BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043J04

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN14569.1|  Eukaryotic translation initiation factor 3 subunit I    361   4e-123   Glycine soja [wild soybean]
ref|XP_008443373.1|  PREDICTED: eukaryotic translation initiation...    364   2e-122   Cucumis melo [Oriental melon]
gb|KDP38201.1|  hypothetical protein JCGZ_04844                         363   3e-122   Jatropha curcas
ref|XP_002521889.1|  eukaryotic translation initiation factor 3 s...    362   9e-122   Ricinus communis
ref|XP_004136687.1|  PREDICTED: eukaryotic translation initiation...    361   2e-121   Cucumis sativus [cucumbers]
ref|XP_003517705.1|  PREDICTED: eukaryotic translation initiation...    360   4e-121   Glycine max [soybeans]
ref|XP_007222666.1|  hypothetical protein PRUPE_ppa008567mg             360   5e-121   Prunus persica
ref|XP_008220972.1|  PREDICTED: eukaryotic translation initiation...    360   5e-121   Prunus mume [ume]
ref|XP_007016708.1|  Transducin/WD40 repeat-like superfamily prot...    360   7e-121   
ref|XP_009777666.1|  PREDICTED: eukaryotic translation initiation...    359   1e-120   Nicotiana sylvestris
gb|KDO58633.1|  hypothetical protein CISIN_1g020461mg                   357   2e-120   Citrus sinensis [apfelsine]
ref|XP_009629813.1|  PREDICTED: eukaryotic translation initiation...    358   2e-120   Nicotiana tomentosiformis
ref|XP_009777665.1|  PREDICTED: eukaryotic translation initiation...    358   4e-120   Nicotiana sylvestris
ref|XP_011095354.1|  PREDICTED: eukaryotic translation initiation...    358   4e-120   Sesamum indicum [beniseed]
ref|XP_006351166.1|  PREDICTED: eukaryotic translation initiation...    357   8e-120   Solanum tuberosum [potatoes]
ref|XP_010062244.1|  PREDICTED: eukaryotic translation initiation...    357   1e-119   Eucalyptus grandis [rose gum]
ref|XP_007157442.1|  hypothetical protein PHAVU_002G070400g             357   1e-119   Phaseolus vulgaris [French bean]
gb|KHN32457.1|  Eukaryotic translation initiation factor 3 subunit I    352   2e-119   Glycine soja [wild soybean]
ref|XP_004250371.1|  PREDICTED: eukaryotic translation initiation...    356   2e-119   Solanum lycopersicum
ref|XP_004492932.1|  PREDICTED: eukaryotic translation initiation...    355   3e-119   Cicer arietinum [garbanzo]
gb|EYU22708.1|  hypothetical protein MIMGU_mgv1a009949mg                355   4e-119   Erythranthe guttata [common monkey flower]
ref|XP_006448047.1|  hypothetical protein CICLE_v10015917mg             355   5e-119   Citrus clementina [clementine]
ref|XP_003596914.1|  Eukaryotic translation initiation factor 3 s...    354   8e-119   
gb|AES67165.2|  eukaryotic translation initiation factor 3 subunit I    354   9e-119   Medicago truncatula
gb|KJB26172.1|  hypothetical protein B456_004G228300                    354   1e-118   Gossypium raimondii
gb|KHG16392.1|  Eukaryotic translation initiation factor 3 subuni...    353   2e-118   Gossypium arboreum [tree cotton]
ref|XP_010557463.1|  PREDICTED: eukaryotic translation initiation...    353   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_002285281.1|  PREDICTED: eukaryotic translation initiation...    353   2e-118   Vitis vinifera
ref|XP_008340535.1|  PREDICTED: eukaryotic translation initiation...    353   2e-118   Malus domestica [apple tree]
ref|XP_008389128.1|  PREDICTED: eukaryotic translation initiation...    353   3e-118   
gb|ABK94219.1|  unknown                                                 352   5e-118   Populus trichocarpa [western balsam poplar]
gb|KJB56100.1|  hypothetical protein B456_009G106100                    352   6e-118   Gossypium raimondii
ref|XP_009351622.1|  PREDICTED: eukaryotic translation initiation...    352   6e-118   Pyrus x bretschneideri [bai li]
ref|XP_003534423.1|  PREDICTED: eukaryotic translation initiation...    352   9e-118   Glycine max [soybeans]
ref|XP_006591952.1|  PREDICTED: eukaryotic translation initiation...    352   1e-117   Glycine max [soybeans]
ref|XP_011021700.1|  PREDICTED: eukaryotic translation initiation...    351   1e-117   Populus euphratica
ref|XP_004489218.1|  PREDICTED: eukaryotic translation initiation...    351   2e-117   Cicer arietinum [garbanzo]
gb|EYU22777.1|  hypothetical protein MIMGU_mgv1a009964mg                351   2e-117   Erythranthe guttata [common monkey flower]
gb|EPS73291.1|  hypothetical protein M569_01462                         350   6e-117   Genlisea aurea
ref|XP_002311556.2|  TGF-beta receptor-interacting protein 1            349   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010926275.1|  PREDICTED: eukaryotic translation initiation...    348   3e-116   Elaeis guineensis
gb|EPS65969.1|  hypothetical protein M569_08807                         347   4e-116   Genlisea aurea
ref|XP_011024978.1|  PREDICTED: eukaryotic translation initiation...    347   4e-116   Populus euphratica
ref|XP_010521568.1|  PREDICTED: eukaryotic translation initiation...    347   8e-116   Tarenaya hassleriana [spider flower]
ref|XP_008350825.1|  PREDICTED: eukaryotic translation initiation...    347   1e-115   
ref|XP_010111947.1|  Eukaryotic translation initiation factor 3 s...    349   3e-115   
emb|CDP11515.1|  unnamed protein product                                340   4e-115   Coffea canephora [robusta coffee]
ref|XP_010937470.1|  PREDICTED: eukaryotic translation initiation...    343   1e-114   Elaeis guineensis
emb|CDP20306.1|  unnamed protein product                                342   9e-114   Coffea canephora [robusta coffee]
ref|XP_008782131.1|  PREDICTED: eukaryotic translation initiation...    341   1e-113   Phoenix dactylifera
ref|XP_010249002.1|  PREDICTED: eukaryotic translation initiation...    340   3e-113   Nelumbo nucifera [Indian lotus]
ref|XP_006854979.1|  hypothetical protein AMTR_s00052p00194740          335   2e-112   
ref|XP_009129412.1|  PREDICTED: eukaryotic translation initiation...    338   2e-112   Brassica rapa
ref|XP_008808070.1|  PREDICTED: eukaryotic translation initiation...    335   3e-112   Phoenix dactylifera
ref|XP_008808069.1|  PREDICTED: eukaryotic translation initiation...    337   7e-112   Phoenix dactylifera
gb|ABR18068.1|  unknown                                                 337   7e-112   Picea sitchensis
ref|XP_010275011.1|  PREDICTED: eukaryotic translation initiation...    336   1e-111   Nelumbo nucifera [Indian lotus]
gb|ABK26793.1|  unknown                                                 336   1e-111   Picea sitchensis
ref|XP_009389562.1|  PREDICTED: eukaryotic translation initiation...    335   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009151956.1|  PREDICTED: eukaryotic translation initiation...    335   5e-111   Brassica rapa
gb|KJB56101.1|  hypothetical protein B456_009G106100                    332   1e-110   Gossypium raimondii
gb|KFK37423.1|  hypothetical protein AALP_AA4G255300                    333   1e-110   Arabis alpina [alpine rockcress]
emb|CDY34145.1|  BnaA02g28950D                                          333   2e-110   Brassica napus [oilseed rape]
ref|XP_010514644.1|  PREDICTED: eukaryotic translation initiation...    332   3e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010502959.1|  PREDICTED: eukaryotic translation initiation...    332   9e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010425732.1|  PREDICTED: eukaryotic translation initiation...    332   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_006395439.1|  hypothetical protein EUTSA_v10004580mg             328   1e-108   Eutrema salsugineum [saltwater cress]
ref|XP_004297796.1|  PREDICTED: eukaryotic translation initiation...    327   6e-108   Fragaria vesca subsp. vesca
ref|XP_002315834.2|  TGF-beta receptor-interacting protein 1            326   1e-107   
emb|CDY03970.1|  BnaC02g36850D                                          337   2e-107   
gb|ACF82853.1|  unknown                                                 321   2e-107   Zea mays [maize]
ref|NP_001061508.1|  Os08g0308100                                       324   9e-107   
ref|XP_006663589.1|  PREDICTED: eukaryotic translation initiation...    323   1e-106   
emb|CDY13713.1|  BnaA06g32100D                                          324   1e-106   Brassica napus [oilseed rape]
emb|CDY71621.1|  BnaAnng38210D                                          323   2e-106   Brassica napus [oilseed rape]
ref|XP_002882056.1|  TGF-beta receptor interacting protein 1            323   2e-106   Arabidopsis lyrata subsp. lyrata
gb|AAC62877.1|  eukaryotic translation initiation factor 3 delta ...    322   4e-106   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43524.1|  putative eukaryotic translation initiation facto...    323   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|NP_182152.2|  transducin/WD40 repeat-like superfamily protein       323   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008670966.1|  PREDICTED: eukaryotic translation initiation...    322   7e-106   Zea mays [maize]
ref|NP_001147501.1|  eukaryotic translation initiation factor 3 s...    321   8e-106   Zea mays [maize]
ref|NP_001055036.1|  Os05g0256000                                       321   1e-105   
ref|XP_001758941.1|  predicted protein                                  321   1e-105   
gb|AIZ68198.1|  eukaryotic translation initiation factor 3 subuni...    321   1e-105   Ornithogalum longebracteatum [sea-onion]
ref|XP_004955547.1|  PREDICTED: eukaryotic translation initiation...    321   1e-105   Setaria italica
ref|XP_001757566.1|  predicted protein                                  320   2e-105   
ref|XP_002461510.1|  hypothetical protein SORBIDRAFT_02g003760          320   3e-105   Sorghum bicolor [broomcorn]
gb|EMS51995.1|  Eukaryotic translation initiation factor 3 subunit I    320   3e-105   Triticum urartu
ref|XP_010508042.1|  PREDICTED: eukaryotic translation initiation...    321   4e-105   Camelina sativa [gold-of-pleasure]
ref|XP_002862549.1|  eukaryotic translation initiation factor 3 d...    319   5e-105   
ref|XP_001763986.1|  predicted protein                                  318   8e-105   
ref|XP_010506629.1|  PREDICTED: eukaryotic translation initiation...    319   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006294579.1|  hypothetical protein CARUB_v10023615mg             317   4e-104   Capsella rubella
dbj|BAJ85385.1|  predicted protein                                      316   7e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003577379.1|  PREDICTED: eukaryotic translation initiation...    316   8e-104   Brachypodium distachyon [annual false brome]
gb|AFM95335.1|  eukaryotic translation initiation factor 3 subunit i    316   9e-104   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002882057.1|  hypothetical protein ARALYDRAFT_322284             316   4e-103   
gb|KJB56103.1|  hypothetical protein B456_009G106100                    311   1e-102   Gossypium raimondii
ref|XP_010678072.1|  PREDICTED: eukaryotic translation initiation...    313   2e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_182151.1|  TGF-beta receptor interacting protein 1               311   6e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAG53616.1|AF285835_1  eukaryotic initiation factor 3I1 subunit      311   6e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KDO58631.1|  hypothetical protein CISIN_1g020461mg                   309   3e-101   Citrus sinensis [apfelsine]
gb|AAK43862.1|AF370485_1  eukaryotic translation initiation facto...    310   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006448046.1|  hypothetical protein CICLE_v10015917mg             309   4e-101   
dbj|BAH19940.1|  AT2G46280                                              305   2e-99    Arabidopsis thaliana [mouse-ear cress]
gb|AAC49079.1|  TGF-beta receptor interacting protein 1 homolog         302   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988251.1|  hypothetical protein SELMODRAFT_269383             300   2e-97    Selaginella moellendorffii
gb|EAZ42270.1|  hypothetical protein OsJ_26838                          295   1e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007215753.1|  hypothetical protein PRUPE_ppa009367mg             276   8e-89    
ref|XP_002500789.1|  predicted protein                                  265   4e-84    Micromonas commoda
gb|KCW69348.1|  hypothetical protein EUGRSUZ_F02830                     258   1e-81    Eucalyptus grandis [rose gum]
ref|XP_001418365.1|  predicted protein                                  253   3e-79    Ostreococcus lucimarinus CCE9901
gb|KJB56102.1|  hypothetical protein B456_009G106100                    253   4e-79    Gossypium raimondii
ref|XP_003059370.1|  predicted protein                                  250   7e-78    Micromonas pusilla CCMP1545
ref|XP_003079673.1|  TGF-beta receptor-interacting protein 1 (ISS)      248   2e-77    Ostreococcus tauri
ref|XP_007512918.1|  predicted protein                                  235   3e-72    Bathycoccus prasinos
ref|XP_011401093.1|  Eukaryotic translation initiation factor 3 s...    230   3e-70    Auxenochlorella protothecoides
ref|XP_006395438.1|  hypothetical protein EUTSA_v10004580mg             228   8e-70    
gb|KDD75202.1|  hypothetical protein H632_c812p0                        217   2e-65    Helicosporidium sp. ATCC 50920
gb|EMT33770.1|  hypothetical protein F775_29343                         216   7e-64    
gb|ETO77218.1|  hypothetical protein F444_07544                         209   3e-62    Phytophthora parasitica P1976
ref|XP_008904158.1|  hypothetical protein PPTG_10533                    209   5e-62    Phytophthora parasitica INRA-310
ref|XP_009538303.1|  hypothetical protein PHYSODRAFT_551045             209   7e-62    Phytophthora sojae
gb|KIZ03352.1|  Eukaryotic translation initiation factor 3 subunit I    209   7e-62    Monoraphidium neglectum
ref|XP_005647023.1|  TGF-beta receptor-interacting protein 1            207   4e-61    Coccomyxa subellipsoidea C-169
ref|XP_002899797.1|  eukaryotic translation initiation factor 3 s...    207   4e-61    Phytophthora infestans T30-4
ref|XP_008553489.1|  PREDICTED: eukaryotic translation initiation...    206   6e-61    Microplitis demolitor
ref|XP_001693266.1|  eukaryotic initiation factor                       206   9e-61    Chlamydomonas reinhardtii
ref|XP_008549768.1|  PREDICTED: eukaryotic translation initiation...    206   1e-60    Microplitis demolitor
gb|KDO58632.1|  hypothetical protein CISIN_1g020461mg                   203   4e-60    Citrus sinensis [apfelsine]
ref|XP_008613397.1|  translation initiation factor 3 subunit I          204   4e-60    Saprolegnia diclina VS20
emb|CCA18540.1|  eukaryotic translation initiation factor 3 subun...    204   5e-60    Albugo laibachii Nc14
ref|XP_011314062.1|  PREDICTED: eukaryotic translation initiation...    202   2e-59    Fopius arisanus
ref|XP_316636.4|  AGAP006607-PA                                         201   4e-59    Anopheles gambiae str. PEST
ref|XP_011337589.1|  PREDICTED: eukaryotic translation initiation...    201   5e-59    Ooceraea biroi
ref|XP_011254946.1|  PREDICTED: eukaryotic translation initiation...    201   6e-59    Camponotus floridanus
sp|B4LUA5.2|EIF3I_DROVI  RecName: Full=Eukaryotic translation ini...    201   7e-59    Drosophila virilis
ref|XP_011160448.1|  PREDICTED: eukaryotic translation initiation...    201   8e-59    Solenopsis invicta [imported red fire ant]
gb|EFZ22632.1|  hypothetical protein SINV_00160                         201   8e-59    
gb|ETN60290.1|  eukaryotic translation initiation factor 3 subunit      201   8e-59    Anopheles darlingi [American malaria mosquito]
ref|XP_002051937.1|  GJ17275                                            201   9e-59    
ref|XP_002078185.1|  GD22675                                            201   9e-59    Drosophila simulans
gb|KFQ29136.1|  Eukaryotic translation initiation factor 3 subunit I    198   1e-58    Merops nubicus
gb|EGI64611.1|  Eukaryotic translation initiation factor 3 subunit I    200   1e-58    Acromyrmex echinatior
ref|XP_001968738.1|  GG24335                                            200   1e-58    Drosophila erecta
ref|XP_002001737.1|  GI15375                                            200   1e-58    
gb|KFO76878.1|  Eukaryotic translation initiation factor 3 subunit I    198   1e-58    Cuculus canorus
ref|XP_009560176.1|  PREDICTED: eukaryotic translation initiation...    198   1e-58    Cuculus canorus
ref|NP_523478.1|  Trip1                                                 200   1e-58    Drosophila melanogaster
sp|B3MVL6.2|EIF3I_DROAN  RecName: Full=Eukaryotic translation ini...    200   1e-58    Drosophila ananassae
ref|XP_005427180.1|  PREDICTED: eukaryotic translation initiation...    198   1e-58    
