564  HVPKSMKGLRSCEGGLPRGVISASHAAGVVHSLEKWTHNEVGPIDVERIDTVWAAALKHG  623

Query  243  LK  238
             +
Sbjct  624  FQ  625



>ref|XP_002964260.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
 gb|EFJ34593.1| hypothetical protein SELMODRAFT_230422 [Selaginella moellendorffii]
Length=615

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 107/182 (59%), Gaps = 10/182 (5%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L+ +P D  EVFL GA  K+GRAIA YL R         ++TE    ++   P + Q  L
Sbjct  441  LDKLPKDASEVFLVGAEHKVGRAIANYLCRH--------RATE-VTSLKKSVPQESQHKL  491

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V V   +  +HCK WI+G+     EQ  APSG  F+QF    + + R DC Y KL AM+L
Sbjct  492  VAVESLEHGRHCKAWIVGEPLRAMEQLHAPSGACFYQFTEEAMEETRPDCLYAKLPAMRL  551

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAALKNGL  241
            P + +G+ +CE +M RGVV A HAGG++  +E W HHEVG  I+VD+ID V  AA+  G 
Sbjct  552  PPEYKGIRACEGSMPRGVVQASHAGGILATMENWNHHEVGNTIDVDKIDAVMRAAVNRGF  611

Query  240  KP  235
             P
Sbjct  612  VP  613



>gb|ADE77466.1| unknown [Picea sitchensis]
Length=228

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 83/143 (58%), Gaps = 1/143 (1%)
 Frame = -1

Query  657  STERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVV  478
            S E+F K +   P +    L QVT YQ+  +CKTWI+G W T  +Q  AP GT F  F+ 
Sbjct  80   SEEQFQKSKMGVPWEFTHNLFQVTSYQSCINCKTWIVGSWLTREDQMKAPKGTRFIPFLP  139

Query  477  PPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEV-  301
             PI   R DCTY  + AM +PK++E L +CE  + R V+ A   GG+VHALE W HHE  
Sbjct  140  FPIPNVREDCTYQTVPAMSVPKNLENLHACENGLPRRVMSAWRVGGIVHALEEWNHHECD  199

Query  300  GAINVDQIDVVWEAALKNGLKPL  232
              I+   +  VW+AA K+G  P 
Sbjct  200  DVIDSASVTRVWDAATKHGFLPF  222



>gb|ACN35049.1| unknown [Zea mays]
Length=520

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 109/178 (61%), Gaps = 0/178 (0%)
 Frame = +1

Query  241  QPILQCSLPDYINLVYIDSSYLVVRPPFESMNHSACMARMNNASSHCVLT*SKPLNILWK  420
            +P+L+  LP  ++ V+++ ++LVV PPF++++H+A +AR+++ + H VL  ++ L++L +
Sbjct  34   EPVLERRLPHDVDPVHLEGAHLVVLPPFQAVHHAAGVARVHHPALHRVLAGAETLDVLGE  93

Query  421  LHCCQLPVSAVSTELDDRRDYKLMKMCS*RSPALLSRCSPFPNYPRLTVFSCLILGNLN*  600
             H  +L V AV  E DD R Y+L+++ + R P LL R  P  + P LT    L+LG+L+ 
Sbjct  94   PHGGELAVGAVPAEADDGRHYELVEVRARRRPPLLPRRQPLAHDPCLTALRRLVLGDLHD  153

Query  601  EFLAIHRGFTLDFYESLSGLGKHQNSNSSTCQVERNGPPKFGSGTC*ENLIHVXGNVI  774
              L + R   L+  + L    +HQ+ +    +V+R+GP + G G   E+L H  G+++
Sbjct  154  VLLELWRRLPLNLQKPLRRKRQHQDPDPLPAEVQRDGPAELGRGAGEEHLPHAAGDLV  211



>gb|ACN34356.1| unknown [Zea mays]
Length=637

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 109/178 (61%), Gaps = 0/178 (0%)
 Frame = +1

Query  241  QPILQCSLPDYINLVYIDSSYLVVRPPFESMNHSACMARMNNASSHCVLT*SKPLNILWK  420
            +P+L+  LP  ++ V+++ ++LVV PPF++++H+A +AR+++ + H VL  ++ L++L +
Sbjct  34   EPVLERRLPHDVDPVHLEGAHLVVLPPFQAVHHAAGVARVHHPALHRVLAGAETLDVLGE  93

Query  421  LHCCQLPVSAVSTELDDRRDYKLMKMCS*RSPALLSRCSPFPNYPRLTVFSCLILGNLN*  600
             H  +L V AV  E DD R Y+L+++ + R P LL R  P  + P LT    L+LG+L+ 
Sbjct  94   PHGGELAVGAVPAEADDGRHYELVEVRARRRPPLLPRRQPLAHDPCLTALRRLVLGDLHD  153

Query  601  EFLAIHRGFTLDFYESLSGLGKHQNSNSSTCQVERNGPPKFGSGTC*ENLIHVXGNVI  774
              L + R   L+  + L    +HQ+ +    +V+R+GP + G G   E+L H  G+++
Sbjct  154  VLLELWRRLPLNLQKPLRRKRQHQDPDPLPAEVQRDGPAELGRGAGEEHLPHAAGDLV  211



>gb|KFK27319.1| hypothetical protein AALP_AA8G367000, partial [Arabis alpina]
Length=77

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  447  TYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVV  268
            TYG LAAM+LPKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+V
Sbjct  1    TYGDLAAMRLPKDVQGLGTCEYTMERGVVHACHAGGVVHMLEGWKHHEVGAIDVDRIDLV  60

Query  267  WEAALKNGL  241
            WEAA++NGL
Sbjct  61   WEAAMRNGL  69



>ref|XP_002989550.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
 gb|EFJ09426.1| hypothetical protein SELMODRAFT_129942 [Selaginella moellendorffii]
Length=621

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 107/182 (59%), Gaps = 5/182 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            L+ +P D  EVFL G   K+GRAIA YL R R   ++   S+  F  ++   P + Q  L
Sbjct  442  LDKLPKDASEVFLVGVEHKVGRAIANYLCRHRATEVLAKSSSYAFESLKKSVPQESQHKL  501

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + VT +      + WI+G+     EQ  APSG  F+QF    + + R DC+Y KL AM+L
Sbjct  502  LDVTCWN----LQAWIVGEPLRAMEQLHAPSGACFYQFTEEAMEETRPDCSYAKLPAMRL  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAALKNGL  241
            P + +G+ +CE +M RGVV A HAGG++  +E W HHEVG  I+VD+ID V  AA+  G 
Sbjct  558  PPEYKGIRACEGSMPRGVVQASHAGGILATMENWNHHEVGNTIDVDKIDAVMRAAVNRGF  617

Query  240  KP  235
             P
Sbjct  618  VP  619



>ref|XP_011073243.1| PREDICTED: protein ECERIFERUM 3-like isoform X3 [Sesamum indicum]
Length=547

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DVDEVFLTGATSKLGRAIALYLARR+V+VLMLT S ERF+KIQ EAPVDCQK+L
Sbjct  462  LNEIPKDVDEVFLTGATSKLGRAIALYLARRKVKVLMLTLSKERFLKIQEEAPVDCQKYL  521

Query  597  VQVTKYQAAKHCK  559
            VQVTKYQAAKHCK
Sbjct  522  VQVTKYQAAKHCK  534



>dbj|BAF01865.1| CER1 protein [Arabidopsis thaliana]
Length=373

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 99/183 (54%), Gaps = 4/183 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L +R V+V   T   + + KI+S  P +C+  L
Sbjct  189  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVS--TLRLDEYEKIRSCVPQECRDHL  246

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  247  VYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIV  305

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAALKNGL  241
            PK +  + SCE  + R  + A    G++HALEGW  HE G ++ +  +D VWEA L +G 
Sbjct  306  PKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSHGF  365

Query  240  KPL  232
            +PL
Sbjct  366  QPL  368



>gb|EMT05122.1| Protein WAX2 [Aegilops tauschii]
Length=465

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R+++RV+M+T STERF KIQ EA  + Q++L
Sbjct  312  LNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTLSTERFQKIQKEAAAEDQQYL  371

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQ  520
            VQVTK+Q+A+ CKTWI+GKW +PREQ
Sbjct  372  VQVTKFQSAEQCKTWIVGKWLSPREQ  397



>gb|EMS58990.1| Protein WAX2 [Triticum urartu]
Length=532

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EVF+TGATSKLGRAIALYL R+++RV+M+T STERF KIQ EA  + Q++L
Sbjct  393  LNEIPKGTTEVFMTGATSKLGRAIALYLCRKKIRVMMMTLSTERFQKIQKEAAAEDQQYL  452

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQ  520
            VQVTK+Q+A+ CKTWI+GKW +PREQ
Sbjct  453  VQVTKFQSAEQCKTWIVGKWLSPREQ  478



>ref|NP_850932.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 dbj|BAE98972.1| CER1 protein [Arabidopsis thaliana]
 gb|AEE27400.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=461

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 99/183 (54%), Gaps = 4/183 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L +R V+V   T   + + KI+S  P +C+  L
Sbjct  277  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVS--TLRLDEYEKIRSCVPQECRDHL  334

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  335  VYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIV  393

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAALKNGL  241
            PK +  + SCE  + R  + A    G++HALEGW  HE G ++ +  +D VWEA L +G 
Sbjct  394  PKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSHGF  453

Query  240  KPL  232
            +PL
Sbjct  454  QPL  456



>ref|XP_009118866.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=644

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/184 (37%), Positives = 99/184 (54%), Gaps = 5/184 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P    ++ +TG  +K+   IA  L +R V VL  T   E + K++S  P +C+  L
Sbjct  455  INSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVL--TLLPEEYEKLRSLVPQECRDRL  512

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T    A + K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  513  VLLTSETLASN-KVWLMGEGTTREEQEMATKGTLFIPFSQFPLKQLRRDCIYHTPPALII  571

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINV--DQIDVVWEAALKNG  244
            PK +  + SCE  + R  + A    G++HALEGW  HE G  N+    +D VWEA L +G
Sbjct  572  PKSLVNIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSNILLSDLDQVWEACLTHG  631

Query  243  LKPL  232
             +PL
Sbjct  632  FQPL  635



>ref|NP_171723.2| protein ECERIFERUM 1 [Arabidopsis thaliana]
 sp|F4HVY0.1|CER1_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27401.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=625

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 99/183 (54%), Gaps = 4/183 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L +R V+V   T   + + KI+S  P +C+  L
Sbjct  441  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVS--TLRLDEYEKIRSCVPQECRDHL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  499  VYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIV  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAALKNGL  241
            PK +  + SCE  + R  + A    G++HALEGW  HE G ++ +  +D VWEA L +G 
Sbjct  558  PKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACLSHGF  617

Query  240  KPL  232
            +PL
Sbjct  618  QPL  620



>gb|KDO85390.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=376

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  193  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  252

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y AA   K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  253  VLSTSY-AAHKTKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  311

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  312  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  370

Query  237  PL  232
            PL
Sbjct  371  PL  372



>ref|XP_006418509.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
 gb|ESQ36862.1| hypothetical protein EUTSA_v10009534mg [Eutrema salsugineum]
Length=615

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 100/183 (55%), Gaps = 4/183 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L +R V+V   T   + + K++S  P +C+  L
Sbjct  431  INSVPKSTTSVVMTGNLTKVAYTIASALCQRGVQVS--TLFPDEYEKLRSSVPRECRGHL  488

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T  +A    K W++G+  T  +Q  A +GT F  F   P+ Q R+DC Y    A+ +
Sbjct  489  VHLTS-EAFSSSKVWLVGEGTTREDQEKATNGTLFIPFSQFPLKQLRKDCIYHTTPALIV  547

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGA-INVDQIDVVWEAALKNGL  241
            PK +  + SCE  + R  + A    G++HA+EGW  HE GA + +  +D VWEA L +G 
Sbjct  548  PKSLVNIHSCENWLPRKAMSATRVAGILHAVEGWEMHECGASVLLSDLDQVWEACLSHGF  607

Query  240  KPL  232
            +PL
Sbjct  608  QPL  610



>emb|CDY38059.1| BnaCnng09200D [Brassica napus]
Length=829

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 5/184 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P    ++ +TG  +K+   IA  L +R V VL  T   E + K+ S  P +C+  L
Sbjct  640  INSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVL--TLLPEEYEKLSSFVPKECRDRL  697

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + +T    A + K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  698  ILLTSETLASN-KVWLMGEGTTREEQEMATKGTLFIPFSQFPLKQLRRDCIYHTPPALII  756

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINV--DQIDVVWEAALKNG  244
            PK +  + SCE  + R  + A    G++HALEGW  HE G  N+    +D VWEA L +G
Sbjct  757  PKSLVNIHSCENWLPRKAMSATRVAGILHALEGWETHECGTSNILLSDLDQVWEACLSHG  816

Query  243  LKPL  232
             +PL
Sbjct  817  FQPL  820



>gb|AHD24918.1| CER1 [Brassica napus]
Length=628

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 5/184 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P    ++ +TG  +K+   IA  L +R V VL  T   E + K+ S  P +C+  L
Sbjct  439  INSLPKSTTKIVMTGNLTKVAYTIASALCQRGVEVL--TLLPEEYEKLSSFVPKECRDRL  496

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + +T    A + K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  497  ILLTSETLASN-KVWLMGEGTTREEQEMATKGTLFIPFSQFPLKQLRRDCIYHTPPALII  555

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINV--DQIDVVWEAALKNG  244
            PK +  + SCE  + R  + A    G++HALEGW  HE G  N+    +D VWEA L +G
Sbjct  556  PKSLVNIHSCENWLPRKAMSATRVAGILHALEGWETHECGTSNILLSDLDQVWEACLSHG  615

Query  243  LKPL  232
             +PL
Sbjct  616  FQPL  619



>gb|KFK27321.1| hypothetical protein AALP_AA8G367700 [Arabis alpina]
Length=70

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -1

Query  426  MKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKN  247
            M+LPKDV+GLG+CEYTM RGVVHACHAGGVVH LEGW HHEVGAI+VD+ID+VWEAA+K+
Sbjct  1    MRLPKDVQGLGTCEYTMERGVVHACHAGGVVHILEGWEHHEVGAIDVDRIDLVWEAAMKH  60