ref|XP_004364074.2|  Trip1-PA                                           200   1e-58    Capsaspora owczarzaki ATCC 30864
ref|NP_001040433.1|  eukaryotic translation initiation factor 3 s...    200   1e-58    Bombyx mori [silk moth]
ref|XP_011055583.1|  PREDICTED: eukaryotic translation initiation...    200   1e-58    Acromyrmex echinatior
ref|XP_001965147.1|  GF23646                                            200   1e-58    
ref|XP_002957235.1|  eukaryotic translation initiation factor 3i        200   1e-58    Volvox carteri f. nagariensis
ref|XP_008937943.1|  PREDICTED: eukaryotic translation initiation...    198   1e-58    Merops nubicus
gb|KJE92223.1|  Trip1-PA                                                200   2e-58    Capsaspora owczarzaki ATCC 30864
sp|B4NW98.2|EIF3I_DROYA  RecName: Full=Eukaryotic translation ini...    199   2e-58    Drosophila yakuba
ref|XP_010083431.1|  PREDICTED: eukaryotic translation initiation...    198   2e-58    Pterocles gutturalis
ref|XP_002021487.1|  GL26537                                            199   2e-58    Drosophila persimilis
ref|XP_002088703.1|  Trip1                                              199   2e-58    
ref|XP_009821601.1|  hypothetical protein H257_00561                    199   2e-58    Aphanomyces astaci
emb|CCI46504.1|  unnamed protein product                                199   2e-58    Albugo candida
ref|XP_010012332.1|  PREDICTED: eukaryotic translation initiation...    197   3e-58    Nestor notabilis
ref|XP_007067631.1|  PREDICTED: eukaryotic translation initiation...    196   3e-58    Chelonia mydas [green seaturtle]
gb|KJB26173.1|  hypothetical protein B456_004G228300                    196   4e-58    Gossypium raimondii
ref|XP_009330494.1|  PREDICTED: eukaryotic translation initiation...    197   4e-58    Pygoscelis adeliae
ref|XP_010731470.1|  PREDICTED: eukaryotic translation initiation...    198   4e-58    
gb|KJB56104.1|  hypothetical protein B456_009G106100                    197   6e-58    Gossypium raimondii
ref|XP_002431936.1|  eukaryotic translation initiation factor 3 s...    198   6e-58    Pediculus humanus corporis [human body lice]
ref|XP_011180318.1|  PREDICTED: eukaryotic translation initiation...    198   6e-58    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_009482861.1|  PREDICTED: eukaryotic translation initiation...    196   6e-58    Pelecanus crispus
ref|XP_005823889.1|  translation initiation factor 3, subunit I         198   8e-58    Guillardia theta CCMP2712
ref|XP_011198986.1|  PREDICTED: eukaryotic translation initiation...    198   8e-58    Bactrocera dorsalis [papaya fruit fly]
ref|XP_004531427.1|  PREDICTED: eukaryotic translation initiation...    198   8e-58    Ceratitis capitata [medfly]
ref|XP_006806095.1|  PREDICTED: eukaryotic translation initiation...    198   9e-58    Neolamprologus brichardi [lyretail cichlid]
gb|EHJ63876.1|  eukaryotic translation initiation factor 3 subunit I    198   9e-58    
ref|XP_001989068.1|  GH10244                                            198   9e-58    Drosophila grimshawi
ref|XP_003443814.1|  PREDICTED: eukaryotic translation initiation...    198   1e-57    Oreochromis niloticus
ref|XP_009814792.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    197   1e-57    Gavia stellata
ref|XP_005707349.1|  translation initiation factor eIF-3 subunit 2      197   1e-57    Galdieria sulphuraria
gb|KFP30991.1|  Eukaryotic translation initiation factor 3 subunit I    197   1e-57    Colius striatus
ref|XP_002066637.1|  GK24461                                            197   1e-57    
gb|EMC82690.1|  Eukaryotic translation initiation factor 3 subunit I    196   2e-57    
ref|XP_392780.2|  PREDICTED: eukaryotic translation initiation fa...    197   2e-57    Apis mellifera [bee]
ref|XP_010198429.1|  PREDICTED: eukaryotic translation initiation...    197   2e-57    Colius striatus
emb|CDQ91911.1|  unnamed protein product                                197   2e-57    Oncorhynchus mykiss
gb|KFB49333.1|  AGAP006607-PA-like protein                              197   2e-57    Anopheles sinensis
ref|XP_008862518.1|  hypothetical protein H310_01239                    197   2e-57    Aphanomyces invadans
ref|XP_009283047.1|  PREDICTED: eukaryotic translation initiation...    197   2e-57    Aptenodytes forsteri
ref|XP_005509744.1|  PREDICTED: eukaryotic translation initiation...    196   2e-57    Columba livia [carrier pigeon]
ref|NP_001133273.1|  Eukaryotic translation initiation factor 3 s...    197   2e-57    Salmo salar
dbj|BAM18089.1|  eukaryotic translation initiation factor 3 subun...    197   3e-57    Papilio xuthus [Chinese swallowtail]
gb|EFN69223.1|  Eukaryotic translation initiation factor 3 subunit I    196   3e-57    Camponotus floridanus
ref|XP_009977243.1|  PREDICTED: eukaryotic translation initiation...    197   3e-57    Tauraco erythrolophus
ref|XP_009927166.1|  PREDICTED: eukaryotic translation initiation...    196   3e-57    Haliaeetus albicilla
gb|KFP00122.1|  Eukaryotic translation initiation factor 3 subunit I    196   4e-57    Calypte anna
gb|KFP52286.1|  Eukaryotic translation initiation factor 3 subunit I    194   4e-57    Cathartes aura
ref|NP_001157867.1|  eukaryotic translation initiation factor 3 s...    196   4e-57    Gallus gallus [bantam]
ref|XP_003707661.1|  PREDICTED: eukaryotic translation initiation...    196   4e-57    Megachile rotundata
gb|EOB00694.1|  Eukaryotic translation initiation factor 3 subunit I    196   4e-57    Anas platyrhynchos [duck]
ref|XP_009579506.1|  PREDICTED: eukaryotic translation initiation...    196   4e-57    Fulmarus glacialis
ref|XP_009708532.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    196   4e-57    Cariama cristata
ref|XP_005239876.1|  PREDICTED: eukaryotic translation initiation...    196   4e-57    
ref|XP_009646824.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    196   4e-57    Egretta garzetta
gb|KFV75063.1|  Eukaryotic translation initiation factor 3 subunit I    196   4e-57    Picoides pubescens
ref|XP_009679337.1|  PREDICTED: eukaryotic translation initiation...    196   4e-57    Struthio camelus australis
ref|XP_010168387.1|  PREDICTED: eukaryotic translation initiation...    196   4e-57    Antrostomus carolinensis
ref|XP_010902262.1|  PREDICTED: eukaryotic translation initiation...    196   4e-57    Esox lucius
ref|XP_011145247.1|  PREDICTED: eukaryotic translation initiation...    196   5e-57    Harpegnathos saltator
gb|KDR14214.1|  hypothetical protein L798_11754                         196   5e-57    Zootermopsis nevadensis
ref|XP_009882825.1|  PREDICTED: eukaryotic translation initiation...    196   5e-57    Charadrius vociferus
ref|XP_010721802.1|  PREDICTED: eukaryotic translation initiation...    196   6e-57    Meleagris gallopavo [common turkey]
gb|KFQ49075.1|  Eukaryotic translation initiation factor 3 subunit I    194   6e-57    Nestor notabilis
gb|ACD65081.1|  eukaryotic translation initiation factor                196   6e-57    Forcipomyia taiwana
ref|XP_008491107.1|  PREDICTED: eukaryotic translation initiation...    196   6e-57    Calypte anna
ref|XP_010280277.1|  PREDICTED: eukaryotic translation initiation...    196   6e-57    Phaethon lepturus
ref|XP_009068306.1|  PREDICTED: eukaryotic translation initiation...    196   6e-57    Acanthisitta chloris
ref|NP_001157823.1|  eukaryotic translation initiation factor 3 s...    196   7e-57    Taeniopygia guttata
ref|XP_005535289.1|  eukaryotic translation initiation factor eIF...    196   7e-57    Cyanidioschyzon merolae strain 10D
gb|KFP75614.1|  Eukaryotic translation initiation factor 3 subunit I    196   7e-57    Acanthisitta chloris
ref|XP_005058303.1|  PREDICTED: eukaryotic translation initiation...    196   7e-57    Ficedula albicollis
ref|XP_010574327.1|  PREDICTED: eukaryotic translation initiation...    196   7e-57    Haliaeetus leucocephalus
ref|XP_003228758.1|  PREDICTED: eukaryotic translation initiation...    196   7e-57    Anolis carolinensis [Carolina anole]
gb|KFW72870.1|  Eukaryotic translation initiation factor 3 subunit I    194   7e-57    Pygoscelis adeliae
ref|XP_009906815.1|  PREDICTED: eukaryotic translation initiation...    196   8e-57    Picoides pubescens
ref|XP_005020506.1|  PREDICTED: eukaryotic translation initiation...    196   8e-57    
ref|XP_006676014.1|  hypothetical protein BATDEDRAFT_84729              196   8e-57    Batrachochytrium dendrobatidis JAM81
ref|XP_009964403.1|  PREDICTED: eukaryotic translation initiation...    195   8e-57    Tyto alba [Schleiereule]
ref|XP_010574326.1|  PREDICTED: eukaryotic translation initiation...    196   8e-57    Haliaeetus leucocephalus
ref|XP_010295903.1|  PREDICTED: eukaryotic translation initiation...    196   8e-57    Balearica regulorum gibbericeps
emb|CAF99511.1|  unnamed protein product                                195   9e-57    Tetraodon nigroviridis
ref|NP_001279068.1|  eukaryotic translation initiation factor 3, ...    195   9e-57    Callorhinchus milii [Australian ghost shark]
gb|KFO60217.1|  Eukaryotic translation initiation factor 3 subunit I    195   1e-56    Corvus brachyrhynchos
ref|XP_008633416.1|  PREDICTED: eukaryotic translation initiation...    195   1e-56    Corvus brachyrhynchos
ref|XP_008188704.1|  PREDICTED: eukaryotic translation initiation...    191   1e-56    
ref|XP_005142501.1|  PREDICTED: eukaryotic translation initiation...    195   1e-56    Melopsittacus undulatus
ref|XP_008294825.1|  PREDICTED: eukaryotic translation initiation...    194   2e-56    Stegastes partitus
ref|NP_998155.1|  eukaryotic translation initiation factor 3 subu...    194   2e-56    Danio rerio [leopard danio]
ref|XP_006019466.1|  PREDICTED: eukaryotic translation initiation...    194   2e-56    Alligator sinensis
gb|EFX80147.1|  hypothetical protein DAPPUDRAFT_304176                  194   3e-56    Daphnia pulex
ref|XP_006274867.1|  PREDICTED: eukaryotic translation initiation...    194   3e-56    Alligator mississippiensis
ref|XP_004074467.1|  PREDICTED: eukaryotic translation initiation...    194   3e-56    Oryzias latipes [Japanese rice fish]
dbj|BAE01324.1|  unnamed protein product                                189   3e-56    Macaca fascicularis [crab eating macaque]
gb|ACQ58286.1|  Eukaryotic translation initiation factor 3 subunit I    194   3e-56    Anoplopoma fimbria
gb|KFV10110.1|  Eukaryotic translation initiation factor 3 subunit I    194   3e-56    Tauraco erythrolophus
ref|XP_003969003.1|  PREDICTED: eukaryotic translation initiation...    194   3e-56    Takifugu rubripes [tiger puffer]
gb|AHH54970.1|  eukaryotic translation initiation factor 3 subunit I    191   3e-56    Panthera tigris altaica
dbj|BAE90204.1|  unnamed protein product                                192   3e-56    Macaca fascicularis [crab eating macaque]
ref|XP_002167671.1|  PREDICTED: eukaryotic translation initiation...    194   3e-56    Hydra vulgaris
gb|KFQ71196.1|  Eukaryotic translation initiation factor 3 subunit I    193   4e-56    Phaethon lepturus
gb|KFM11279.1|  Eukaryotic translation initiation factor 3 subunit I    194   4e-56    Aptenodytes forsteri
ref|XP_005302240.1|  PREDICTED: eukaryotic translation initiation...    194   4e-56    Chrysemys picta bellii
ref|XP_003937672.1|  PREDICTED: eukaryotic translation initiation...    192   5e-56    Saimiri boliviensis boliviensis
gb|ELU14583.1|  hypothetical protein CAPTEDRAFT_180537                  193   5e-56    Capitella teleta
gb|KFQ11963.1|  Eukaryotic translation initiation factor 3 subunit I    192   6e-56    Haliaeetus albicilla
ref|XP_001509369.3|  PREDICTED: eukaryotic translation initiation...    192   6e-56    
ref|XP_007563815.1|  PREDICTED: eukaryotic translation initiation...    193   6e-56    Poecilia formosa
gb|KFP10887.1|  Eukaryotic translation initiation factor 3 subunit I    193   6e-56    Egretta garzetta
gb|KFZ50593.1|  Eukaryotic translation initiation factor 3 subunit I    193   6e-56    Antrostomus carolinensis
gb|KFW07927.1|  Eukaryotic translation initiation factor 3 subunit I    193   6e-56    Fulmarus glacialis
gb|KFQ08008.1|  Eukaryotic translation initiation factor 3 subunit I    193   6e-56    Leptosomus discolor
gb|ACO09379.1|  Eukaryotic translation initiation factor 3 subunit 2    193   7e-56    Osmerus mordax
gb|KGL92853.1|  Eukaryotic translation initiation factor 3 subunit I    193   7e-56    Charadrius vociferus
ref|XP_010275012.1|  PREDICTED: eukaryotic translation initiation...    190   9e-56    Nelumbo nucifera [Indian lotus]
ref|XP_003396808.1|  PREDICTED: eukaryotic translation initiation...    192   9e-56    
gb|ADO28015.1|  eukaryotic translation initiation factor 3 subunit i    192   1e-55    Ictalurus furcatus
ref|XP_009230695.1|  PREDICTED: eukaryotic translation initiation...    191   1e-55    Pongo abelii [orang utan]
ref|XP_010352245.1|  PREDICTED: eukaryotic translation initiation...    191   1e-55    Rhinopithecus roxellana
gb|KFO08490.1|  Eukaryotic translation initiation factor 3 subunit I    192   1e-55    Balearica regulorum gibbericeps
ref|XP_005718524.1|  Translation initiation factor eIF3, subunit I      192   1e-55    Chondrus crispus [carageen]
ref|XP_005812506.1|  PREDICTED: eukaryotic translation initiation...    192   1e-55    Xiphophorus maculatus
ref|XP_003487069.1|  PREDICTED: eukaryotic translation initiation...    192   1e-55    Bombus impatiens
ref|NP_001187527.1|  eukaryotic translation initiation factor 3 s...    192   2e-55    Ictalurus punctatus
ref|XP_008330275.1|  PREDICTED: eukaryotic translation initiation...    192   2e-55    
ref|XP_008330274.1|  PREDICTED: eukaryotic translation initiation...    192   2e-55    Cynoglossus semilaevis [half-smooth tongue sole]
ref|NP_001015781.1|  eukaryotic translation initiation factor 3 s...    192   2e-55    Xenopus tropicalis [western clawed frog]
ref|XP_008918903.1|  PREDICTED: eukaryotic translation initiation...    195   2e-55    
gb|EPQ15220.1|  Eukaryotic translation initiation factor 3 subunit I    192   2e-55    
ref|XP_008330273.1|  PREDICTED: eukaryotic translation initiation...    192   2e-55    
ref|XP_011356138.1|  PREDICTED: eukaryotic translation initiation...    191   2e-55    
gb|EDL80550.1|  rCG30571, isoform CRA_b                                 190   3e-55    
gb|AEE62555.1|  unknown                                                 191   3e-55    
ref|XP_007249463.1|  PREDICTED: eukaryotic translation initiation...    191   3e-55    
ref|XP_005181692.1|  PREDICTED: eukaryotic translation initiation...    191   3e-55    
ref|NP_001087664.1|  eukaryotic translation initiation factor 3 s...    191   3e-55    
gb|ACH44280.1|  putative eukaryotic translation initiation factor...    191   3e-55    
ref|XP_007492943.1|  PREDICTED: eukaryotic translation initiation...    191   3e-55    
ref|XP_003276408.2|  PREDICTED: eukaryotic translation initiation...    191   3e-55    
ref|XP_003801293.1|  PREDICTED: eukaryotic translation initiation...    191   3e-55    
gb|EFN80705.1|  Eukaryotic translation initiation factor 3 subunit I    191   4e-55    
ref|XP_004603791.1|  PREDICTED: eukaryotic translation initiation...    191   4e-55    
gb|EFN80704.1|  Eukaryotic translation initiation factor 3 subunit I    191   4e-55    
ref|XP_006117620.1|  PREDICTED: eukaryotic translation initiation...    191   4e-55    
ref|XP_006094311.1|  PREDICTED: eukaryotic translation initiation...    191   4e-55    
ref|XP_008155232.1|  PREDICTED: eukaryotic translation initiation...    191   4e-55    
ref|XP_003500685.1|  PREDICTED: eukaryotic translation initiation...    191   5e-55    
ref|XP_004591787.1|  PREDICTED: eukaryotic translation initiation...    191   5e-55    
ref|XP_007432017.1|  PREDICTED: eukaryotic translation initiation...    191   5e-55    
ref|XP_002802333.1|  PREDICTED: eukaryotic translation initiation...    191   5e-55    
ref|XP_004679476.1|  PREDICTED: eukaryotic translation initiation...    191   6e-55    
dbj|BAD96203.1|  eukaryotic translation initiation factor 3, subu...    191   6e-55    
ref|XP_010593652.1|  PREDICTED: eukaryotic translation initiation...    191   6e-55    
gb|AAX36269.1|  eukaryotic translation initiation factor 3 subuni...    191   6e-55    
gb|AAV38402.1|  eukaryotic translation initiation factor 3, subun...    191   6e-55    
ref|NP_003748.1|  eukaryotic translation initiation factor 3 subu...    191   6e-55    
ref|XP_002115720.1|  expressed hypothetical protein                     191   7e-55    
gb|EDL30181.1|  eukaryotic translation initiation factor 3, subun...    190   7e-55    
ref|XP_011445956.1|  PREDICTED: eukaryotic translation initiation...    190   7e-55    