Query  246  GL  241
             L
Sbjct  61   NL  62



>ref|XP_006306971.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
 gb|EOA39869.1| hypothetical protein CARUB_v10008547mg [Capsella rubella]
Length=647

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 3/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+  +IA  L +R V+V   T   + + K++S  P +C+  L
Sbjct  464  INSVPKTTTNVVMTGNLTKVAYSIASALCQRGVQVS--TLRLDEYEKLRSCVPQECRDHL  521

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T   +    K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    A+ +
Sbjct  522  VYLTT-DSLSSKKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTPALIV  580

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +  + SCE  + R  + A    G++HALEGW  HE G   +  +D VW+A L +G +
Sbjct  581  PKSLVNIHSCENWLPRKAMSATRVAGILHALEGWDMHECGTSLLSDLDQVWDACLSHGFQ  640

Query  237  PL  232
            PL
Sbjct  641  PL  642



>emb|CDP09364.1| unnamed protein product [Coffea canephora]
Length=616

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 103/182 (57%), Gaps = 7/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    EV L G  +K+ R++AL L  R ++V + +Q    F K++    V  Q  L
Sbjct  432  LNNIPKGTTEVLLVGNLTKVARSVALALCERGIQVNISSQ--YEFEKLKQS--VASQSNL  487

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V ++K  AA   KTW++G   T ++Q  AP G  F  F   P  + R DC+Y    AM  
Sbjct  488  VVLSKSVAA--YKTWLVGDGLTEKQQLNAPKGALFIPFSTFPPKKVRSDCSYLHTPAMLA  545

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  ++ L SCE  + R  + A  A G+VHALEGWT HE G  N+  ++ VW+AALK+G +
Sbjct  546  PASLQNLDSCENWLPRRALSAVRAAGIVHALEGWTEHECGE-NMLNVEEVWQAALKHGFR  604

Query  237  PL  232
            PL
Sbjct  605  PL  606



>gb|KDO85389.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=474

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  291  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  350

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y A K  K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  351  VLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  409

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  410  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  468

Query  237  PL  232
            PL
Sbjct  469  PL  470



>gb|KDO85388.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=529

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  346  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  405

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y A K  K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  406  VLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  464

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  465  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  523

Query  237  PL  232
            PL
Sbjct  524  PL  525



>gb|AAB87721.1| maize gl1 homolog [Arabidopsis thaliana]
Length=625

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 98/183 (54%), Gaps = 4/183 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L +R V+V   T   + + KI+S  P +C+  L
Sbjct  441  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVS--TLRLDEYEKIRSCVPQECRDHL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q R DC Y    A+ +
Sbjct  499  VYLTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRSDCIYHTTPALIV  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAALKNGL  241
            PK +  + SCE  + R  + A    G++HALEGW  HE G ++ +  +D VWEA L +G 
Sbjct  558  PKSLVNVHSCENWLPRKAMSATRVAGILHALEGWETHECGTSLLLSDLDKVWEACLSHGF  617

Query  240  KPL  232
            +PL
Sbjct  618  QPL  620



>ref|XP_006464363.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Citrus sinensis]
Length=611

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  428  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  487

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y A K  K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  488  VLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  546

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  547  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  605

Query  237  PL  232
            PL
Sbjct  606  PL  607



>ref|XP_006445499.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
 gb|ESR58739.1| hypothetical protein CICLE_v10019265mg [Citrus clementina]
Length=639

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y A K  K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  516  VLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  574

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  575  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  633

Query  237  PL  232
            PL
Sbjct  634  PL  635



>ref|XP_006464361.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Citrus sinensis]
 gb|KDO85380.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y A K  K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  516  VLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  574

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  575  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  633

Query  237  PL  232
            PL
Sbjct  634  PL  635



>ref|XP_008804903.1| PREDICTED: protein ECERIFERUM 3-like isoform X2 [Phoenix dactylifera]
Length=565

 Score = 71.2 bits (173),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP D  E+FLTGATSKLGRAIALYL R+++RVLMLT S ERF KIQ EAP +CQ +L
Sbjct  438  LNEIPKDAKEIFLTGATSKLGRAIALYLCRKKIRVLMLTLSAERFQKIQKEAPPECQHYL  497

Query  597  VQVTKYQAAKH  565
            VQVTKYQAA++
Sbjct  498  VQVTKYQAAQN  508


 Score = 39.3 bits (90),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -3

Query  556  VDNWEMGYTSRAKLGSFRNTFSSICSPAYHPIP*RLHLREVGSNEASKGC  407
            +D W++  T  A +G+ R+    +C  +Y+ +   LHL + G +EAS GC
Sbjct  510  MDRWQVAITKGAAVGTTRHALPPVCGSSYYWLQEGLHLWKAGCHEASPGC  559



>gb|KDO85387.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=639

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y A K  K W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  516  VLSTSYAAHK-TKIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  574

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  575  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  633

Query  237  PL  232
            PL
Sbjct  634  PL  635



>ref|NP_001184890.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
 gb|AEE27402.1| protein ECERIFERUM 1 [Arabidopsis thaliana]
Length=630

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 99/187 (53%), Gaps = 7/187 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L +R V+V   T   + + KI+S  P +C+  L
Sbjct  441  INSVPKATTSVVMTGNLTKVAYTIASALCQRGVQVS--TLRLDEYEKIRSCVPQECRDHL  498

Query  597  VQVTKYQAAKH----CKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLA  430
            V +T    + +     K W++G+  T  EQ  A  GT F  F   P+ Q RRDC Y    
Sbjct  499  VYLTSEALSSNKGFWVKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQLRRDCIYHTTP  558

Query  429  AMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVDQIDVVWEAAL  253
            A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++ +  +D VWEA L
Sbjct  559  ALIVPKSLVNVHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLLSDLDQVWEACL  618

Query  252  KNGLKPL  232
             +G +PL
Sbjct  619  SHGFQPL  625



>gb|KJB23545.1| hypothetical protein B456_004G104100 [Gossypium raimondii]
Length=525

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EAP DCQ +L
Sbjct  440  LNEIPKDVEEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQREAPADCQNYL  499

Query  597  VQVTKYQAAKHCKT  556
            VQVTKYQAA++CK 
Sbjct  500  VQVTKYQAAQNCKV  513



>gb|KFK42594.1| hypothetical protein AALP_AA1G015600 [Arabis alpina]
Length=624

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 94/182 (52%), Gaps = 3/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V +TG  +K+   IA  L  R V+V   T     + K++S  P +C+  L
Sbjct  441  INSLPKATTTVVVTGNLTKVAYTIASALCHRGVQVS--TLRLHEYEKLRSCIPRECRDQL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V +T  +A    K W++G+  +  EQ  A  GT F  F   P+ Q R DC Y    A+ +
Sbjct  499  VHITT-EALSSNKVWLVGEGTSKEEQEKAIKGTLFIPFSQFPLKQLRGDCIYHTTPALVV  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +  + SCE  + R  + A    G++HALEGW  HE G   +  +D VWEA L +G +
Sbjct  558  PKSLVNIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLSDLDQVWEACLSHGFQ  617

Query  237  PL  232
            PL
Sbjct  618  PL  619



>ref|XP_006464362.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Citrus sinensis]
 gb|KDO85381.1| hypothetical protein CISIN_1g006590mg [Citrus sinensis]
Length=638

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 94/182 (52%), Gaps = 3/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P     V L G  +    A A+  +  ++ + + T   + + K++   PV+ Q  L
Sbjct  456  VNSLPKTTAHVLLRGTVTANKVANAVASSLCQMGIKVATICKDDYEKLKLRIPVEAQHNL  515

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V  T Y  A H   W++G   T +EQ+ AP GT F  +   P  + R+DC Y    AM +
Sbjct  516  VLSTSY--AAHKTIWLVGDDLTGKEQARAPKGTIFIPYTQIPPRKLRKDCFYHSTPAMII  573

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +  + SCE  +GR V+ A    G++HALEGW  +E G    D I  VW A+L++G +
Sbjct  574  PPSLSNMHSCENWLGRRVMSAWRIAGIIHALEGWDLNECGQTMCD-IHQVWHASLRHGFR  632

Query  237  PL  232
            PL
Sbjct  633  PL  634



>ref|XP_007219469.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
 gb|EMJ20668.1| hypothetical protein PRUPE_ppa021389mg [Prunus persica]
Length=218

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 95/182 (52%), Gaps = 8/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    EV L G  +K+  A A  L ++ ++V  L Q+   ++K+     V   + +
Sbjct  36   LNSIPKGTTEVLLRGNLTKVAYATAFALCQKGIQVATLNQT--EYLKLTKSLNVTDSRLV  93

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  +  Q     K W++G   +  EQ  AP GT F  F   P  + R+DC Y    AMK 
Sbjct  94   LARSYAQ-----KIWLVGDGLSEEEQLRAPKGTLFVPFSQFPQKKLRKDCFYHYTPAMKT  148

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +E + +CE  + R V+ A    G+VHALEGW  HE G  N+  ID VW+A L++G +
Sbjct  149  PPSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECG-YNMSNIDKVWQATLQHGFQ  207

Query  237  PL  232
            PL
Sbjct  208  PL  209



>ref|XP_010496698.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=386

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 78/145 (54%), Gaps = 2/145 (1%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T   + + K++S  P +C+ +LV  T  +     K W++G+  T  EQ  A  GT F  F
Sbjct  238  TLRLDEYEKLRSCIPQECRDYLVYQTS-EVLSSNKVWLVGEGTTSEEQEKATKGTLFIPF  296

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
               P+ Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  297  SQFPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHE  356

Query  303  VG-AINVDQIDVVWEAALKNGLKPL  232
             G ++    +D VWEA L +G +PL
Sbjct  357  CGTSLLPSDLDQVWEACLSHGFQPL  381



>ref|XP_010512796.1| PREDICTED: protein ECERIFERUM 1-like, partial [Camelina sativa]
Length=326

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 78/145 (54%), Gaps = 2/145 (1%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T   + + K++S  P +C+ +LV  T  +     K W++G+  T  EQ  A  GT F  F
Sbjct  178  TLRLDEYEKLRSCIPQECRDYLVYQTS-EVLSSNKVWLVGEGTTSEEQEKATKGTLFIPF  236

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
               P+ Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  237  SQFPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHE  296

Query  303  VG-AINVDQIDVVWEAALKNGLKPL  232
             G ++    +D VWEA L +G +PL
Sbjct  297  CGTSLLPSDLDQVWEAFLSHGFQPL  321



>ref|XP_008223563.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Prunus mume]
Length=575

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV+EVFL+GATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAP DCQ +L
Sbjct  443  LNEIPKDVEEVFLSGATSKLGRAIALYLCRRKVRVLMLTLSTERFQKIQKEAPADCQHYL  502

Query  597  VQVTKYQAAKHCKT  556
            VQVTKYQAA++CK 
Sbjct  503  VQVTKYQAARNCKV  516



>gb|EEC81004.1| hypothetical protein OsI_23762 [Oryza sativa Indica Group]
Length=126

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL R+++RVLMLT STERF+ IQ EAP + Q++L
Sbjct  54   LNEIPGDVAEVFLTGATSKLGRAIALYLCRKKIRVLMLTLSTERFMNIQREAPAEFQQYL  113

Query  597  VQVTKYQAAKHCK  559
            VQVTKYQAA++CK
Sbjct  114  VQVTKYQAAQNCK  126



>gb|AIE57503.1| CER1 [Camelina sativa]
Length=625

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 78/145 (54%), Gaps = 2/145 (1%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T   + + K++S  P +C+ +LV  T  +     K W++G+  T  EQ  A  GT F  F
Sbjct  477  TLRLDEYEKLRSCIPQECRDYLVYQTS-EVLSSNKVWLVGEGTTSEEQEKATKGTLFIPF  535

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
               P+ Q R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE
Sbjct  536  SQFPLKQLRKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEVHE  595

Query  303  VG-AINVDQIDVVWEAALKNGLKPL  232
             G ++    +D VWEA L +G +PL
Sbjct  596  CGTSLLPSDLDQVWEACLSHGFQPL  620



>ref|XP_008232261.1| PREDICTED: protein ECERIFERUM 1-like [Prunus mume]
Length=623

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 97/182 (53%), Gaps = 8/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    EV L G  +K+  A AL L ++ ++V  L Q+   ++K+     V   +F+
Sbjct  441  LNSIPKGTTEVLLRGKLTKVAYATALALCQKGIQVATLHQT--EYLKLTKSLNVTESRFV  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  +  Q     K W++G   +  EQ  AP GT F  F   P  + R+DC Y    AMK 
Sbjct  499  LTRSYAQ-----KIWLVGDGLSEEEQLRAPKGTLFFPFSQFPPKKLRKDCFYHYTPAMKT  553

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +E + +CE  + R V+ A    G+VHALEGW  HE G  N+  ID VW+A L++G +
Sbjct  554  PTSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECGY-NMSNIDKVWQATLQHGFQ  612

Query  237  PL  232
            PL
Sbjct  613  PL  614



>ref|XP_010920316.1| PREDICTED: protein ECERIFERUM 1-like [Elaeis guineensis]
Length=618

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 95/182 (52%), Gaps = 7/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN +P    ++ LTG  SK+ RAIA  L  R ++V+M  +     +K+Q   P     +L
Sbjct  441  LNSVPAGTKQILLTGNVSKVARAIAFTLCNRGIQVMMTKKQEFHILKLQ--MPESTASYL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
                 Y      + WI+G      EQ  AP+GT F  F   P  +  +DCTY    AMK+
Sbjct  499  TLSNTYSP----QVWIVGDGLDDTEQRRAPTGTRFIPFSQFPPKKLNKDCTYNTTPAMKI  554

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P+ +E + SCE  + R V+ A    G+VHALEGW+ HE G   +D I+ +W A L +G  
Sbjct  555  PETLENMHSCENWLPRRVMSAWRIAGIVHALEGWSAHECGETMLD-IEKIWSATLHHGFL  613

Query  237  PL  232
            PL
Sbjct  614  PL  615



>ref|XP_003530144.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Glycine max]
Length=625

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 99/182 (54%), Gaps = 8/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G  +K+   IA  L ++ V+V   T   + +VK+++      + F+
Sbjct  441  LNSIPNGTTQVLLRGKLTKVAYTIAFTLCQQGVQVA--TMHKDDYVKLKNSFSSFGKNFI  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            ++ +  Q     KTW++G+  T  EQ  AP GT F  +   P I++R+DC+Y    AM +
Sbjct  499  IEKSYTQ-----KTWLVGEGLTEEEQLKAPKGTLFITYSQFPPIKYRKDCSYHFTPAMLV  553

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  ++ + SCE  + R V+ A    G+VH LEGW+ HE     +  ID VW + L++G +
Sbjct  554  PSSIQNVHSCENWLPRKVMSAWRIAGIVHCLEGWSEHECNY-TMHNIDKVWRSTLQHGFQ  612

Query  237  PL  232
            PL
Sbjct  613  PL  614



>ref|XP_002528208.1| sterol desaturase, putative [Ricinus communis]
 gb|EEF34165.1| sterol desaturase, putative [Ricinus communis]
Length=578

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+I  DV EVFLTGATSKLGRAIALYL RR+VRVLMLT STERF KIQ EAP+DCQ +L
Sbjct  444  LNEISKDVTEVFLTGATSKLGRAIALYLCRRKVRVLMLTLSTERFQKIQKEAPLDCQSYL  503

Query  597  VQVTKYQAAKHCK  559
            VQVTKYQAA++CK
Sbjct  504  VQVTKYQAAQNCK  516


 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -1

Query  393  SCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
            +C+YTM RGVVHACHAGGVVH LEGW+HHEVGAI+VD+ID+VW AALK+GLKP+
Sbjct  514  NCKYTMDRGVVHACHAGGVVHLLEGWSHHEVGAIDVDRIDLVWNAALKHGLKPV  567



>gb|KJB67450.1| hypothetical protein B456_010G191300 [Gossypium raimondii]
Length=671

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 94/182 (52%), Gaps = 6/182 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G  +K+  A+A  L ++ ++V +L +  + + K+        +  L
Sbjct  488  LNSIPKGTTQVLLRGNLTKVAFAVAFSLCQKGIQVTVLRE--DEYEKLDKSLGTKSEGKL  545

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V    Y +   CK W++G   T  EQ  A  GT F  F   P+   R+DC Y    AM+ 
Sbjct  546  VISKSYSS---CKVWLVGDDLTEEEQRKANKGTLFIPFSQFPLKNLRKDCFYHTTPAMQA  602

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +E + SCE  + R V+      G++HALEGW  HE G   +  ID VWEA LK+G +
Sbjct  603  PKALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECGY-TISNIDKVWEACLKHGFQ  661

Query  237  PL  232
            PL
Sbjct  662  PL  663



>ref|XP_010097746.1| Protein WAX2 [Morus notabilis]
 gb|EXB70701.1| Protein WAX2 [Morus notabilis]
Length=618

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    +V L G  +K+  AIA  L  + ++V   + S + FVK++     +  K  
Sbjct  433  LNNIPKGTTQVLLIGKLTKVAYAIAYALCHKGIQVA--SSSEDEFVKLKKSQNDEDSKSN  490

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            + ++KY + +H + W++G   T  EQS A  GT F  F   P  + RRDC Y    AM  
Sbjct  491  LVISKYYS-RH-QIWLVGDGLTEEEQSKASKGTIFVPFSQFPPKKLRRDCFYHHTPAMLT  548

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG--AINVDQIDVVWEAALKNG  244
            PK +E + +CE  + R  + A    G+VHAL GW  HE G    NV   + VWEA+L++G
Sbjct  549  PKTLENIHACENWLPRRAMSAWRVAGIVHALAGWDEHECGFNITNVCNFEKVWEASLRHG  608

Query  243  LKPL  232
             +PL
Sbjct  609  FQPL  612



>ref|XP_010535406.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Tarenaya hassleriana]
Length=628

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 97/182 (53%), Gaps = 3/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N IP    +V + G+ +K+  AIA  L RR ++V  L ++   + ++    P +C+  L
Sbjct  441  INSIPKGTTDVVMRGSLTKVAYAIASALCRRGIQVTALRRN--EYERLTLCVPAECKGRL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  T      H K W++G+    R+Q  A  GT F  F   P  + R+DC Y    A+ +
Sbjct  499  LYSTSKTLPSH-KIWLVGEGMDERDQERATEGTVFIPFSPFPPKELRKDCIYHTTPALTV  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +E   SCE  + R  + A  A G++HALEGW  HE G+  +  +D +W+A L +G +
Sbjct  558  PKSLENFHSCENWLPRKAISATRAAGILHALEGWETHEHGSTLLHDLDFIWDACLGHGFR  617

Query  237  PL  232
            PL
Sbjct  618  PL  619



>ref|XP_010535407.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Tarenaya hassleriana]
Length=584

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 97/182 (53%), Gaps = 3/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N IP    +V + G+ +K+  AIA  L RR ++V  L ++   + ++    P +C+  L
Sbjct  397  INSIPKGTTDVVMRGSLTKVAYAIASALCRRGIQVTALRRN--EYERLTLCVPAECKGRL  454

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  T      H K W++G+    R+Q  A  GT F  F   P  + R+DC Y    A+ +
Sbjct  455  LYSTSKTLPSH-KIWLVGEGMDERDQERATEGTVFIPFSPFPPKELRKDCIYHTTPALTV  513

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +E   SCE  + R  + A  A G++HALEGW  HE G+  +  +D +W+A L +G +
Sbjct  514  PKSLENFHSCENWLPRKAISATRAAGILHALEGWETHEHGSTLLHDLDFIWDACLGHGFR  573

Query  237  PL  232
            PL
Sbjct  574  PL  575



>ref|XP_004307280.1| PREDICTED: protein ECERIFERUM 1-like [Fragaria vesca subsp. vesca]
Length=623

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 99/182 (54%), Gaps = 8/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP +  +V LTG  +K+  AIA  L++R + V   T   + ++K+     +   K  
Sbjct  441  LNNIPKETTQVVLTGNFTKVAYAIAFALSQRGIEVA--TIYKDEYLKLTKS--LSATKST  496

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V + K  A+K    W++G   + + Q  AP GT F  F   P+ + RRDC Y    AMK+
Sbjct  497  VVLAKGSASK---IWLVGDGLSKQTQLQAPKGTIFVPFTQFPLKELRRDCFYHCPPAMKI  553

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +E + SCE  + R V+ A    G+VHA EGW  HE G    D ID VWEA L+ G +
Sbjct  554  PKSIENVYSCENWLPRRVMSAWRIAGIVHASEGWNEHECGYAMSD-IDKVWEATLRLGFQ  612