ref|NP_061269.1|  eukaryotic translation initiation factor 3 subu...    190   7e-55    
gb|ELR48735.1|  Eukaryotic translation initiation factor 3 subunit I    190   8e-55    
gb|EFB27372.1|  hypothetical protein PANDA_010855                       190   8e-55    
ref|XP_005878403.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    191   9e-55    
gb|EKC38588.1|  Eukaryotic translation initiation factor 3 subunit I    190   9e-55    
ref|XP_007170666.1|  PREDICTED: eukaryotic translation initiation...    190   9e-55    
ref|XP_003765492.1|  PREDICTED: eukaryotic translation initiation...    191   9e-55    
ref|XP_008064944.1|  PREDICTED: eukaryotic translation initiation...    191   9e-55    
ref|NP_001231553.1|  eukaryotic translation initiation factor 3, ...    190   9e-55    
ref|XP_007197322.1|  PREDICTED: eukaryotic translation initiation...    188   1e-54    
ref|NP_001015628.1|  eukaryotic translation initiation factor 3 s...    190   1e-54    
gb|KFW78228.1|  Eukaryotic translation initiation factor 3 subunit I    189   1e-54    
ref|XP_967415.1|  PREDICTED: eukaryotic translation initiation fa...    190   1e-54    
ref|XP_004406473.1|  PREDICTED: eukaryotic translation initiation...    190   1e-54    
ref|NP_001108507.1|  eukaryotic translation initiation factor 3 s...    190   1e-54    
gb|ERE85417.1|  eukaryotic translation initiation factor 3 subuni...    191   1e-54    
ref|XP_006895022.1|  PREDICTED: eukaryotic translation initiation...    190   1e-54    
ref|XP_005317802.1|  PREDICTED: eukaryotic translation initiation...    189   1e-54    
ref|XP_002400973.1|  translation initiation factor 3 and TGF-beta...    186   1e-54    
ref|XP_007125162.1|  PREDICTED: eukaryotic translation initiation...    189   2e-54    
ref|XP_005395112.1|  PREDICTED: eukaryotic translation initiation...    190   2e-54    
ref|NP_001156064.1|  eukaryotic translation initiation factor 3 s...    189   2e-54    
ref|XP_007948641.1|  PREDICTED: eukaryotic translation initiation...    189   2e-54    
ref|XP_002921914.2|  PREDICTED: eukaryotic translation initiation...    190   2e-54    
ref|XP_010619869.1|  PREDICTED: eukaryotic translation initiation...    189   2e-54    
ref|XP_011501372.1|  PREDICTED: eukaryotic translation initiation...    189   3e-54    
ref|XP_001639587.1|  predicted protein                                  189   3e-54    
ref|XP_003387873.1|  PREDICTED: eukaryotic translation initiation...    189   3e-54    
ref|XP_008419625.1|  PREDICTED: eukaryotic translation initiation...    189   3e-54    
ref|XP_001656392.1|  AAEL013144-PA                                      189   3e-54    
ref|XP_006862226.1|  PREDICTED: eukaryotic translation initiation...    189   4e-54    
ref|XP_004705070.1|  PREDICTED: eukaryotic translation initiation...    189   4e-54    
ref|XP_004266574.1|  PREDICTED: eukaryotic translation initiation...    189   4e-54    
ref|XP_004372060.1|  PREDICTED: eukaryotic translation initiation...    190   4e-54    
gb|EHB12852.1|  Eukaryotic translation initiation factor 3 subunit I    189   4e-54    
ref|XP_005139430.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    189   4e-54    
ref|XP_006054762.1|  PREDICTED: eukaryotic translation initiation...    190   6e-54    
gb|AAX41399.1|  eukaryotic translation initiation factor 3 subuni...    188   6e-54    
dbj|GAA27675.2|  translation initiation factor 3 subunit I              184   6e-54    
ref|NP_001280295.1|  uncharacterized protein LOC100162604               188   6e-54    
gb|EHH14557.1|  hypothetical protein EGK_00504                          188   7e-54    
gb|KHJ35878.1|  putative eukaryotic translation initiation factor 3     188   7e-54    
ref|XP_004341724.1|  eTGF-beta receptor-interacting protein, puta...    188   8e-54    
gb|AFR92732.1|  translation initiation factor 3 subunit I               188   1e-53    
ref|XP_007092475.1|  PREDICTED: eukaryotic translation initiation...    187   1e-53    
ref|XP_004900249.1|  PREDICTED: eukaryotic translation initiation...    189   1e-53    
dbj|BAE42882.1|  unnamed protein product                                187   1e-53    
ref|XP_777869.1|  hypothetical protein CNBA5660                         188   1e-53    
ref|XP_567255.1|  hypothetical protein                                  187   2e-53    
gb|AAI27353.1|  eif3s2 protein                                          187   2e-53    
gb|ELK02020.1|  Eukaryotic translation initiation factor 3 subunit I    191   2e-53    
ref|XP_005761487.1|  hypothetical protein EMIHUDRAFT_438175             187   2e-53    
ref|XP_003191596.1|  hypothetical protein CGB_A6310C                    187   3e-53    
gb|KIR53699.1|  eukaryotic translation initiation factor 3 subunit I    187   3e-53    
ref|XP_004485231.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    188   3e-53    
ref|XP_004665214.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    187   3e-53    
gb|KJE03072.1|  eukaryotic translation initiation factor 3 subunit I    187   3e-53    
ref|NP_001126286.1|  eukaryotic translation initiation factor 3 s...    186   3e-53    
gb|KIR86604.1|  eukaryotic translation initiation factor 3 subunit I    187   3e-53    
ref|XP_005102454.1|  PREDICTED: eukaryotic translation initiation...    186   3e-53    
gb|KIR48380.1|  eukaryotic translation initiation factor 3 subunit I    186   3e-53    
gb|KIR69157.1|  eukaryotic translation initiation factor 3 subunit I    186   3e-53    
ref|XP_006777450.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    187   4e-53    
ref|XP_005102453.1|  PREDICTED: eukaryotic translation initiation...    186   4e-53    
ref|XP_001503867.4|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    186   4e-53    
ref|XP_006994436.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    186   5e-53    
ref|XP_001868509.1|  eukaryotic translation initiation factor 3 s...    186   6e-53    
gb|EMP28420.1|  Alpha-taxilin                                           196   7e-53    
ref|XP_007468733.1|  PREDICTED: eukaryotic translation initiation...    189   7e-53    
ref|XP_006901315.1|  PREDICTED: eukaryotic translation initiation...    185   1e-52    
ref|XP_535328.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic tran...    186   1e-52    
ref|XP_004850898.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    186   2e-52    
ref|XP_008079360.1|  WD40 repeat-like protein                           184   2e-52    
ref|XP_009167677.1|  hypothetical protein T265_04631                    182   2e-52    
ref|XP_007680736.1|  hypothetical protein BAUCODRAFT_286498             184   2e-52    
ref|XP_003844805.1|  similar to eukaryotic translation initiation...    184   3e-52    
ref|XP_002840508.1|  hypothetical protein                               184   3e-52    
ref|XP_008024458.1|  hypothetical protein SETTUDRAFT_168745             184   3e-52    
gb|EEC83341.1|  hypothetical protein OsI_28738                          181   6e-52    
gb|KFM68458.1|  Eukaryotic translation initiation factor 3 subunit I    183   6e-52    
ref|XP_009013860.1|  hypothetical protein HELRODRAFT_185422             182   6e-52    
gb|AAW25130.1|  SJCHGC02831 protein                                     182   6e-52    
ref|XP_002122597.1|  PREDICTED: eukaryotic translation initiation...    182   7e-52    
ref|XP_006158209.1|  PREDICTED: eukaryotic translation initiation...    182   8e-52    
ref|XP_008210954.1|  PREDICTED: eukaryotic translation initiation...    182   9e-52    
gb|ERZ95383.1|  hypothetical protein GLOINDRAFT_341253                  182   9e-52    
gb|ABK92672.1|  unknown                                                 174   1e-51    
ref|XP_001603140.1|  PREDICTED: eukaryotic translation initiation...    182   1e-51    
ref|XP_007692855.1|  hypothetical protein COCMIDRAFT_108319             182   1e-51    
ref|XP_007363750.1|  WD40 repeat-like protein                           182   1e-51    
emb|CEJ88530.1|  Putative Eukaryotic translation initiation facto...    182   1e-51    
emb|CDS04160.1|  hypothetical protein LRAMOSA07115                      182   2e-51    
gb|KIM93051.1|  hypothetical protein OIDMADRAFT_107011                  182   2e-51    
gb|AAY32924.1|  TGF-beta receptor interacting protein 1                 182   2e-51    
gb|AFK47032.1|  unknown                                                 174   2e-51    
ref|XP_001557202.1|  eukaryotic translation initiation factor 3         182   2e-51    
ref|XP_001933019.1|  eukaryotic translation initiation factor 3 s...    182   2e-51    
ref|XP_009047818.1|  hypothetical protein LOTGIDRAFT_200332             181   3e-51    
ref|XP_008692694.1|  PREDICTED: eukaryotic translation initiation...    181   4e-51    
gb|EJU03377.1|  WD40 repeat-like protein                                181   4e-51    
ref|XP_003051107.1|  predicted protein                                  181   4e-51    
gb|EJT48020.1|  hypothetical protein A1Q1_02936                         181   4e-51    
emb|CDH49815.1|  eukaryotic translation initiation factor 3subunit      181   4e-51    
ref|XP_006963216.1|  predicted protein                                  181   5e-51    
ref|XP_009451208.1|  PREDICTED: eukaryotic translation initiation...    178   6e-51    
gb|KGG49952.1|  subunit I of eukaryotic translation initiation fa...    181   8e-51    
gb|KFO34423.1|  Eukaryotic translation initiation factor 3 subunit I    189   8e-51    
gb|EHK41282.1|  hypothetical protein TRIATDRAFT_301894                  180   8e-51    
gb|KIW74742.1|  eukaryotic translation initiation factor 3 subunit I    180   9e-51    
ref|XP_001595804.1|  eukaryotic translation initiation factor 3         180   9e-51    
ref|XP_008723623.1|  eukaryotic translation initiation factor 3 s...    179   1e-50    
gb|KIW69713.1|  eukaryotic translation initiation factor 3 subunit I    179   1e-50    
ref|XP_010221644.1|  PREDICTED: eukaryotic translation initiation...    174   1e-50    
gb|KEQ62058.1|  putative eukaryotic translation initiation factor...    179   1e-50    
gb|KIX06858.1|  eukaryotic translation initiation factor 3 subunit I    179   2e-50    
gb|EWG40623.1|  eukaryotic translation initiation factor 3 subunit I    179   2e-50    
ref|XP_007755968.1|  eukaryotic translation initiation factor 3 s...    179   2e-50    
gb|KEQ86784.1|  putative eukaryotic translation initiation factor...    179   3e-50    
ref|XP_001208970.1|  eukaryotic translation initiation factor 3 s...    179   3e-50    
emb|CCG84178.1|  protein of unknown function                            178   3e-50    
dbj|GAD97183.1|  conserved hypothetical protein                         180   3e-50    
gb|ACO13175.1|  Eukaryotic translation initiation factor 3 subunit I    178   4e-50    
gb|KEQ92579.1|  hypothetical protein AUEXF2481DRAFT_423089              178   4e-50    
ref|XP_007797965.1|  putative eukaryotic translation initiation f...    178   5e-50    
gb|EMT63386.1|  Eukaryotic translation initiation factor 3 subunit I    178   6e-50    
ref|XP_009254997.1|  hypothetical protein FPSE_03603                    178   6e-50    
ref|NP_001075647.1|  eukaryotic translation initiation factor 3 s...    177   9e-50    
gb|KEQ76375.1|  eukaryotic translation initiation factor 3 subunit I    177   9e-50    
gb|EGU87079.1|  hypothetical protein FOXB_02473                         178   9e-50    
emb|CBY20744.1|  unnamed protein product                                177   1e-49    
ref|XP_007873769.1|  hypothetical protein PNEG_01801                    177   1e-49    
gb|EHK16486.1|  hypothetical protein TRIVIDRAFT_82783                   177   1e-49    
gb|KFA62828.1|  hypothetical protein S40285_03799                       177   1e-49    
gb|ACO15193.1|  Eukaryotic translation initiation factor 3 subunit I    177   1e-49    
emb|CCF74483.1|  unnamed protein product                                177   2e-49    
gb|KIL96311.1|  hypothetical protein FAVG1_01055                        177   2e-49    
ref|XP_007814077.1|  eukaryotic translation initiation factor 3 s...    176   2e-49    
gb|KFX89447.1|  hypothetical protein V490_07014                         176   3e-49    
ref|XP_660601.1|  hypothetical protein AN2997.2                         176   3e-49    
ref|XP_001903926.1|  hypothetical protein                               176   3e-49    
gb|KID66371.1|  eukaryotic translation initiation factor 3 subunit 2    176   3e-49    
gb|KIO29603.1|  hypothetical protein M407DRAFT_167483                   176   3e-49    
ref|XP_003664486.1|  hypothetical protein MYCTH_2307366                 176   4e-49    
gb|KIW28535.1|  eukaryotic translation initiation factor 3 subunit I    176   4e-49    
gb|ESZ97118.1|  eukaryotic translation initiation factor 3 subunit 2    176   4e-49    
ref|XP_002488027.1|  eukaryotic translation initiation factor 3 s...    176   4e-49    
ref|XP_001818333.1|  eukaryotic translation initiation factor 3 s...    176   4e-49    
ref|XP_002556539.1|  KLTH0H15752p                                       176   4e-49    
gb|EIF45267.1|  eukaryotic translation initiation factor 3 subunit      176   5e-49    
gb|KDB12673.1|  eukaryotic translation initiation factor 3 subunit 2    176   5e-49    
gb|ACO14914.1|  Eukaryotic translation initiation factor 3 subunit I    175   5e-49    
ref|XP_007816213.1|  WD40 repeat 2                                      175   5e-49    
gb|KEY69990.1|  hypothetical protein S7711_04008                        175   5e-49    
ref|XP_007911781.1|  putative eukaryotic translation initiation f...    175   6e-49    
gb|ELR06011.1|  eukaryotic translation initiation factor 3 subunit I    175   6e-49    
gb|KFG62729.1|  putative eukaryotic initiation factor-3, delta su...    174   6e-49    
gb|EPZ33787.1|  hypothetical protein O9G_004435                         175   6e-49    
gb|KFY09000.1|  hypothetical protein V492_05712                         175   6e-49    
gb|EHA23450.1|  hypothetical protein ASPNIDRAFT_207376                  175   7e-49    
ref|XP_002670116.1|  predicted protein                                  175   7e-49    
ref|XP_001263576.1|  eukaryotic translation initiation factor 3 s...    175   7e-49    
emb|CCX32511.1|  Similar to Eukaryotic translation initiation fac...    175   7e-49    
sp|A2QEV8.1|EIF3I_ASPNC  RecName: Full=Eukaryotic translation ini...    175   7e-49    
gb|EPE08176.1|  eukaryotic translation initiation factor 3 subunit 2    175   7e-49    
gb|KIW02168.1|  eukaryotic translation initiation factor 3 subunit I    175   7e-49    
gb|EJW87370.1|  eukaryotic translation initiation factor 3 subunit I    171   8e-49    
ref|XP_002582844.1|  eukaryotic translation initiation factor 3 3...    175   8e-49    
ref|XP_754751.1|  eukaryotic translation initiation factor 3 subu...    175   8e-49    
ref|XP_007399384.1|  hypothetical protein PHACADRAFT_261788             175   8e-49    
ref|XP_007748455.1|  eukaryotic translation initiation factor 3 s...    175   8e-49    
dbj|GAM40932.1|  translation initiation factor                          175   9e-49    
ref|XP_008595136.1|  eukaryotic translation initiation factor 3 3...    175   9e-49    
ref|XP_003739333.1|  PREDICTED: eukaryotic translation initiation...    175   9e-49    
gb|EQL00507.1|  eukaryotic translation initiation factor 3 subunit 2    175   9e-49    
ref|XP_003006338.1|  eukaryotic translation initiation factor 3 3...    174   1e-48    
gb|KIW54434.1|  eukaryotic translation initiation factor 3 subunit I    174   1e-48    
gb|KHN96372.1|  eukaryotic translation initiation factor 3 subunit 2    174   1e-48    
emb|CEP61303.1|  LALA0S02e11386g1_1                                     175   1e-48    
ref|XP_002153410.1|  eukaryotic translation initiation factor 3 s...    174   1e-48    
ref|XP_003686526.1|  hypothetical protein TPHA_0G02570                  174   1e-48    
ref|XP_003686473.1|  hypothetical protein TPHA_0G02030                  175   1e-48    
gb|EIE82800.1|  hypothetical protein RO3G_07505                         174   1e-48    
emb|CDO77164.1|  hypothetical protein BN946_scf184657.g40               173   1e-48    
emb|CDK24887.1|  unnamed protein product                                174   1e-48    
ref|XP_003067988.1|  eukaryotic translation initiation factor, pu...    174   2e-48    
gb|KFZ10578.1|  hypothetical protein V501_05126                         174   2e-48    
ref|XP_001240506.1|  conserved hypothetical protein                     174   2e-48    
gb|KIW89036.1|  eukaryotic translation initiation factor 3 subunit I    174   2e-48    
gb|KIJ36634.1|  hypothetical protein M422DRAFT_61136                    175   2e-48    
dbj|GAA84383.1|  eukaryotic translation initiation factor 3 subun...    174   2e-48    