Query  237  PL  232
            PL
Sbjct  613  PL  614



>ref|XP_007015845.1| CER1 protein [Theobroma cacao]
 gb|EOY33464.1| CER1 protein [Theobroma cacao]
Length=618

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 91/188 (48%), Gaps = 20/188 (11%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP +  +V L G  SK    +   L           Q   + V +Q +   D +K L
Sbjct  441  LNCIPKETTQVLLRGRISKDACLLVQAL----------CQKGIQVVTLQED---DYKKLL  487

Query  597  VQVTKYQ------AAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  436
                K +      A    K W++G   T +EQS AP GT F  F + P  Q R+DC Y  
Sbjct  488  KYDNKLESNLVLSARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQIRKDCYYHT  547

Query  435  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAA  256
              AM+ PK VE + SCE  + R V+ A    G++HA EGW  +E G      ID VWEA+
Sbjct  548  TPAMEAPKSVENMHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTFS-IDKVWEAS  606

Query  255  LKNGLKPL  232
            L++G +PL
Sbjct  607  LEHGFRPL  614



>ref|XP_007015842.1| CER1 protein isoform 1 [Theobroma cacao]
 gb|EOY33461.1| CER1 protein isoform 1 [Theobroma cacao]
Length=618

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 91/188 (48%), Gaps = 20/188 (11%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP +  +V L G  SK    +   L           Q   + V +Q +   D +K L
Sbjct  441  LNCIPKETTQVLLRGRISKDACLLVQAL----------CQKGIQVVTLQED---DYKKLL  487

Query  597  VQVTKYQ------AAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  436
                K +      A    K W++G   T +EQS AP GT F  F + P  Q R+DC Y  
Sbjct  488  KYDNKLESNLVPSARYDVKVWLVGDGLTDKEQSKAPKGTLFIPFSIFPPNQIRKDCYYHT  547

Query  435  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAA  256
              AM+ PK VE + SCE  + R V+ A    G++HA EGW  +E G      ID VWEA+
Sbjct  548  TPAMEAPKSVENMHSCEDWLPRRVMSASRVAGIIHASEGWEVNECGGTTFS-IDKVWEAS  606

Query  255  LKNGLKPL  232
            L++G +PL
Sbjct  607  LEHGFRPL  614



>ref|XP_004253517.1| PREDICTED: protein CER1-like 1, partial [Solanum lycopersicum]
Length=215

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 96/182 (53%), Gaps = 6/182 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G  SK+  +IAL L    ++V+  T   E + +++++   +    L
Sbjct  34   LNSIPKGTSQVVLRGRFSKVANSIALVLCEGGIQVV--TLDEEDYKRLKAKLTPEAATNL  91

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V    Y  +K   TW++G   +  EQ  AP GT F  +   P  + R+DC Y    AM  
Sbjct  92   VLSKSYNVSK---TWLVGDGLSKDEQLKAPKGTLFIPYSQFPPRKVRKDCFYFNTPAMIA  148

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK VE + SCE  + R V+ A    G++HALEGW  HE G + +D    VW+A+LK+G  
Sbjct  149  PKHVENVDSCENWLPRRVMSAWRIAGILHALEGWNEHECGDMILD-TQKVWKASLKHGFC  207

Query  237  PL  232
            PL
Sbjct  208  PL  209



>ref|XP_011469549.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=618

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 96/182 (53%), Gaps = 4/182 (2%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G  +K+  A+A  L +R ++V+   Q+   ++K+         K +
Sbjct  437  LNSIPKGTTQVLLIGNLTKVAYALAFSLCQRDIQVVTSHQA--EYLKLTKSLNATEGK-V  493

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V    Y      + W++G   + +EQ  AP GT F  F   P  + RRDC Y    AMK+
Sbjct  494  VHDRSYAQKFAMQIWLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKI  553

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +E + SCE  + R V+ A    G+VHA+EGW  HE G   +  ID VW+A L++G +
Sbjct  554  PKSLENVYSCENWLPRRVMSAWRIAGIVHAMEGWNEHECGY-TMSNIDKVWQATLRHGFQ  612

Query  237  PL  232
            PL
Sbjct  613  PL  614



>gb|KDO42773.1| hypothetical protein CISIN_1g041887mg [Citrus sinensis]
Length=223

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = -1

Query  561  KTWIIGKWATPREQSWAPSGTHFHQFV-VPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCE  385
            K W++G   T  EQS A  GT F  F   PP  + R+DCTY    AM  P  +E + SCE
Sbjct  108  KIWLVGNGLTEEEQSKAERGTMFVPFSQFPPAKKRRKDCTYHLTPAMATPAALENVDSCE  167

Query  384  YTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
              + R V+ A   GG+VHALEGW  HE G   +  +D VW+AAL++G  PL
Sbjct  168  NWLPRRVMSAWRIGGIVHALEGWNEHECG-YTISNVDTVWDAALRHGFVPL  217



>ref|XP_007218863.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
 gb|EMJ20062.1| hypothetical protein PRUPE_ppa002893mg [Prunus persica]
Length=623

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 95/182 (52%), Gaps = 8/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    EV L G  +K+  A A  L ++ ++V  L Q+   ++K+     V   + +
Sbjct  441  LNSIPKGTTEVLLRGNLTKVAYATAFALCQKGIQVATLNQT--EYLKLTKSLNVTDSRLV  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  +  Q     K W++G   +  EQ  AP GT F  F   P  + R+DC Y    AMK 
Sbjct  499  LARSYAQ-----KIWLVGDGLSEEEQLRAPKGTLFVPFSQFPQKKLRKDCFYHYTPAMKT  553

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +E + +CE  + R V+ A    G+VHALEGW  HE G  N+  ID VW+A L++G +
Sbjct  554  PPSLENVHACENWLPRRVMSAWRIAGIVHALEGWKEHECG-YNMSNIDKVWQATLQHGFQ  612

Query  237  PL  232
            PL
Sbjct  613  PL  614



>ref|XP_010496480.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=625

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 2/137 (1%)
 Frame = -1

Query  639  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  460
            K++S  P++ +  LV  T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q 
Sbjct  485  KLRSCVPLEYRDHLVYQTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQL  543

Query  459  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVD  283
            R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++   
Sbjct  544  RKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLPS  603

Query  282  QIDVVWEAALKNGLKPL  232
             +D VWEA L +G +PL
Sbjct  604  DLDQVWEACLSHGFQPL  620



>ref|XP_010496714.1| PREDICTED: protein ECERIFERUM 1 isoform X2 [Camelina sativa]
Length=625

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 2/137 (1%)
 Frame = -1

Query  639  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  460
            K++S  P++ +  LV  T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q 
Sbjct  485  KLRSCVPLEYRDHLVYQTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQL  543

Query  459  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVD  283
            R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++   
Sbjct  544  RKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLPS  603

Query  282  QIDVVWEAALKNGLKPL  232
             +D VWEA L +G +PL
Sbjct  604  DLDQVWEACLSHGFQPL  620



>ref|XP_010496713.1| PREDICTED: protein ECERIFERUM 1 isoform X1 [Camelina sativa]
Length=625