>gb|KHN14569.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   361 bits (926),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  19   QTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKT  78

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS DGSHF+TGSLDKSA+LWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  79   VTSLAKSADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  138

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  139  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  198

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  199  LHHFDPDYFNIKI  211



>ref|XP_008443373.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis melo]
Length=326

 Score =   364 bits (934),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLNKTIISGGED+V+RIWD+ETGKLLKESD+E+GHKK 
Sbjct  134  QTGESVLLLKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDSETGKLLKESDKETGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL K+ DGSHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLTKASDGSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T   L ++  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTAKLWNVQTGQQLFSFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  K+  SGGED  V
Sbjct  111  TTDPFVELPSAIHVKRIARDPSEQTGESVLLLKGPQGRINRAVWGPLNKTIISGGEDAVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|KDP38201.1| hypothetical protein JCGZ_04844 [Jatropha curcas]
Length=326

 Score =   363 bits (932),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKESD+E GHKK 
Sbjct  134  QTGESVLILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLTKSSDGSHFVTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T T L ++  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTAKLWNVQTGTQLYSFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIARDPADQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_002521889.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF40525.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=326

 Score =   362 bits (929),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLNKTI+S GED+V+RIWD+ETGKLLKESD+E GHKK 
Sbjct  134  QTGESVLVLKGPQGRINRAVWGPLNKTILSAGEDAVIRIWDSETGKLLKESDREIGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLTKSSDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEE+GGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEVGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNKEGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLWD++T T L ++  + P  AV +S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTAKLWDVKTGTQLYSFNFDSPARAVDLS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIARDPDNQTGESVLVLKGPQGRINRAVWGPLNKTILSAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_004136687.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 ref|XP_004159618.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cucumis sativus]
 gb|KGN59537.1| hypothetical protein Csa_3G824820 [Cucumis sativus]
Length=326

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETGKLLKESD+E GHKK 
Sbjct  134  QTGESVLLLKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGKLLKESDKEIGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL KS DGSHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  VTSLTKSSDGSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T   L ++  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTAKLWNVQTGQQLFSFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  K+  S GED  V
Sbjct  111  TTDPFMELPSAIHVKRIARDPSEQTGESVLLLKGPQGRINRAVWGPLNKTIISAGEDAVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_003517705.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS DGSHF+TGSLDKSA+LWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  VTSLAKSADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFA-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I         E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIANDPAEQTGESVLLIKGPQGRINRAIWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_007222666.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
 gb|EMJ23865.1| hypothetical protein PRUPE_ppa008567mg [Prunus persica]
Length=326

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D+E GHKK 
Sbjct  134  QVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS+DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLAKSVDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T   L T+  + P  AV +S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDLS-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGV-------KGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I  +    V       KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELSSAIHVKRIANDPADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_008220972.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Prunus mume]
Length=326

 Score =   360 bits (924),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D+E GHKK 
Sbjct  134  QVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS+DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLAKSVDGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T   L T+  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFS-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGV-------KGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I  +    V       KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELSSAIHVKRIANDPADQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_007016708.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016709.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34327.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY34328.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=326

 Score =   360 bits (923),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKLL+E+D+ESGHKK 
Sbjct  134  QTGESVLVIKGPQGRINRAIWGPLNSTIISAGEDAVIRIWDSETGKLLREADKESGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS DGSHF+TGSLDKSAKLWD+RTLTL+KTYVTERPVNAV +SPLLDH+VLGGGQ
Sbjct  194  ITSLAKSADGSHFLTGSLDKSAKLWDVRTLTLIKTYVTERPVNAVALSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T T L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLFTFNFDSPARSVDFA-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P   +  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRITRDATEQTGESVLVIKGPQGRINRAIWGPLNSTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_009777666.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Nicotiana sylvestris]
Length=326

 Score =   359 bits (921),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+LKESD+E GHKKG
Sbjct  134  QVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKILKESDKEVGHKKG  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQ
Sbjct  194  ITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQ+EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQQEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDHDYFNIKI  326


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D+SAKLWD++T T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I       + E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMGLPSAIHVKRISKDPSDQVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|KDO58633.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=268

 Score =   357 bits (915),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLKESD+E+GHKK 
Sbjct  76   QGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLKESDKETGHKKT  135

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  136  ITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQ  195

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  196  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  255

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  256  LHHFDPDYFNIKI  268



>ref|XP_009629813.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Nicotiana tomentosiformis]
Length=326

 Score =   358 bits (920),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+LKESD+E GHKKG
Sbjct  134  QIGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKILKESDKEVGHKKG  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQ
Sbjct  194  ITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQ+EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQQEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDHDYFNIKI  326


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D+SAKLWD++T T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I       + E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMGLPSAIHVKRISRDPSDQIGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_009777665.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nicotiana sylvestris]
Length=331

 Score =   358 bits (918),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            + GESVLT+KG QGRINRAVWGPLN+TIIS GED+V+RIWD ETGK+LKESD+E GHKKG
Sbjct  139  EVGESVLTLKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDVETGKILKESDKEVGHKKG  198

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQ
Sbjct  199  ITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQ  258

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQ+EIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  259  DASAVTTTDHRAGKFEAKFYDKILQQEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  318

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  319  LHHFDHDYFNIKI  331


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 83/187 (44%), Gaps = 25/187 (13%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D+SAKLWD++T T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQSAKLWDVQTGTQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAG--------KFEAKFYDKILQEEIG----GVKGHFGPINALAFNPDGKSFASGG  228
            TTD   G        +      D+IL  E+G     +KG  G IN   + P  ++  S G
Sbjct  111  TTDPFMGLPSAIHVKRISKDPSDRILCTEVGESVLTLKGPQGRINRAVWGPLNRTIISAG  170

Query  227  EDGYVRL  207
            ED  +R+
Sbjct  171  EDAVIRI  177



>ref|XP_011095354.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Sesamum indicum]
Length=326

 Score =   358 bits (918),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLN+TIIS GEDSV+RIWD+ETGKLLKESD+E GHKK 
Sbjct  134  QTGESVLILKGPQGRINRAVWGPLNRTIISAGEDSVIRIWDSETGKLLKESDKEDGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS DGSHF+TGSLDKSAKLWDIRTL L+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLSKSTDGSHFLTGSLDKSAKLWDIRTLKLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 82/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWSCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD++T T L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWDVKTGTPLYTFNFDSPARSVDFA-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I +       E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMGLPSAIHIKRIARDPEDQTGESVLILKGPQGRINRAVWGPLNRTIISAGEDSVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_006351166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum tuberosum]
Length=326

 Score =   357 bits (916),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  ESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWDAETGK+LKESD+E GHKKG
Sbjct  134  QISESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKILKESDKEIGHKKG  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS+DGSHFITGSLDKSAKLWDIRTLTL+K Y TERPVNAVTMSPLL+H+VLGGGQ
Sbjct  194  ITSLQKSVDGSHFITGSLDKSAKLWDIRTLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDQDYFNIKI  326


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++A LWD++T T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAMLWDVQTGTQLHTFTFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I       + E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGLTSAIHVKRISEDPSEQISESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010062244.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Eucalyptus grandis]
 gb|KCW69347.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=326

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKLL+ESD+E+GHKK 
Sbjct  134  QASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKLLRESDKETGHKKA  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL KS+DGSHF+TGS DKSAKLWDIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  VTSLMKSVDGSHFVTGSQDKSAKLWDIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVT TDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTMTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D +AKLW ++  T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFS-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  ++GH G I    + P  K+  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_007157442.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
 gb|AAK49947.1|AF335551_1 TGF-beta receptor-interacting protein 1 [Phaseolus vulgaris]
 gb|ESW29436.1| hypothetical protein PHAVU_002G070400g [Phaseolus vulgaris]
Length=326

 Score =   357 bits (915),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTG+SV+ +KG QGRINRA+WGPLN+TIIS GED+V+RIWD+ETGKL+KESD+ESGHKK 
Sbjct  134  QTGDSVVLIKGPQGRINRAIWGPLNRTIISAGEDAVIRIWDSETGKLIKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS DGSHF+TGSLDKSA+LWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  VTSLAKSADGSHFLTGSLDKSARLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ---EEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I     E+ G     +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIANDPTEQTGDSVVLIKGPQGRINRAIWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|KHN32457.1| Eukaryotic translation initiation factor 3 subunit I [Glycine 
soja]
Length=211

 Score =   352 bits (902),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKLL+ESD+ESGHKK 
Sbjct  19   QIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDSETGKLLQESDKESGHKKT  78

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS D SHF+TGSLDKSA+LWD R+LTL+KTYVTERPVNAVTMSPLLDH+V+GGGQ
Sbjct  79   VTSLAKSADDSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQ  138

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  139  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  198

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  199  LHHFDPDYFNIKI  211



>ref|XP_004250371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Solanum lycopersicum]
Length=326

 Score =   356 bits (913),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  ESVL +KG QGRINRAVWGPLNKTIIS GED+V+RIWDAETGK+LKESD+E GHKKG
Sbjct  134  QMSESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDAETGKVLKESDKEIGHKKG  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS+DGSHFITGSLDKSAKLWDIR+LTL+K Y TERPVNAVTMSPLL+H+VLGGGQ
Sbjct  194  ITSLQKSVDGSHFITGSLDKSAKLWDIRSLTLIKNYTTERPVNAVTMSPLLNHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+I+I
Sbjct  314  LHHFDQDYFNIRI  326


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++A LWD++T   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAMLWDVQTGAQLHTFTFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A     I       + E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGLTSAIHIKNISKDPSEQMSESVLVLKGPQGRINRAVWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_004492932.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   355 bits (912),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGES+L +KG QGRINRA+WGPLN+TIIS GEDSV+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL KS DGSHF+TGSLDKSAKLWD RTL+L+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  VTSLVKSADGSHFLTGSLDKSAKLWDARTLSLVKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW++++   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSGRLITGSADQTVKLWNVQSGQQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELTSAIHVKRIAKDPADQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|EYU22708.1| hypothetical protein MIMGU_mgv1a009949mg [Erythranthe guttata]
Length=326

 Score =   355 bits (912),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLNKTIIS GEDSV+RIWD+ETGKLLKESD+E GHKK 
Sbjct  134  QTGESVLVLKGPQGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKLLKESDKEDGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+K+ DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLSKATDGSHFLTGSLDKSAKLWDSRTLTLMKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DASSVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDQDYFNIKI  326


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTLWFADNGERLG---TYRGHNGAVWSCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AK+WD++T T L T+  + P  +V  +       +G   D   V 
Sbjct  61   SRDSTTLITGSADQTAKIWDVKTGTPLFTFNFDSPARSVDFA-------VG---DKLVVI  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G       K  A   D    E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGLSSAIHIKHVAADPDDQTGESVLVLKGPQGRINRAVWGPLNKTIISAGEDSVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_006448047.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 ref|XP_006492275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Citrus sinensis]
 gb|ESR61287.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|KDO58630.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=326

 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLKESD+E+GHKK 
Sbjct  134  QGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLKESDKETGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFA-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_003596914.1| Eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=321

 Score =   354 bits (909),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES+L +KG QGRINRA+WGPLNKTIIS GED+V+RIWD+ETGKLLKESD+E GHKK 
Sbjct  129  QTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRIWDSETGKLLKESDKELGHKKT  188

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS DGSHF TGSLDKSAK+WD RTL+L+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  189  ITSLAKSADGSHFCTGSLDKSAKIWDSRTLSLVKTYVTERPVNAVTMSPLLDHVVLGGGQ  248

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  249  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  308

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  309  LHHFDPDYFNIKI  321


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 77/180 (43%), Gaps = 20/180 (11%)
 Frame = -2

Query  725  MKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSI  546
            MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     S 
Sbjct  1    MKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDVSR  57

Query  545  DGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTT  366
            D    ITGS D++AKLW+++T   L T+  + P  +V  S       +G   D  AV TT
Sbjct  58   DSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFS-------VG---DKLAVITT  107

Query  365  DHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  207
            D       A    +I +       E +  +KG  G IN   + P  K+  S GED  +R+
Sbjct  108  DPFMELSSAIHVKRIAKDPSDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRI  167



>gb|AES67165.2| eukaryotic translation initiation factor 3 subunit I [Medicago 
truncatula]
Length=326

 Score =   354 bits (909),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES+L +KG QGRINRA+WGPLNKTIIS GED+V+RIWD+ETGKLLKESD+E GHKK 
Sbjct  134  QTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVIRIWDSETGKLLKESDKELGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS DGSHF TGSLDKSAK+WD RTL+L+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLAKSADGSHFCTGSLDKSAKIWDSRTLSLVKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSGRLITGSADQTAKLWNVQTGQQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMELSSAIHVKRIAKDPSDQTAESLLVIKGPQGRINRAIWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|KJB26172.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=326

 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL K+ DGSHF++GSLDKSAKLWD RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLTKAADGSHFLSGSLDKSAKLWDTRTLTLIKTYSTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW+++  T L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFA-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I        +E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|KHG16392.1| Eukaryotic translation initiation factor 3 subunit I -like protein 
[Gossypium arboreum]
Length=326

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL K+ DGSHF++GSLDKSAKLWD RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLTKAADGSHFLSGSLDKSAKLWDTRTLTLIKTYSTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++ KLW+++  T L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSVEFA-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I        +E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIAGDPTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010557463.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKESD+E+GHKK 
Sbjct  134  QVAESVLVLKGVQGRINRAVWGPLNRTIISAGEDAVVRIWDSETGKLLKESDKEAGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL K+ D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLCKAADSSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDK+L EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKLLLEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYFHIK+
Sbjct  314  LHHFDQDYFHIKV  326