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 2/137 (1%)
 Frame = -1

Query  639  KIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQF  460
            K++S  P++ +  LV  T  +A    K W++G+  T  EQ  A  GT F  F   P+ Q 
Sbjct  485  KLRSCVPLEYRDHLVYQTS-EALSSNKVWLVGEGTTREEQEKATKGTLFIPFSQFPLKQL  543

Query  459  RRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVG-AINVD  283
            R+DC Y    A+ +PK +  + SCE  + R  + A    G++HALEGW  HE G ++   
Sbjct  544  RKDCIYHTTPALIVPKSLANIHSCENWLPRKAMSATRVAGILHALEGWEMHECGTSLLPS  603

Query  282  QIDVVWEAALKNGLKPL  232
             +D VWEA L +G +PL
Sbjct  604  DLDQVWEACLSHGFQPL  620



>ref|XP_010545442.1| PREDICTED: protein ECERIFERUM 3 isoform X2 [Tarenaya hassleriana]
Length=523

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP DV EVFLTGATSKLGRAIALYL RRRVRVLMLT STERF KIQ EA V+ Q +L
Sbjct  442  LNEIPKDVKEVFLTGATSKLGRAIALYLCRRRVRVLMLTLSTERFQKIQKEAAVEDQNYL  501

Query  597  VQVTKYQAAKHCK  559
            VQVTKYQAA+HCK
Sbjct  502  VQVTKYQAAQHCK  514



>ref|XP_004308720.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=614

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 1/110 (1%)
 Frame = -1

Query  561  KTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEY  382
            K W++G   + +EQ  AP GT F  F   P  + RRDC Y    AMK+PK +E + SCE 
Sbjct  502  KIWLVGDGLSKKEQLSAPKGTIFVPFSQFPPKKLRRDCFYHYTPAMKIPKSLENVYSCEN  561

Query  381  TMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLKPL  232
             + R V+ A    G+VHA+EGW  HE G   +  ID VW+A L++G +PL
Sbjct  562  WLPRRVMSAWRIAGIVHAMEGWNEHECGY-TMSNIDKVWQATLRHGFQPL  610



>ref|XP_010276564.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=620

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 97/182 (53%), Gaps = 8/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP +  ++ L G  SK   AI+  L RR V+V M+ +    F K++ + P +  + L
Sbjct  441  LNSIPKETKQLLLRGNVSKTAIAISKALCRRGVQVAMVDKVD--FDKLKLQLPTELWRNL  498

Query  597  VQVTKYQAAKHCKTWII-GKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMK  421
            V  T Y      K W++  + +   EQ  AP GTHF  F   P+ + R DC Y    A+ 
Sbjct  499  VLSTSYN----YKVWLVEDRVSREEEQKQAPEGTHFIPFSQFPLKRIRNDCVYYTTPALL  554

Query  420  LPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            +PK +E + SCE  + R V+ A    G+VHALEGW  HE G   +D +D VW A L++G 
Sbjct  555  IPKALENVHSCENWLPRRVMSAWRVAGIVHALEGWEEHECGDTVLD-VDKVWNATLRHGF  613

Query  240  KP  235
             P
Sbjct  614  LP  615



>gb|KJB67446.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=528

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 93/182 (51%), Gaps = 6/182 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G  +K+  A+A  L ++ ++V +L +  + + K+        +  L
Sbjct  345  LNSIPKGTTQVLLRGNLTKVAFAVAFALCQKGIQVTVLRE--DEYEKLDKSLGTKSEGKL  402

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V    Y +   CK W++G   T  EQ  A  GT F  F   P  + R+DC Y    AM+ 
Sbjct  403  VTSKSYSS---CKVWLVGDDLTEEEQRKANKGTLFIPFSQLPPKKLRKDCFYHTTPAMQT  459

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +E + SCE  + R V+      G++HALEGW  HE G   +  ID VWEA LK+G +
Sbjct  460  PTALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECG-YTMSNIDKVWEACLKHGFQ  518

Query  237  PL  232
            PL
Sbjct  519  PL  520



>ref|XP_010255638.1| PREDICTED: protein ECERIFERUM 1-like isoform X1 [Nelumbo nucifera]
Length=713

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 99/185 (54%), Gaps = 8/185 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G T+K   AI+  L +R ++V M+ ++  +F +++   P +    L
Sbjct  535  LNSIPQGTKQVLLRGRTTKTAIAISRVLCQRGIQVAMIDKN--QFDRLKLRLPTELWSNL  592

Query  597  VQVTKYQAAKHCKTWIIGKWATP-REQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMK  421
               T Y      K W++G+ A    EQ   P GTHF  F   P  + R DC Y    A++
Sbjct  593  FLSTNYN----YKVWLVGEGALKDEEQRQLPEGTHFIPFSQFPPKRVRSDCIYYTTPALR  648

Query  420  LPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGL  241
            +PK +E + SCE  + R V+ A    G+VHALEGW  HE G   +D +D VW A+L++G 
Sbjct  649  IPKALENVHSCENWLPRRVMSAWRVAGIVHALEGWDEHECGDTVLD-VDKVWTASLRHGF  707

Query  240  KPL*R  226
             P+ R
Sbjct  708  LPVAR  712



>ref|XP_006583526.1| PREDICTED: protein ECERIFERUM 1-like isoform X2 [Glycine max]
Length=522

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (56%), Gaps = 6/144 (4%)
 Frame = -1

Query  663  TQSTERFVKIQSEAPVDCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQF  484
            T   + +VK+++      + F+++ +  Q     KTW++G+  T  EQ  AP GT F  +
Sbjct  374  TMHKDDYVKLKNSFSSFGKNFIIEKSYTQ-----KTWLVGEGLTEEEQLKAPKGTLFITY  428

Query  483  VVPPIIQFRRDCTYGKLAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHE  304
               P I++R+DC+Y    AM +P  ++ + SCE  + R V+ A    G+VH LEGW+ HE
Sbjct  429  SQFPPIKYRKDCSYHFTPAMLVPSSIQNVHSCENWLPRKVMSAWRIAGIVHCLEGWSEHE  488

Query  303  VGAINVDQIDVVWEAALKNGLKPL  232
                 +  ID VW + L++G +PL
Sbjct  489  CNY-TMHNIDKVWRSTLQHGFQPL  511



>gb|KJB67445.1| hypothetical protein B456_010G191100 [Gossypium raimondii]
Length=624

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 93/182 (51%), Gaps = 6/182 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP    +V L G  +K+  A+A  L ++ ++V +L +  + + K+        +  L
Sbjct  441  LNSIPKGTTQVLLRGNLTKVAFAVAFALCQKGIQVTVLRE--DEYEKLDKSLGTKSEGKL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V    Y +   CK W++G   T  EQ  A  GT F  F   P  + R+DC Y    AM+ 
Sbjct  499  VTSKSYSS---CKVWLVGDDLTEEEQRKANKGTLFIPFSQLPPKKLRKDCFYHTTPAMQT  555

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +E + SCE  + R V+      G++HALEGW  HE G   +  ID VWEA LK+G +
Sbjct  556  PTALENVDSCENWLPRRVMSVWRIAGILHALEGWEEHECG-YTMSNIDKVWEACLKHGFQ  614