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNKDGDLLFSCAKDHTPTVWYADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++ KLWD++T   L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTVKLWDVQTGKPLYTFNFGSPARSVDFA-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I       + E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMDLSSAIHVKRIARDPEDQVAESVLVLKGVQGRINRAVWGPLNRTIISAGEDAVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_002285281.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Vitis vinifera]
 emb|CAN80198.1| hypothetical protein VITISV_030908 [Vitis vinifera]
 emb|CBI26753.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L +KG QGRINRA+WGPLN+TIIS GED+++RIWD+ETGKLLKESD+E+GHKK 
Sbjct  134  QTAESALVIKGPQGRINRAIWGPLNRTIISAGEDAIVRIWDSETGKLLKESDKETGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL+K++DGSHF+TGSLDKSAKLWD RTLTL+KTY+TERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  VTSLSKAVDGSHFVTGSLDKSAKLWDSRTLTLIKTYLTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASHVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF++KI
Sbjct  314  LHHFDPDYFNVKI  326


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW++ T   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVETGAQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E    +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELTSAIHVKRIARDPSQQTAESALVIKGPQGRINRAIWGPLNRTIISAGEDAIV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_008340535.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D E GHKK 
Sbjct  134  QVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS+DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQ
Sbjct  194  ITSLAKSVDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASMVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T   L T+  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL---QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I    ++++G     +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMDVTSAIHVKRIASDPEDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_008389128.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=326

 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D E GHKK 
Sbjct  134  QIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQ
Sbjct  194  ITSLAKSXDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASTVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYFHIKI
Sbjct  314  LHHFDSDYFHIKI  326


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T   L T+  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL---QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I    +++IG     +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMDVTSAIHVKRIAGDPEDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|ABK94219.1| unknown [Populus trichocarpa]
Length=326

 Score =   352 bits (904),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GESVLT+ G  GRINRAVWG LNKTIIS GEDSV+RIWD+ETGKLLKESD E GHKK 
Sbjct  134  QSGESVLTITGPTGRINRAVWGSLNKTIISAGEDSVVRIWDSETGKLLKESDPEVGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTY TERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYATERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 73/182 (40%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    IT S D+S KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMLLITASADQSVKLWNVQTGAQLFTFNFNSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A     I +       E +  + G  G IN   +    K+  S GED  V
Sbjct  111  TTDPFMGVTSAINVKSIAEDPSQQSGESVLTITGPTGRINRAVWGSLNKTIISAGEDSVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|KJB56100.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=326

 Score =   352 bits (904),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK 
Sbjct  134  QTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKLLREADKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGG-------VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I ++           +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_009351622.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pyrus x bretschneideri]
Length=326

 Score =   352 bits (904),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D E GHKK 
Sbjct  134  QVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS+DG+HF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQ
Sbjct  194  ITSLAKSVDGTHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASMVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T   L T+  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL---QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I    ++++G     +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMDVTSAIHVKRIASDPEDQVGESALILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_003534423.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
Length=326

 Score =   352 bits (902),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GES+L +KG  GRINRA+WGPLN TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QSGESLLLIKGPLGRINRAIWGPLNSTIISAGEDAVIRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS DGSHF+TGSLDKSA+LWD R+LTL+KTYVTERPVNAVTMSPLLDH+V+GGGQ
Sbjct  194  VTSLAKSADGSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLWD+++   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSVRLITGSADQTAKLWDVQSGLQLYTFNFDSPARSVDFS-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I         E +  +KG  G IN   + P   +  S GED  +
Sbjct  111  TTDPFMELSSAIHVKRIADDPTEQSGESLLLIKGPLGRINRAIWGPLNSTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_006591952.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Glycine max]
 gb|ACU23631.1| unknown [Glycine max]
Length=326

 Score =   352 bits (902),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRA+WGPLN TIIS GED+V+RIWD+ETGKLL+ESD+ESGHKK 
Sbjct  134  QIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVIRIWDSETGKLLQESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS D SHF+TGSLDKSA+LWD R+LTL+KTYVTERPVNAVTMSPLLDH+V+GGGQ
Sbjct  194  VTSLAKSADDSHFLTGSLDKSARLWDTRSLTLIKTYVTERPVNAVTMSPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD+++   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWDVQSGLQLYTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I       + E +  +KG  G IN   + P   +  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIANDPSQQIGESVLLIKGPQGRINRAIWGPLNTTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_011021700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GES+LT+ G  GRINRAVWGPLNKTIIS GEDSV+RIWD+ETGKLLKESD E GHKK 
Sbjct  134  QSGESMLTITGPTGRINRAVWGPLNKTIISAGEDSVIRIWDSETGKLLKESDPEVGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWD R LTL+KTY TERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLTKSADGSHFLTGSLDKSAKLWDTRNLTLIKTYATERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGESFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 73/182 (40%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    IT S D+S KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMLLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFS-------VG---DKFAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A     I         E +  + G  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGVTSAINVKNIADDPSQQSGESMLTITGPTGRINRAVWGPLNKTIISAGEDSVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_004489218.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Cicer arietinum]
Length=326

 Score =   351 bits (901),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGES+L +KG QGRINRA+WGPLN+TIIS GEDSV+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVVRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS DGSHF+TGSLDKS+KLWD RTL+L+KTYVTERPVNAV MSPLL+H+VLGGGQ
Sbjct  194  ITSLAKSADGSHFLTGSLDKSSKLWDARTLSLVKTYVTERPVNAVAMSPLLNHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            +HHFD +Y++IKI
Sbjct  314  VHHFDQEYYNIKI  326


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLWD+++   L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSGRLITGSADQTAKLWDVQSGQQLFTFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELTSAIHVKRIAKDPKDQTGESLLVIKGPQGRINRAIWGPLNRTIISAGEDSVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|EYU22777.1| hypothetical protein MIMGU_mgv1a009964mg [Erythranthe guttata]
Length=326

 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGES+L +KG QGRINRAVWGPLNKTIIS GEDS++R+WD+ETGKLLKESD+E GHKK 
Sbjct  134  QTGESILVLKGPQGRINRAVWGPLNKTIISAGEDSIIRVWDSETGKLLKESDKEDGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+K+ D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLSKATDVSHFLTGSLDKSAKLWDSRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DASSVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDQDYFNIKI  326


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWSCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AK+WD++T T L T+  + P  +V  +       +G   D   V 
Sbjct  61   SRDSSTLITGSADQTAKIWDVKTGTPLFTFNFDSPARSVDFA-------VG---DKLVVI  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G       K  A   D    E I  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGLSSAIHIKPVAADPDDQTGESILVLKGPQGRINRAVWGPLNKTIISAGEDSII  170

Query  212  RL  207
            R+
Sbjct  171  RV  172



>gb|EPS73291.1| hypothetical protein M569_01462 [Genlisea aurea]
Length=326

 Score =   350 bits (897),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVL +KG QGRINRAVWGPLN+TI+S GED+V+R WDAETGKLL+E+D+E  HKK 
Sbjct  134  QTGESVLVLKGPQGRINRAVWGPLNRTIVSAGEDAVIRRWDAETGKLLQETDKEESHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLSKSTDGSHFLTGSLDKSAKLWDTRTLKLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 77/181 (43%), Gaps = 20/181 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D     W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTAWFADNGERLG---TYRGHNGAVWSCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW+++T T L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSGRLITGSADQTAKLWNVKTGTPLYTFNFDSPARSVDFA-------IG---DNLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I         E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHIKRISGDPADQTGESVLVLKGPQGRINRAVWGPLNRTIVSAGEDAVI  170

Query  212  R  210
            R
Sbjct  171  R  171



>ref|XP_002311556.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEE88923.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=326

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GESVLT+ G  GRINRAVWGPLN+TIIS GED V+RIWD+ETGKLLKES+ E GHKK 
Sbjct  134  QSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKLLKESEPEVGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL KS DGSHF+TGSLDKSAKLWD RTLTL+K Y TERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ISSLTKSADGSHFLTGSLDKSAKLWDSRTLTLIKNYTTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASSVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 74/182 (41%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    IT S D+S KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I         E +  + G  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMGVTSAINVKRIADDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010926275.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
 ref|XP_010926276.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   348 bits (892),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ESVLT+KG QGRINRAVWGPLNKTIISGGED+V+RIWDAETG+LLKESD+E+GH+K 
Sbjct  134  QTSESVLTIKGPQGRINRAVWGPLNKTIISGGEDAVVRIWDAETGQLLKESDKETGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  ITSLSKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNACAISPLLDHVVMGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVR
Sbjct  254  EASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  314  LHHFDPDYFNIKM  326


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D+S KLW ++T   L ++  + P  AV  S       +G   D  A+ 
Sbjct  61   SRDSGLLITGSADQSVKLWSVQTGAQLYSFNFDSPAKAVDFS-------IG---DKLAII  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G       K  A+   +   E +  +KG  G IN   + P  K+  SGGED  V
Sbjct  111  TTDPFMGLPSTIQVKRIARDPSEQTSESVLTIKGPQGRINRAVWGPLNKTIISGGEDAVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|EPS65969.1| hypothetical protein M569_08807 [Genlisea aurea]
Length=326

 Score =   347 bits (891),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGES+LT+KG QGRINRA+WGPLN+TI+S GED+V+RIWD ETGKLLK+SD+E  HKK 
Sbjct  134  QTGESLLTLKGPQGRINRAIWGPLNRTIVSAGEDAVIRIWDTETGKLLKQSDKEESHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS DGSHF+TGSLDKSAKLWD RT+ L+KTYVTERPVNAV +SPLLDH+VLGGGQ
Sbjct  194  ITSLSKSTDGSHFLTGSLDKSAKLWDTRTIKLIKTYVTERPVNAVAISPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILTEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF IKI
Sbjct  314  LHHFDPDYFSIKI  326


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 79/175 (45%), Gaps = 6/175 (3%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWSCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLWD++T   L T+  + P  +V  + + D  V+        ++
Sbjct  61   SRDSKRLITGSADQTAKLWDVKTGKPLYTFEFDSPARSVDFA-VGDKFVVITTDTFMELS  119

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  207
            +  H   K  A   D+   E +  +KG  G IN   + P  ++  S GED  +R+
Sbjct  120  SAIHI--KRIASDPDEQTGESLLTLKGPQGRINRAIWGPLNRTIVSAGEDAVIRI  172



>ref|XP_011024978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Populus euphratica]
Length=326

 Score =   347 bits (891),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GESVLT+ G  GRINRAVWGPLN+TIIS GED V+RIWD+ETGKLLKES+ E GHKK 
Sbjct  134  QSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVVRIWDSETGKLLKESEPEVGHKKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL KS DGSHF+TGSLDKSAKLWD RTLTL+K Y TERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ISSLTKSADGSHFLTGSLDKSAKLWDSRTLTLIKNYTTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASSVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 73/182 (40%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    IT S D+S KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMQLITASADQSVKLWNVQTGAQLYTFSFNSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I         E +  + G  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMEVTSAINVKRIADDPSQQSGESVLTITGPAGRINRAVWGPLNRTIISAGEDCVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010521568.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Tarenaya hassleriana]
Length=326

 Score =   347 bits (890),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  +SVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWDAETGKLL ESD+E GHKK 
Sbjct  134  QVADSVLVLKGVQGRINRAVWGPLNRTIISAGEDAVIRIWDAETGKLLNESDKEVGHKKA  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL K+ D SHF+TGSLDKSAKLWD RTLTL+KTY TERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLCKAADSSHFLTGSLDKSAKLWDTRTLTLIKTYGTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDKIL EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKILLEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF IKI
Sbjct  314  LHHFDQDYFSIKI  326


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 75/177 (42%), Gaps = 10/177 (6%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNKDGDLLFSCAKDHTPTVWYADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMS--PLLDHIVLGGGQDASA  378
            S D +  ITGS D++ KLW+++T   L T+    P  +V  S    L  I      D S+
Sbjct  61   SRDSARLITGSADQTVKLWEVQTGKQLYTFNFGSPARSVDFSVGDKLAVITTDPFMDLSS  120

Query  377  VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  207
                 H A   E +  D +L      +KG  G IN   + P  ++  S GED  +R+
Sbjct  121  AIHVKHIARDPEDQVADSVLV-----LKGVQGRINRAVWGPLNRTIISAGEDAVIRI  172



>ref|XP_008350825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Malus domestica]
Length=328

 Score =   347 bits (889),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/195 (86%), Positives = 179/195 (92%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GES L +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D E GHKK 
Sbjct  134  QIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDPEVGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPL DH+VLGGGQ
Sbjct  194  ITSLAKSXDGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLCDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKS--FASGGEDGY  216
            DAS VTTTDHR+GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK   F+SGGEDGY
Sbjct  254  DASTVTTTDHRSGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKKVYFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYFHIKI
Sbjct  314  VRLHHFDSDYFHIKI  328


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 81/182 (45%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T   L T+  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSARLITGSADQTAKLWNVQTGQQLFTFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL---QEEIGG----VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I    +++IG     +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMDVTSAIHVKRIAGDPEDQIGESALILKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010111947.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
 gb|EXC32128.1| Eukaryotic translation initiation factor 3 subunit I [Morus notabilis]
Length=429

 Score =   349 bits (896),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ESVL +KG QGRINRAVWGPLN+TIISGGED+++RIWD+ETGKLL ESD+E  HKK 
Sbjct  237  QTSESVLVIKGPQGRINRAVWGPLNQTIISGGEDTIIRIWDSETGKLLNESDKEVSHKKN  296

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAKS+DGSHF+TGS DKSAKLWD RTLTL+KTY TERPVNAV MSPLLDH+VLGGGQ
Sbjct  297  ITSLAKSVDGSHFLTGSHDKSAKLWDTRTLTLIKTYTTERPVNAVAMSPLLDHVVLGGGQ  356

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS+VTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  357  DASSVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  416

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  417  LHHFDPDYFNIKI  429


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  107  ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWSCDV  163

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D+SAKLWD+RT   L T+  + P  +V  S       +G   D  AV 
Sbjct  164  SRDSIRLITGSADQSAKLWDVRTGHQLHTFNFDSPARSVDFS-------VG---DKLAVI  213

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I         E +  +KG  G IN   + P  ++  SGGED  +
Sbjct  214  TTDPFMGHTSAIHVKRIADDPDDQTSESVLVIKGPQGRINRAVWGPLNQTIISGGEDTII  273

Query  212  RL  207
            R+
Sbjct  274  RI  275



>emb|CDP11515.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   340 bits (873),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 171/193 (89%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GES+L +KG QGRINRAVWGPLNKTIISGGEDSV+RIWD+ETGKLLKESD+E+GHKKG
Sbjct  19   QSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKLLKESDKEAGHKKG  78

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS D +HFI+GSLDKSAKLWD+RTLTLLKTY TERPVNAV MSPLLDH+VLGGGQ
Sbjct  79   ITSLSKSNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQ  138

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDGKSFA GGEDGYVR
Sbjct  139  DASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFARGGEDGYVR  198

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  199  LHHFDPDYFNIKI  211



>ref|XP_010937470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Elaeis guineensis]
Length=326

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVLT+KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K 
Sbjct  134  QTGESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQLLKESDKETGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNA  +SPLLDH+VLGGGQ
Sbjct  194  VTSLLKSADGSHFLTGSLDKSAKLWDSRTLTLIKTYVTERPVNACAISPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  314  LHHFDPDYFNIKM  326


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLGTY---RGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++ KLWD++T   L ++  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTVKLWDVQTGVQLYSFNFDSPARAVDFS-------VG---DKFAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G        +I++       E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGLPSTIQVKRIVRDPSQQTGESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>emb|CDP20306.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   342 bits (876),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GES+L +KG QGRINRAVWGPLNKTIISGGEDSV+RIWD+ETGKLLKESD+E+GHKKG
Sbjct  134  QSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKLLKESDKEAGHKKG  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS D +HFI+GSLDKSAKLWD+RTLTLLKTY TERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLSKSNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR
Sbjct  254  DASAVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  314  LHHFDPDYFNIKI  326


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D     W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTGWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  +TGS D++AKLW+++T T L T+  + P  +V            G  D  AV 
Sbjct  61   SRDSSLLLTGSADQTAKLWNVKTGTQLYTFNFDSPTRSVDF----------GVGDKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G   A    +I +       E I  +KG  G IN   + P  K+  SGGED  +
Sbjct  111  TTDPFMGLPSAIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_008782131.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Phoenix dactylifera]
Length=326