Query  237  PL  232
            PL
Sbjct  615  PL  616



>ref|XP_009384064.1| PREDICTED: protein ECERIFERUM 1-like [Musa acuminata subsp. malaccensis]
Length=625

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 94/182 (52%), Gaps = 7/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN IP +  +V L G  SK+   +A  L +R V V++  +    +  ++S+ P     +L
Sbjct  441  LNSIPPETKKVALCGNLSKVAYRVASVLCQRCVEVIITRK--HEYYMLKSQIPESIAGYL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +    +      + W++G      EQ  AP GT F  +   P  + R+DCTY    AMK+
Sbjct  499  LLSNNHNT----QVWLVGDGLEDVEQRTAPKGTLFVPYSSFPPKKVRKDCTYCTTPAMKI  554

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  VE + SCE  + R V+ A    G+VHALEGW  HE G    D ID +W AAL++G  
Sbjct  555  PDTVENMHSCENWLPRRVMSASRVAGIVHALEGWDSHECGDKTQD-IDKMWSAALRHGFL  613

Query  237  PL  232
            PL
Sbjct  614  PL  615



>ref|XP_006410962.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
 gb|ESQ52415.1| hypothetical protein EUTSA_v10016375mg [Eutrema salsugineum]
Length=628

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = -1

Query  615  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  436
            DC++ LV    Y        W++G   +  EQ  A  GT F  F   P  + R+DC Y  
Sbjct  490  DCKENLVLTRNYSPT----IWLVGDGLSKEEQKMAGKGTRFLPFSQFPPTKLRKDCFYHT  545

Query  435  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAIN-VDQIDVVWEA  259
              AM +P   + + SCE  +GR V+ A   GG+VHALEGW  HE G  N +     VWEA
Sbjct  546  TPAMIIPDSAQNIDSCENWLGRRVMSAWRVGGIVHALEGWEEHECGLHNSILNPPKVWEA  605

Query  258  ALKNGLKPL  232
            AL+NG KPL
Sbjct  606  ALRNGFKPL  614



>ref|XP_010505369.1| PREDICTED: protein CER1-like 2 [Camelina sativa]
Length=634

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = -1

Query  615  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  436
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  493  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTMFLPFSQFPPDKLRKDCVYHT  548

Query  435  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAIN-VDQIDVVWEA  259
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N +     VWEA
Sbjct  549  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSILNSPRVWEA  608

Query  258  ALKNGLKPL  232
            AL+NG +PL
Sbjct  609  ALRNGFQPL  617



>ref|XP_008438264.1| PREDICTED: protein ECERIFERUM 1-like isoform X3 [Cucumis melo]
Length=493

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 98/182 (54%), Gaps = 7/182 (4%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+IP    +V LTG  +KL  A+   L++R +++ +L    E+  K  ++A  + +  L
Sbjct  310  LNNIPKFATQVLLTGKFTKLAFALYHSLSKRGIQIGVLN---EQHYKKLNKASNNYEGTL  366

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            V     +   H + W++G+  T  EQ  AP GT F  F   P    R+DC Y    AMK 
Sbjct  367  VLA---EGHSHNQIWLVGEGLTDEEQLKAPKGTTFIPFSQFPPKILRKDCFYHCTPAMKA  423

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            P  +E + SCE  + R V+ A    GVVHA+EGWT HE G   +  ID VW+A L +G +
Sbjct  424  PPSLENMHSCENWLPRRVMSAWRIAGVVHAMEGWTEHECG-YGMSDIDRVWKATLGHGFQ  482

Query  237  PL  232
            PL
Sbjct  483  PL  484



>ref|XP_010520222.1| PREDICTED: protein ECERIFERUM 1-like [Tarenaya hassleriana]
Length=631

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 103/196 (53%), Gaps = 6/196 (3%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            +N +P    +V + G+ +K+  AIA  L ++ ++V   T   + + K+    P + +  L
Sbjct  441  INSVPKGTVDVVMRGSLTKVAYAIASALCQKGIKVT--TLRKDEYDKLMGCIPHEWRDRL  498

Query  597  VQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGKLAAMKL  418
            +  T      H K W++G+    +EQ  A  G+ F  F   P  + R+DC Y    A+ +
Sbjct  499  LYSTSKTLPSH-KIWLVGEGIDEKEQGKATQGSIFIPFSQFPPKELRKDCLYHTTPALTV  557

Query  417  PKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAINVDQIDVVWEAALKNGLK  238
            PK +E + SCE  + R  + A  A G+VHALEGW  HE G+  +  +D +W+A+L +G +
Sbjct  558  PKSLENIHSCENWLPRKAISAARAAGIVHALEGWERHECGSSLLHDLDAIWDASLSHGFR  617

Query  237  PL*RMPFLLLSSHLMK  190
            PL   P    S+H +K
Sbjct  618  PL---PLPHFSTHNLK  630



>ref|XP_010517047.1| PREDICTED: protein CER1-like 2 isoform X2 [Camelina sativa]
Length=586

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = -1

Query  615  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  436
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  453  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHT  508

Query  435  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAIN-VDQIDVVWEA  259
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N V     VWEA
Sbjct  509  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSVLNSPRVWEA  568

Query  258  ALKNGLKPL  232
            AL+NG +PL
Sbjct  569  ALRNGFQPL  577



>ref|XP_010517046.1| PREDICTED: protein CER1-like 2 isoform X1 [Camelina sativa]
Length=623

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 5/129 (4%)
 Frame = -1

Query  615  DCQKFLVQVTKYQAAKHCKTWIIGKWATPREQSWAPSGTHFHQFVVPPIIQFRRDCTYGK  436
             C++ LV  T Y        W++G   + +EQ  A  GT F  F   P  + R+DC Y  
Sbjct  490  SCKENLVLTTNYNPM----IWLVGDGVSTKEQKMAKEGTLFLPFSQFPPDKLRKDCVYHT  545

Query  435  LAAMKLPKDVEGLGSCEYTMGRgvvhachaggvvhALEGWTHHEVGAIN-VDQIDVVWEA  259
              AM +P   + + SCE  +GR V+ A   GG+VH+LEGW  HE G  N V     VWEA
Sbjct  546  TPAMIIPHSAQNIDSCENWLGRRVMSAWRVGGIVHSLEGWEEHECGLDNSVLNSPRVWEA  605

Query  258  ALKNGLKPL  232
            AL+NG +PL
Sbjct  606  ALRNGFQPL  614



>gb|KJB83321.1| hypothetical protein B456_013G242200 [Gossypium raimondii]
Length=514

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  777  LNDIPXDVDEVFLTGATSKlgraialylarrrvrvlmLTQSTERFVKIQSEAPVDCQKFL  598
            LN+   DV EVFLTGATSKLGRA ALYL R+RVRVLMLT STERF KI  E PVDCQ +L
Sbjct  441  LNEFSKDVKEVFLTGATSKLGRATALYLCRKRVRVLMLTSSTERFQKILKETPVDCQNYL  500

Query  597  VQVTKYQAAKHCKT  556
            VQVTKYQAA++CK 
Sbjct  501  VQVTKYQAAQNCKV  514



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730