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ESVLT+KG QGRINRAVWGPLNKTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K 
Sbjct  134  QTSESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVVRIWDSETGQLLKESDKETGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL+KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  VTSLSKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNACAISPLLDHVVMGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  EASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD +YF+IK+
Sbjct  314  LHHFDPEYFNIKM  326


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D+S KLW+++T   L T+    P  AV  S       +G   D  AV 
Sbjct  61   SHDSGLLITGSADQSVKLWNVQTGAQLYTFNFGSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G       K  A+   +   E +  +KG  G IN   + P  K+  S GED  V
Sbjct  111  TTDPFMGLPSTIQVKQIARDPSEQTSESVLTIKGPQGRINRAVWGPLNKTIISAGEDAVV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010249002.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Nelumbo nucifera]
Length=326

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVLT+KG QGRINRA+WGPLN+TIIS GED+V R+WD ETGKL+ ESD+ESGH+K 
Sbjct  134  QTGESVLTIKGPQGRINRAIWGPLNRTIISAGEDAVTRVWDTETGKLINESDKESGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+V+GGGQ
Sbjct  194  VTSLAKSADWSHFLTGSLDKSAKLWDTRTLTLVKTYVTERPVNAVAMSPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  EASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  314  LHHFDPDYFNIKM  326


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T T L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFGSPTRSVDFS-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED   
Sbjct  111  TTDPFMELTSAIHVKRIARDPSDQTGESVLTIKGPQGRINRAIWGPLNRTIISAGEDAVT  170

Query  212  RL  207
            R+
Sbjct  171  RV  172



>ref|XP_006854979.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
 gb|ERN16446.1| hypothetical protein AMTR_s00052p00194740 [Amborella trichopoda]
Length=238

 Score =   335 bits (859),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +TGESVL ++G QGRINRAVWGPLN+TIISGGED+V+R+WD+ETGKLLKE+D+E GH+K 
Sbjct  46   KTGESVLVIRGPQGRINRAVWGPLNRTIISGGEDAVIRMWDSETGKLLKETDKEIGHQKT  105

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS DGSHF+TGSLDKSAKLWD+RTLTL+KTYVTERPVNA  +SPL DH+V+GGGQ
Sbjct  106  ITSLSKSSDGSHFLTGSLDKSAKLWDVRTLTLIKTYVTERPVNACAISPLHDHVVIGGGQ  165

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ +IL+EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  166  EASHVTTTDRRAGKFEAKFFHQILEEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  225

Query  209  LHHFDADYFHIKI  171
            LHHFDADYF+IK+
Sbjct  226  LHHFDADYFNIKM  238



>ref|XP_009129412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brassica rapa]
Length=328

 Score =   338 bits (867),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 178/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL ++   GR  INRAVWGPLN+TI+SGGED+VLRIWDAETGKLLKESD E GHK
Sbjct  134  QVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETGKLLKESDSEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
              ITSL KS D SHFITGSLDK+AKLWD+RTLTLLKTYV+  PVNAV+MSPLLDH+VLGG
Sbjct  194  NTITSLTKSADDSHFITGSLDKTAKLWDMRTLTLLKTYVSGVPVNAVSMSPLLDHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+I+I
Sbjct  314  VRLHHFDSDYFNIRI  328


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 75/184 (41%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+         GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGE---RHGTFRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D+SAKLWD++T   L ++    P  +V  +       LG   D  AV 
Sbjct  61   SRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFA-------LG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    V         P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VLRI  174



>ref|XP_008808070.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Phoenix dactylifera]
Length=254

 Score =   335 bits (859),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVLT+KG  GRINRAVWGPLNKTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K 
Sbjct  62   QTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQLLKESDKETGHQKP  121

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS  GSHF++GSLDKSAKLWD RTLTL+K YVTERPVNA  +SPLLDH+V+GGGQ
Sbjct  122  ITSLSKSAKGSHFLSGSLDKSAKLWDARTLTLIKAYVTERPVNACAISPLLDHVVIGGGQ  181

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF SGGEDGYVR
Sbjct  182  DASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFTSGGEDGYVR  241

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  242  LHHFDPDYFNIKM  254



>ref|XP_008808069.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Phoenix dactylifera]
Length=326

 Score =   337 bits (863),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTGESVLT+KG  GRINRAVWGPLNKTIIS GED+V+RIWD+ETG+LLKESD+E+GH+K 
Sbjct  134  QTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVIRIWDSETGQLLKESDKETGHQKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS  GSHF++GSLDKSAKLWD RTLTL+K YVTERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  ITSLSKSAKGSHFLSGSLDKSAKLWDARTLTLIKAYVTERPVNACAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF SGGEDGYVR
Sbjct  254  DASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFTSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  314  LHHFDPDYFNIKM  326


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERL---GTYKGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D+S KLW+++T   L ++  + P  AV  S       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQSVKLWNVQTGVQLYSFNFDSPARAVDFS-------VG---DKLAVI  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G       K  A+   +   E +  +KG  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMGLPSTIQVKRIARDPSQQTGESVLTIKGPHGRINRAVWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|ABR18068.1| unknown [Picea sitchensis]
Length=326

 Score =   337 bits (863),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ +S+LT+ G +GRINRAVWGPLN+TIISGGED+V+RIWD+ETGKLL+ES++E+GH+K 
Sbjct  134  QSADSILTITGIKGRINRAVWGPLNRTIISGGEDAVVRIWDSETGKLLRESEKETGHQKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ
Sbjct  194  ITSLFKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVR
Sbjct  254  EASHVTTTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYFHIK+
Sbjct  314  LHHFDNDYFHIKM  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 75/185 (41%), Gaps = 26/185 (14%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W    G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYGHNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  IT S D++ KLW++ T T L ++  E P  AV ++            D   V 
Sbjct  61   SRDSTRLITSSADQTVKLWNVETGTQLFSFNFESPARAVDLAE----------GDKLVVI  110

Query  371  TTD---HRAGKFEAKFYDKILQEE-------IGGVKGHFGPINALAFNPDGKSFASGGED  222
            TTD           K  +K L ++       I G+KG    IN   + P  ++  SGGED
Sbjct  111  TTDPFMELPSAIHIKRIEKDLSKQSADSILTITGIKGR---INRAVWGPLNRTIISGGED  167

Query  221  GYVRL  207
              VR+
Sbjct  168  AVVRI  172



>ref|XP_010275011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Nelumbo nucifera]
Length=326

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+GESVLT++G QGRINRA+WGPLN+TIIS GED+V+R+WD ETGKL+ ESD+ESGH+K 
Sbjct  134  QSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVIRVWDTETGKLINESDKESGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSLAKS D S+F+TGSLDKSAKLWD RTLTL+K YVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  VTSLAKSADWSNFLTGSLDKSAKLWDARTLTLIKAYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  EASHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  314  LHHFDPDYFNIKM  326


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW+++T T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWNVQTGTQLYTFNFDSPTRSVDFS-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  ++G  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIARDPSDQSGESVLTIRGPQGRINRAIWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RV  172



>gb|ABK26793.1| unknown [Picea sitchensis]
Length=326

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ +S+LT+ G +GRINRAVWGPLN+TIISGGED+V+RIWD+ETGKLL+ES++E+GH+K 
Sbjct  134  QSADSILTITGIKGRINRAVWGPLNRTIISGGEDAVVRIWDSETGKLLRESEKETGHQKP  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWDIRTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ
Sbjct  194  ITSLFKSADGSHFLTGSLDKSAKLWDIRTLTLIKTYVTERPVNAVAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTTD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG+SFASGGEDGYVR
Sbjct  254  EASHVTTTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDGRSFASGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD++YFHIK+
Sbjct  314  LHHFDSEYFHIKM  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 75/185 (41%), Gaps = 26/185 (14%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W    G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYGHNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  IT S D++ KLW++ T T L ++  E P  AV ++            D   V 
Sbjct  61   SRDSTRLITSSADQTVKLWNVETGTQLFSFNFESPARAVDLAE----------GDKLVVI  110

Query  371  TTD---HRAGKFEAKFYDKILQEE-------IGGVKGHFGPINALAFNPDGKSFASGGED  222
            TTD           K  +K L ++       I G+KG    IN   + P  ++  SGGED
Sbjct  111  TTDPFMELPSAIHIKRIEKDLSKQSADSILTITGIKGR---INRAVWGPLNRTIISGGED  167

Query  221  GYVRL  207
              VR+
Sbjct  168  AVVRI  172



>ref|XP_009389562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389563.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I {ECO:0000255|HAMAP-Rule:MF_03008}-like [Musa acuminata subsp. 
malaccensis]
Length=326

 Score =   335 bits (859),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ ESVLT+KG QGRINRA+WGPLNKTIIS GED+V+R+WD ETG+LLKESD+E+GH+K 
Sbjct  134  QSSESVLTIKGPQGRINRAIWGPLNKTIISAGEDAVVRVWDTETGQLLKESDKETGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL+KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  VTSLSKSADGSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNACAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTTD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  EAVHVTTTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF IK+
Sbjct  314  LHHFDPDYFTIKM  326


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D+S KLW+++T   L ++  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQSVKLWNVQTGAQLYSFNFDSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G       K  A+  ++   E +  +KG  G IN   + P  K+  S GED  V
Sbjct  111  TTDPFMGLPSTIQVKRIARDPNEQSSESVLTIKGPQGRINRAIWGPLNKTIISAGEDAVV  170

Query  212  RL  207
            R+
Sbjct  171  RV  172



>ref|XP_009151956.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151957.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
 ref|XP_009151959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Brassica rapa]
Length=328

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q GESVL ++  +GR  INRAVWGPLN+TI+SGGED+VLRIWDAETGKLLKE+D+E GHK
Sbjct  134  QDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETGKLLKETDKEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            + ITSL KS D SHF+TGSLDK+AKLWD+RTLTL+KTY +  PVNAV+MSPLLDH+V+GG
Sbjct  194  QTITSLCKSADDSHFLTGSLDKTAKLWDMRTLTLIKTYTSGVPVNAVSMSPLLDHVVIGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAG FEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGNFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+         GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGE---RHGTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD++T T L ++    P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKTGTQLFSFKFSSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFG--PINALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I         E +  ++   G   IN   + P  ++  SGGED 
Sbjct  111  TTDPFMARTSAIHVKRIADDPQDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VLRI  174



>gb|KJB56101.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=272

 Score =   332 bits (850),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 2/193 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QTG  + T   + G   RAVWGPLN+TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK 
Sbjct  82   QTGAQLYTF--NFGSPARAVWGPLNRTIVSAGEDAVIRIWDSETGKLLREADKESGHKKT  139

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  140  ITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  199

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  200  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  259

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IKI
Sbjct  260  LHHFDPDYFNIKI  272


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 74/175 (42%), Gaps = 15/175 (9%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW+++T   L T+    P  AV   P L+  ++  G+DA  + 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARAV-WGP-LNRTIVSAGEDA-VIR  117

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  207
              D   GK         L  E     GH   I +L  + DG  F +G  D   +L
Sbjct  118  IWDSETGK---------LLREADKESGHKKTITSLTKSADGSHFLTGSLDKSAKL  163



>gb|KFK37423.1| hypothetical protein AALP_AA4G255300 [Arabis alpina]
Length=328

 Score =   333 bits (855),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 181/195 (93%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWDAETGKLLKES++E GHK
Sbjct  134  QVADSVLVLQSPEGRMRINRAVWGPLNQTIVSGGEDAVIRIWDAETGKLLKESNEEDGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL+KS D SHFITGSLDK+AKLWD+RTLTL+KTY +  PVNAV++SPLLDH+V+GG
Sbjct  194  KPITSLSKSADDSHFITGSLDKTAKLWDMRTLTLIKTYTSNVPVNAVSISPLLDHVVIGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+I+I
Sbjct  314  VRLHHFDSDYFNIRI  328



>emb|CDY34145.1| BnaA02g28950D [Brassica napus]
Length=330

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 178/197 (90%), Gaps = 4/197 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL ++   GR  INRAVWGPLN+TI+SGGED+VLRIWDAETGKLLKESD E GHK
Sbjct  134  QVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETGKLLKESDSEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAK--LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVL  402
              ITSL KS D SHFITGSLDK+AK  LWD+RTLTLLKTYV+  PVNAV+MSPLLDH+VL
Sbjct  194  NTITSLTKSADDSHFITGSLDKTAKACLWDMRTLTLLKTYVSGVPVNAVSMSPLLDHVVL  253

Query  401  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGED  222
            GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGED
Sbjct  254  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGED  313

Query  221  GYVRLHHFDADYFHIKI  171
            GYVRLHHFD+DYF+I+I
Sbjct  314  GYVRLHHFDSDYFNIRI  330


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 75/184 (41%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+         GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGE---RHGTFRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D+SAKLWD++T   L ++    P  +V  +       LG   D  AV 
Sbjct  61   SRDSLRLITGSADQSAKLWDVKTGQQLFSFKFGSPARSVDFA-------LG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    V         P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPEDQVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VLRI  174



>ref|XP_010514644.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Camelina sativa]
 ref|XP_010514645.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Camelina sativa]
Length=328

 Score =   332 bits (852),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/195 (83%), Positives = 178/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWD+ETGKLLKESD E GHK
Sbjct  134  QVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETGKLLKESDGEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSLAK+ D SHFITGSLDK+AKLWD+RTLTLLKTY T  PVNAVTMSPLL+H+VLGG
Sbjct  194  KPITSLAKAADDSHFITGSLDKTAKLWDMRTLTLLKTYSTVVPVNAVTMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHH D DYF+IKI
Sbjct  314  VRLHHLDPDYFNIKI  328


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  S + DH+         AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFS-VGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    V         P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>ref|XP_010502959.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=328

 Score =   332 bits (850),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 178/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWD+ETGKLLKESD E GHK
Sbjct  134  QVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETGKLLKESDGEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSLAK+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAVTMSPLL+H+VLGG
Sbjct  194  KPITSLAKAADDSHFITGSLDKTAKLWDMRTLTLIKTYSTVVPVNAVTMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHH D DYF+IKI
Sbjct  314  VRLHHLDPDYFNIKI  328


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  S + DH+         AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFS-VGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    V         P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>ref|XP_010425732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camelina sativa]
Length=356

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++  +GR  INRAVWGPLN+TI+SGGED+V+RIWD+ETGKLLKESD E GHK
Sbjct  162  QVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDSETGKLLKESDGEVGHK  221

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAVTMSPLL+H+VLGG
Sbjct  222  KPITSLCKAADDSHFITGSLDKTAKLWDMRTLTLIKTYSTVVPVNAVTMSPLLNHVVLGG  281

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGY
Sbjct  282  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGY  341

Query  215  VRLHHFDADYFHIKI  171
            VRLHH D+DYF+IKI
Sbjct  342  VRLHHLDSDYFNIKI  356


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  32   ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGERLG---TYRGHNGAVWCCDV  88

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  + + DH+         AV 
Sbjct  89   SRDSSRLITGSADQTAKLWDVQSGQELFTFKFGSPTRSVDFA-VGDHL---------AVI  138

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    V         P     IN   + P  ++  SGGED 
Sbjct  139  TTDPFMERTSAIHVKRIAEDPQDQVADSVLVLQSPEGRKRINRAVWGPLNQTIVSGGEDA  198

Query  218  YVRL  207
             +R+
Sbjct  199  VIRI  202



>ref|XP_006395439.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32725.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=328

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 177/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++   G  RINRAVWGPLN+TI+SGGED+V+R+WD ETGKL+KES++E GHK
Sbjct  134  QIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDAVIRVWDTETGKLIKESNEEEGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAV MSPLL+H+VLGG
Sbjct  194  KTITSLCKAADDSHFITGSLDKTAKLWDMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 77/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+         GH   + S   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGE---RHGTYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AK+W+++T   L ++    P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKIWEVKTGRQLFSFKFGSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    +         P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPEDQIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRV  174



>ref|XP_004297796.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   327 bits (837),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 176/196 (90%), Gaps = 3/196 (2%)
 Frame = -2

Query  749  QTGESVLTMK-GHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGH  579
            QT ES+LT+K   QGR  INRAVWGPLN+TIIS GED+++RIWD+ETGKLL+E+ +E GH
Sbjct  134  QTAESILTLKITPQGRMKINRAVWGPLNRTIISAGEDAIIRIWDSETGKLLQENQKEDGH  193

Query  578  KKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLG  399
             K ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTY TE PVNAV MSPLL+H+VLG
Sbjct  194  TKTITSLVKSPDGSHFLTGSLDKSAKLWDTRTLTLIKTYRTESPVNAVAMSPLLNHVVLG  253

Query  398  GGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDG  219
            GGQDA  VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDG
Sbjct  254  GGQDAINVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDG  313

Query  218  YVRLHHFDADYFHIKI  171
            Y+RLHHFD DYF+IKI
Sbjct  314  YIRLHHFDHDYFNIKI  329


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 78/187 (42%), Gaps = 27/187 (14%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPNVWFADNGERLGTY---RGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   + T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGHQVFTFNFDSPTRSVEFS-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGP-----INALAFNPDGKSFASGG  228
            TTD    +  A    +I         E I  +K    P     IN   + P  ++  S G
Sbjct  111  TTDPFMEQTSAIHVKRIAADPADQTAESILTLK--ITPQGRMKINRAVWGPLNRTIISAG  168

Query  227  EDGYVRL  207
            ED  +R+
Sbjct  169  EDAIIRI  175



>ref|XP_002315834.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
 gb|EEF02005.2| TGF-beta receptor-interacting protein 1 [Populus trichocarpa]
Length=328

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q+GESVLT+   G  GRINRAVWG LNKTIIS GEDS+    +  TGKLLKESD E GHK
Sbjct  134  QSGESVLTITITGPTGRINRAVWGSLNKTIISAGEDSMGFRGNWLTGKLLKESDPEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTY TERPVNAVTMSPLLDH+VLGG
Sbjct  194  KPITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYATERPVNAVTMSPLLDHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDAS+VTTTDHRAGKFEAKFYDK+LQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASSVTTTDHRAGKFEAKFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD DYF+IKI
Sbjct  314  VRLHHFDPDYFNIKI  328



>emb|CDY03970.1| BnaC02g36850D [Brassica napus]
Length=680

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 178/197 (90%), Gaps = 4/197 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL ++   GR  INRAVWGPLN+TI+SGGED+VLRIWDAETGKLLKESD E GHK
Sbjct  484  QVSESVLVLESPNGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETGKLLKESDAEVGHK  543

Query  575  KGITSLAKSIDGSHFITGSLDKSAK--LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVL  402
              ITSL KS D SHFITGSLDK+AK  LWD+RTLTLLKTYV+  PVNAV+MSPLLDH+VL
Sbjct  544  NTITSLTKSADDSHFITGSLDKTAKACLWDMRTLTLLKTYVSGVPVNAVSMSPLLDHVVL  603

Query  401  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGED  222
            GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGED
Sbjct  604  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGED  663

Query  221  GYVRLHHFDADYFHIKI  171
            GYVRLHHFD+DYF+I+I
Sbjct  664  GYVRLHHFDSDYFNIRI  680



>gb|ACF82853.1| unknown [Zea mays]
Length=211

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+LLKESD+ESGH+K 
Sbjct  19   QTEESALVITGIKGRINRAVWGPLNRTIITAGEDATVRIWDSETGQLLKESDKESGHQKT  78

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP  D +VLGGGQ
Sbjct  79   ISSLSKSLDWSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQ  138

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  139  DAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  198

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF IK+
Sbjct  199  LHHFDSDYFSIKM  211



>ref|NP_001061508.1| Os08g0308100 [Oryza sativa Japonica Group]
 gb|AAQ56413.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Japonica Group]
 gb|AAQ56424.1| TGF-beta receptor-interacting protein-like protein [Oryza sativa 
Japonica Group]
 dbj|BAC92643.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAC92579.1| putative TGF-beta receptor-interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF23422.1| Os08g0308100 [Oryza sativa Japonica Group]
 dbj|BAI39771.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
 dbj|BAI39984.1| putative TGF-beta receptor-interacting protein 1 [Oryza sativa 
Indica Group]
Length=326

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ LKESD+E GH+K 
Sbjct  134  QSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQCLKESDKEQGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ
Sbjct  194  ITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 79/185 (43%), Gaps = 26/185 (14%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + S   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTY---RGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD++T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFA-------IG---DGLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEE----------IGGVKGHFGPINALAFNPDGKSFASGGED  222
            TTD+           +I ++           I G+KG    IN   + P  ++  + GED
Sbjct  111  TTDNFMENVPTAQVKRIAEDPDDQSEESLLVITGIKGR---INRAVWGPLNRTIITAGED  167

Query  221  GYVRL  207
              +R+
Sbjct  168  ATIRI  172



>ref|XP_006663589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oryza brachyantha]
Length=310

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +R+WD ETGK LKESD+E GH+K 
Sbjct  118  QSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATVRLWDTETGKCLKESDKEQGHQKT  177

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ
Sbjct  178  ISSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQ  237

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  238  DAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  297

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  298  LHHFDSDYFNIKI  310


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 61/133 (46%), Gaps = 17/133 (13%)
 Frame = -2

Query  584  GHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIV  405
            GH   + S   S D +  ITGS D++AKLWD++T   L T+  + P  +V          
Sbjct  34   GHNGAVWSCDVSRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSV-------EFA  86

Query  404  LGGGQDASAVTTTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK  246
            +G   D  AV TTD+          K  A+  D   +E +  + G  G IN   + P  +
Sbjct  87   IG---DGLAVITTDNFMDNAPTAQVKRIAEDPDDQSEESLLVITGIKGRINRAVWGPLNR  143

Query  245  SFASGGEDGYVRL  207
            +  + GED  VRL
Sbjct  144  TIITAGEDATVRL  156



>emb|CDY13713.1| BnaA06g32100D [Brassica napus]
Length=344

 Score =   324 bits (830),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 180/211 (85%), Gaps = 18/211 (9%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q GESVL ++  +GR  INRAVWGPLN+TI+SGGED+VLRIWDAETGKLLKE+D+E GHK
Sbjct  134  QDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETGKLLKETDKEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAK----------------LWDIRTLTLLKTYVTERPV  444
            + ITSL KS D SHF+TGSLDK+AK                LWD+RTLTL+KTY +  PV
Sbjct  194  QTITSLCKSADDSHFLTGSLDKTAKACLPFLLYLLFHNPPVLWDMRTLTLIKTYTSGVPV  253

Query  443  NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  264
            NAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKFYDKILQEEIGGVKGHFGPINALA
Sbjct  254  NAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIGGVKGHFGPINALA  313

Query  263  FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            FNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  314  FNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  344


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 77/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+         GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDMLFSCAKDHTPTLWYADNGE---RHGTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD++T T L ++    P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKTGTQLFSFKFSSPARSVDFS-------VG---DKLAVI  110

Query  371  TTD---HRAGKFEAKFYDKILQEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTD    R      K      Q++ G  V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIADDPQDQDGESVLVLENPEGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VLRI  174



>emb|CDY71621.1| BnaAnng38210D [Brassica napus]
Length=344

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 180/211 (85%), Gaps = 18/211 (9%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL ++  +GR  INRAVWGPLN+TI+SGGED+VLRIWDAETGKLLKE+D+E GHK
Sbjct  134  QDGDSVLVLENPEGRKRINRAVWGPLNQTIVSGGEDAVLRIWDAETGKLLKETDKEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAK----------------LWDIRTLTLLKTYVTERPV  444
            + ITSL KS D SHF+TGSLDK+AK                LWD+RTLTL+KTY +  PV
Sbjct  194  QTITSLCKSADDSHFLTGSLDKTAKACLPRLSSLSIACFKVLWDMRTLTLIKTYTSGVPV  253

Query  443  NAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALA  264
            NAV+MSPLLDH+V+GGGQDASAVTTTDHRAG FEAKFYDKILQEEIGGVKGHFGPINALA
Sbjct  254  NAVSMSPLLDHVVIGGGQDASAVTTTDHRAGNFEAKFYDKILQEEIGGVKGHFGPINALA  313

Query  263  FNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            FNPDG+SF+SGGEDGYVRLHHFD+DYF+IKI
Sbjct  314  FNPDGRSFSSGGEDGYVRLHHFDSDYFNIKI  344


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 79/184 (43%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D +  +W A+ G+         GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDMLFSCAKDHIPTLWYADNGE---RHGTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD++T T L ++    P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKTETQLFSFKFSSPARSVDFS-------VG---DKLAVI  110

Query  371  TTD---HRAGKFEAKFYDKILQEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTD    R      K   +  Q++ G  V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPQDQDGDSVLVLENPEGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VLRI  174



>ref|XP_002882056.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58315.1| TGF-beta receptor interacting protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++   G  RINRAVWGPLN+TI+S GED+V+RIWD ETGKLL E+++E GHK
Sbjct  134  QVSDSVLVLQCPDGKKRINRAVWGPLNQTIVSAGEDTVIRIWDTETGKLLNETNEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T  PVNAV MSPLL+H+VLGG
Sbjct  194  KAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNKDGDLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  + L DH+         AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGSPTRSVDFA-LGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTDH   +  A    +I ++    V         P     IN   + P  ++  S GED 
Sbjct  111  TTDHFVDRMAAIHVKRIAEDPEDQVSDSVLVLQCPDGKKRINRAVWGPLNQTIVSAGEDT  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>gb|AAC62877.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   322 bits (825),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL ++   G+  INRAVWGPLN+TI+SGGED+ +RIWDAETGKLLK+SD+E GHK
Sbjct  134  QVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            + ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T  PVNAV MSPLL+H+VLGG
Sbjct  194  EAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYD ILQEEIGGVKGHFGPINALAF+PDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDTILQEEIGGVKGHFGPINALAFSPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD++YF+IKI
Sbjct  314  VRLHHFDSNYFNIKI  328


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLG---TYRGHSGAVWCCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  S + DH+         AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFS-VGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF---------GPINALAFNPDGKSFASGGEDG  219
            TTDH  G   A    +I ++    V               IN   + P  ++  SGGED 
Sbjct  111  TTDHFVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  AIRI  174



>dbj|BAC43524.1| putative eukaryotic translation initiation factor 3 delta subunit 
[Arabidopsis thaliana]
Length=355

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL ++   G+  INRAVWGPLN+TI+SGGED+ +RIWDAETGKLLK+SD+E GHK
Sbjct  161  QVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHK  220

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            + ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T  PVNAV MSPLL+H+VLGG
Sbjct  221  EAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGG  280

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYD ILQEEIGGVKGHFGPINALAF+PDGKSF+SGGEDGY
Sbjct  281  GQDASAVTTTDHRAGKFEAKFYDTILQEEIGGVKGHFGPINALAFSPDGKSFSSGGEDGY  340

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD++YF+IKI
Sbjct  341  VRLHHFDSNYFNIKI  355


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 82/184 (45%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  31   ILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLG---TYRGHSGAVWCCDI  87

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  S + DH+         AV 
Sbjct  88   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFS-VDDHL---------AVI  137

Query  371  TTDHRAGKFEAKFYDKIL---QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH  G   A    +I    ++++G  V     P     IN   + P  ++  SGGED 
Sbjct  138  TTDHFVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDA  197

Query  218  YVRL  207
             +R+
Sbjct  198  AIRI  201



>ref|NP_182152.2| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
 gb|AEC10672.1| transducin/WD40 repeat-like superfamily protein [Arabidopsis 
thaliana]
Length=355

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL ++   G+  INRAVWGPLN+TI+SGGED+ +RIWDAETGKLLK+SD+E GHK
Sbjct  161  QVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDAAIRIWDAETGKLLKQSDEEVGHK  220

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            + ITSL K+ D SHF+TGS DK+AKLWD+RTLTL+KTY T  PVNAV MSPLL+H+VLGG
Sbjct  221  EAITSLCKAADDSHFLTGSHDKTAKLWDMRTLTLIKTYTTVVPVNAVAMSPLLNHVVLGG  280

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYD ILQEEIGGVKGHFGPINALAF+PDGKSF+SGGEDGY
Sbjct  281  GQDASAVTTTDHRAGKFEAKFYDTILQEEIGGVKGHFGPINALAFSPDGKSFSSGGEDGY  340

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD++YF+IKI
Sbjct  341  VRLHHFDSNYFNIKI  355


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 82/184 (45%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  31   ILMKGHERPLTFLRYNRNGDLLFSCAKDHTPTVWFADNGERLG---TYRGHSGAVWCCDI  87

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  S + DH+         AV 
Sbjct  88   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFGAPARSVDFS-VGDHL---------AVI  137

Query  371  TTDHRAGKFEAKFYDKIL---QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH  G   A    +I    ++++G  V     P     IN   + P  ++  SGGED 
Sbjct  138  TTDHFVGTSSAIHVKRIAEDPEDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDA  197

Query  218  YVRL  207
             +R+
Sbjct  198  AIRI  201



>ref|XP_008670966.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 ref|XP_008670967.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Zea mays]
 tpg|DAA42586.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42587.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
 tpg|DAA42588.1| TPA: hypothetical protein ZEAMMB73_734722 [Zea mays]
Length=326

 Score =   322 bits (824),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+LLKESD+ESGH+K 
Sbjct  134  QTEESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDSETGQLLKESDKESGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP  D +VLGGGQ
Sbjct  194  ISSLSKSLDWSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF IK+
Sbjct  314  LHHFDSDYFSIKM  326


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + +   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW++ T   L ++  + P  +V  +       +G   DA AV 
Sbjct  61   SRDSARLITGSADQTAKLWEVSTGKELFSFRFDAPARSVEFA-------IG---DALAVV  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD+          K  A+  D   +E    + G  G IN   + P  ++  + GED  +
Sbjct  111  TTDNFMDHVPTVQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|NP_001147501.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 gb|ACG27749.1| eukaryotic translation initiation factor 3 subunit 2 [Zea mays]
 tpg|DAA59664.1| TPA: eukaryotic translation initiation factor 3 subunit 2 [Zea 
mays]
Length=326

 Score =   321 bits (823),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETG+LLKESD+ESGH+K 
Sbjct  134  QTEESALVITGIKGRINRAVWGPLNRTIITAGEDATVRIWDSETGQLLKESDKESGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP  D +VLGGGQ
Sbjct  194  ISSLSKSLDWSHFITGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF IK+
Sbjct  314  LHHFDSDYFSIKM  326


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + +   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD+ T   L ++  + P  +V  +       +G   DA AV 
Sbjct  61   SRDSARLITGSADQTAKLWDVSTGKELFSFRFDAPARSVEFA-------IG---DALAVV  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD+          K  A+  D   +E    + G  G IN   + P  ++  + GED  V
Sbjct  111  TTDNFMDHVPTVQVKRIAEDIDDQTEESALVITGIKGRINRAVWGPLNRTIITAGEDATV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|NP_001055036.1| Os05g0256000 [Oryza sativa Japonica Group]
 gb|AAV31388.1| putative TGF-beta receptor interacting protein [Oryza sativa 
Japonica Group]
 dbj|BAF16950.1| Os05g0256000 [Oryza sativa Japonica Group]
 dbj|BAG97027.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78857.1| hypothetical protein OsI_19205 [Oryza sativa Indica Group]
 gb|EEE63021.1| hypothetical protein OsJ_17829 [Oryza sativa Japonica Group]
Length=326

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG  L ESD+E GH+K 
Sbjct  134  QSEESLLVISGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGTCLNESDKEQGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SPLLDH+V+GGGQ
Sbjct  194  ITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IKI
Sbjct  314  LHHFDSDYFNIKI  326


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L      SGH   + S   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLG---TYSGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD++T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGAELFTFRFDAPARSVEFA-------IG---DGLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL-------QEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD+  G        +I        +E +  + G  G IN   + P  ++  + GED  +
Sbjct  111  TTDNFMGNVPTAQVKRIADDPDDQSEESLLVISGIKGRINRAVWGPLNRTIITAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_001758941.1| predicted protein [Physcomitrella patens]
 gb|EDQ76447.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ E VLT+ G QGRINR +WGPLNKTIIS GED+ +RIWDAETGK L ESD E+GH+K 
Sbjct  134  QSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKCLIESDPETGHQKV  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITS+AKS DGSHFITGS DKSAKLWDIRTLT+LKTY TERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  ITSMAKSADGSHFITGSQDKSAKLWDIRTLTVLKTYTTERPVNAAAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VT T  RAGKFEAKF+ KI +EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  EASQVTMTSTRAGKFEAKFFHKIFEEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            +H FDADY+HIK+
Sbjct  314  VHFFDADYYHIKV  326


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + S  +D    +W A  G+ L       GH   +     
Sbjct  4    ILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  +T S D++ KLWD  T  LL T+  + P  AV+ S            D   V 
Sbjct  61   SRDSTRLVTSSADQTVKLWDCETGVLLDTFYFDAPARAVSFSE----------GDKMVVI  110

Query  371  TTDHRAGKFEAKFY-----DKILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            +TD    K  A        D+ LQ  E++  + G  G IN + + P  K+  S GED  +
Sbjct  111  STDPFMEKQSAIHVKMINSDRSLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|AIZ68198.1| eukaryotic translation initiation factor 3 subunit I-like isoform 
X1 [Ornithogalum saundersiae]
Length=328

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 171/195 (88%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQ--GRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            QT +SVLT+KG Q  GRI  A+WGPLNKTIISGGED +LR WD ETG LL ESD+E+GH+
Sbjct  134  QTSDSVLTIKGPQLQGRITGAMWGPLNKTIISGGEDGILRTWDTETGSLLMESDKETGHQ  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL+KS DGSHF+T SLDKSAKLWD RTLTLLKTYVT  PVNA  +SPLLDH+V+GG
Sbjct  194  KRITSLSKSADGSHFLTSSLDKSAKLWDTRTLTLLKTYVTSAPVNACAISPLLDHVVMGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDA  VT TDHRAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SFASGGEDGY
Sbjct  254  GQDAVNVTMTDHRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFASGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD DYF+IKI
Sbjct  314  VRLHHFDPDYFNIKI  328


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 80/183 (44%), Gaps = 22/183 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   I S   
Sbjct  4    ILMKGHERPLTFLRYNREGDLLFSCAKDHNPTVWFADNGERLG---VYKGHNGAIWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++ KLW+++T   L ++  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTVKLWNVQTGAQLYSFDFDSPARSVQFS-------VG---DKLAVI  110

Query  371  TTDHRAG---KFEAKFYDKILQEE----IGGVKGH--FGPINALAFNPDGKSFASGGEDG  219
            TTD   G     + K   +   E+    +  +KG    G I    + P  K+  SGGEDG
Sbjct  111  TTDPFMGHPPTIQVKRISRDPSEQTSDSVLTIKGPQLQGRITGAMWGPLNKTIISGGEDG  170

Query  218  YVR  210
             +R
Sbjct  171  ILR  173



>ref|XP_004955547.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Setaria italica]
Length=326

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETGKLLKESD+ESGH+K 
Sbjct  134  QTDESALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGKLLKESDKESGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS D SHFITGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP  D +VLGGGQ
Sbjct  194  ISSLSKSADWSHFITGSLDKSAKLWDSRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD+DYF+IK+
Sbjct  314  LHHFDSDYFNIKM  326


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + S   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD+ T   L ++  + P  +V  +       +G   DA AV 
Sbjct  61   SRDSARLITGSADQTAKLWDVSTGRELFSFRFDAPARSVEFA-------IG---DALAVI  110

Query  371  TTDHRAG-------KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD+          K  A+  D    E    + G  G IN   + P  ++  + GED  +
Sbjct  111  TTDNFMDHVPTVQVKHIAEDLDDQTDESALVITGIKGRINRAVWGPLNRTIITAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_001757566.1| predicted protein [Physcomitrella patens]
 gb|EDQ77623.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ E VLT+ G QGRINRA+WGPLNKTIIS GED+ +RIWDAETGKLLKESD E+GH+K 
Sbjct  134  QSSEDVLTITGPQGRINRAMWGPLNKTIISAGEDATIRIWDAETGKLLKESDPETGHQKV  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            IT++AKS DGSHFITGS DKSAKLWDIRTL +LKTY TERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  ITAMAKSADGSHFITGSHDKSAKLWDIRTLQMLKTYTTERPVNAAAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VT T  RAGKFEAKF+ KI +EEIGGVKGHFGPINAL FNPDG+SF+SGGEDGYVR
Sbjct  254  EASQVTMTSTRAGKFEAKFFHKIFEEEIGGVKGHFGPINALVFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            +H FD+DY+HIK+
Sbjct  314  VHFFDSDYYHIKV  326


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (41%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + S  +D    +W A  G+ L       GH   +     
Sbjct  4    ILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERL---GTYKGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  +T S D++ KLWD  T   L ++  + P  AV+ +            D   V 
Sbjct  61   SRDSTRLVTSSADQTVKLWDCETGVQLHSFNFDAPARAVSFAE----------GDKMVVI  110

Query  371  TTD-----HRAGKFEAKFYDKILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A   +    D+ LQ  E++  + G  G IN   + P  K+  S GED  +
Sbjct  111  TTDPFMEQQSAIHVKRIESDRSLQSSEDVLTITGPQGRINRAMWGPLNKTIISAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_002461510.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
 gb|EER98031.1| hypothetical protein SORBIDRAFT_02g003760 [Sorghum bicolor]
Length=326

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT +S L + G +GRINRAVWGPLN+TII+ GED+ +RIWD+ETGKLLKESD+ESGH+K 
Sbjct  134  QTEDSALVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDSETGKLLKESDKESGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP  D +VLGGGQ
Sbjct  194  ITSLSKSLDWSHFVTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPTHDTVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKFY KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFYHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD++YF IK+
Sbjct  314  LHHFDSEYFSIKM  326


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 80/187 (43%), Gaps = 30/187 (16%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + +   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLW++ T   L ++  + P  +V  +       +G   DA AV 
Sbjct  61   SRDSARLITGSADQTAKLWEVSTGKELFSFRFDAPARSVEFA-------IG---DALAVV  110

Query  371  TTD------------HRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGG  228
            TTD            H A   + +  D  L   I G+KG    IN   + P  ++  + G
Sbjct  111  TTDNFMDHVPTVQVKHIAEDIDDQTEDSALV--ITGIKGR---INRAVWGPLNRTIITAG  165

Query  227  EDGYVRL  207
            ED  +R+
Sbjct  166  EDATIRI  172



>gb|EMS51995.1| Eukaryotic translation initiation factor 3 subunit I [Triticum 
urartu]
Length=341

 Score =   320 bits (821),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKLLKESD+E+GH+K 
Sbjct  100  QTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKLLKESDKEAGHQKA  159

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSP LD++V+GGGQ
Sbjct  160  ISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDMSPTLDNVVIGGGQ  219

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVR
Sbjct  220  DAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVR  279

Query  209  LHHFDADYFHIKI  171
            LHHFD +YF+IK+
Sbjct  280  LHHFDPEYFNIKM  292



>ref|XP_010508042.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=360

 Score =   321 bits (822),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 171/195 (88%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL +    G  RINRAVWGPLNKTI+S GED+V+RIWD ETG LLKESD+E GHK
Sbjct  166  QVDDSVLVINNPDGKKRINRAVWGPLNKTIVSAGEDAVIRIWDTETGTLLKESDEEVGHK  225

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLD +AKLWD+RTLTL+K+Y T  PVNAV MSPLL+H++LGG
Sbjct  226  KAITSLCKAADDSHFLTGSLDNTAKLWDMRTLTLIKSYTTVVPVNAVAMSPLLNHVMLGG  285

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAG FEAKFYD ILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  286  GQDASAVTTTDHRAGNFEAKFYDTILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  345

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD++YF+IKI
Sbjct  346  VRLHHFDSNYFNIKI  360


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 78/188 (41%), Gaps = 30/188 (16%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  36   ILLKGHERPLTCLRYNRDGDLLFSCAKDHNPTLWFADNGERLG---TYRGHNGAVWCCDV  92

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+       +V  S + DH+         AV 
Sbjct  93   SRDSSRLITGSADQTAKLWDVQSGEQLFTFKFGSTARSVEFS-VGDHL---------AVI  142

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG-------------KSFASG  231
            TTD    +  A    +I+++    V      IN    NPDG             K+  S 
Sbjct  143  TTDPFIERTSAIHVKRIVEDPQDQVDDSVLVIN----NPDGKKRINRAVWGPLNKTIVSA  198

Query  230  GEDGYVRL  207
            GED  +R+
Sbjct  199  GEDAVIRI  206



>ref|XP_002862549.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH38807.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=328

 Score =   319 bits (818),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL ++   G+  INRAVWGPLN+TI+SGGED+V+RIWD ETGKLLK+SD E GHK
Sbjct  134  QVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRIWDTETGKLLKQSDVEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            + ITSL K+ D SHF+TGS DK+AKLWD+R+LTL+K+Y T  PVNAV MSPLL+H+VLGG
Sbjct  194  EAITSLCKAADDSHFLTGSHDKTAKLWDMRSLTLIKSYTTVVPVNAVAMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYD IL+EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDTILEEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD++YF+IKI
Sbjct  314  VRLHHFDSNYFNIKI  328


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 81/184 (44%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A  G+ L       GH   ++    
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWLAHNGERLG---TYRGHNGAVSCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+       +V  S + DH+         AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKQLFTFNFGSSARSVDFS-VGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKIL---QEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH  G   A    +I    Q+++G  V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDHFMGVSSAIHVKRIAEDPQDQVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDT  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>ref|XP_001763986.1| predicted protein [Physcomitrella patens]
 gb|EDQ71125.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ E VLT+ G QGRINR +WGPLNKTIIS GED+ +RIWDAETGK LKESD E+GH+K 
Sbjct  134  QSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATIRIWDAETGKCLKESDPETGHQKV  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            IT+++KS DGSHFITGS DKSAKLWDIRTLT+LKTY TERPVNA  +SPLLDH+V+GGGQ
Sbjct  194  ITAMSKSADGSHFITGSHDKSAKLWDIRTLTVLKTYTTERPVNAAAISPLLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VT T  R GKFEAKF+ KI +EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  EASQVTMTSTRVGKFEAKFFHKIFEEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            +H FDADY+HIK+
Sbjct  314  VHFFDADYYHIKV  326


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + S  +D    +W A  G+ L       GH   +     
Sbjct  4    ILLKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYASNGERL---GTYKGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  +T S D++ KLW+  T  LL T+  + P  AV+ S            D   V 
Sbjct  61   SRDSTRLVTSSADQTVKLWECETGVLLHTFNFDAPARAVSFSE----------GDKMVVI  110

Query  371  TTDHRAGKFEAKFY-----DKILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            +TD    K  A        D+ LQ  E++  + G  G IN + + P  K+  S GED  +
Sbjct  111  STDPFMEKQSAIHVKRIESDRFLQSSEDVLTITGPQGRINRVMWGPLNKTIISAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_010506629.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Camelina sativa]
Length=361

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 172/195 (88%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL +    G  RINRAVWG LNKTI+S GED+V+RIWD ETG LLKESD+E GHK
Sbjct  167  QVGDSVLVINNPDGKKRINRAVWGLLNKTIVSAGEDAVIRIWDTETGTLLKESDEEVGHK  226

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLDK+AKLWD+RTLTL+K+Y T  PVNAV MSPLL+H++LGG
Sbjct  227  KAITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLIKSYTTVVPVNAVAMSPLLNHVMLGG  286

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYD IL+EEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  287  GQDASAVTTTDHRAGKFEAKFYDTILEEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  346

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD++YF IKI
Sbjct  347  VRLHHFDSNYFDIKI  361


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 76/188 (40%), Gaps = 30/188 (16%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + S  +D    +W  + G+ L       GH   +     
Sbjct  37   ILLKGHERPLTCLRYNRDGDLLFSCAKDHTPTLWFVDNGERLG---TYRGHNGAVWCCDV  93

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P   V  S + DH+         AV 
Sbjct  94   SRDSSRLITGSADQTAKLWDVQSGEQLFTFKFGSPARFVDFS-VGDHL---------AVI  143

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG-------------KSFASG  231
            TTD    +  A    +I ++    V      IN    NPDG             K+  S 
Sbjct  144  TTDPFMERTSAIHVKRIAEDPQDQVGDSVLVIN----NPDGKKRINRAVWGLLNKTIVSA  199

Query  230  GEDGYVRL  207
            GED  +R+
Sbjct  200  GEDAVIRI  207



>ref|XP_006294579.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
 gb|EOA27477.1| hypothetical protein CARUB_v10023615mg [Capsella rubella]
Length=328

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/195 (84%), Positives = 179/195 (92%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL +   +GR  INRAVWGPLN+TI+SGGED+V+RIWD ETG+LLKESD+E GHK
Sbjct  134  QVDESVLVLPSAEGRKRINRAVWGPLNQTIVSGGEDAVIRIWDTETGQLLKESDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL+K+ D SHFITGSLDKSAKLWD+RTLTLLKTY T  PVNAVTMSPLL+HIVLGG
Sbjct  194  KAITSLSKAADDSHFITGSLDKSAKLWDMRTLTLLKTYTTVVPVNAVTMSPLLNHIVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 77/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  + + DH+         AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVQSGQQLFTFKFGSPARSVDFA-VGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF---------GPINALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    V               IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERNSAIHVKRIAEDPEDQVDESVLVLPSAEGRKRINRAVWGPLNQTIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>dbj|BAJ85385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   316 bits (810),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKLLKESD+E GH+K 
Sbjct  134  QTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKLLKESDKEVGHQKA  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP LDH+V+GGGQ
Sbjct  194  ISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD +YF+IK+
Sbjct  314  LHHFDPEYFNIKM  326


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S   +  ITGS D++AKLWD++T   L T+  + P  +V ++ + DH+         AV 
Sbjct  61   SRHSTRLITGSADQTAKLWDVKTGKELFTFRFDAPARSVDLA-IGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G        +I        +E    + G  G IN   + P  ++  + GED  +
Sbjct  111  TTDSFMGNMPTAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_003577379.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Brachypodium distachyon]
Length=326

 Score =   316 bits (810),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT +S L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKLL ESD+E GH+K 
Sbjct  134  QTEDSALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKLLNESDKEVGHQKA  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP LDH+V+GGGQ
Sbjct  194  ISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD DYF+IK+
Sbjct  314  LHHFDPDYFNIKM  326


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 22/183 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHAPNVWYADNGERLG---TYKGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S   +  +TGS D++AKLWD++T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRHSTRLLTGSADQTAKLWDVKTGKELFTFRFDAPARSVDFA-------IG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGG--------VKGHFGPINALAFNPDGKSFASGGEDGY  216
            TTD   G  +     K + E+I          + G  G IN   + P  ++  + GED  
Sbjct  111  TTDSFMGN-QPTAQVKRIAEDIEDQTEDSALVISGITGRINRAVWGPGNRTIITAGEDAT  169

Query  215  VRL  207
            +R+
Sbjct  170  IRI  172



>gb|AFM95335.1| eukaryotic translation initiation factor 3 subunit i [Triticum 
aestivum]
Length=326

 Score =   316 bits (810),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ETGKLLKESD+E GH+K 
Sbjct  134  QTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSETGKLLKESDKEVGHQKA  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SP LDH+V+GGGQ
Sbjct  194  ISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVNAVDISPTLDHVVIGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA  VT TD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVR
Sbjct  254  DAMNVTMTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVR  313

Query  209  LHHFDADYFHIKI  171
            LHHFD +YF+IK+
Sbjct  314  LHHFDPEYFNIKM  326


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 78/182 (43%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWYADNGDRLG---TYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S   +  ITGS D++AKLWD++T   L T+  + P  +V ++ + DH+         AV 
Sbjct  61   SRHSARLITGSADQTAKLWDVKTGKELFTFRFDAPARSVDLA-IGDHL---------AVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD   G        +I        +E    + G  G IN   + P  ++  + GED  +
Sbjct  111  TTDSFMGNMPTAQVKRIAEDLQDQTEESALVISGITGRINRAVWGPGNRTIITAGEDATI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_002882057.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58316.1| hypothetical protein ARALYDRAFT_322284 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   316 bits (809),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 175/197 (89%), Gaps = 4/197 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGR--INRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q G+SVL ++   G+  INRAVWGPLN+TI+SGGED+V+RIWD ETGKLLK+SD E GHK
Sbjct  163  QVGDSVLVLQSPDGKKKINRAVWGPLNQTIVSGGEDTVIRIWDTETGKLLKQSDVEVGHK  222

Query  575  KGITSLAKSIDGSHFITGSLDKSAK--LWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVL  402
            + ITSL K+ D SHF+TGS DK+AK  LWD+R+LTL+K+Y T  PVNAV MSPLL+H+VL
Sbjct  223  EAITSLCKAADDSHFLTGSHDKTAKACLWDMRSLTLIKSYTTVVPVNAVAMSPLLNHVVL  282

Query  401  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGED  222
            GGGQDASAVTTTDHRAGKFEAKFYD IL+EEIGGVKGHFGPINALAFNPDGKSF+SGGED
Sbjct  283  GGGQDASAVTTTDHRAGKFEAKFYDTILEEEIGGVKGHFGPINALAFNPDGKSFSSGGED  342

Query  221  GYVRLHHFDADYFHIKI  171
            GYVRLHHFD++YF+IKI
Sbjct  343  GYVRLHHFDSNYFNIKI  359


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 86/193 (45%), Gaps = 25/193 (13%)
 Frame = -2

Query  749  QTGESVLT---MKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGH  579
            QT E+ +T   MKGH+  +    +      + S  +D    +W A  G+ L       GH
Sbjct  24   QTLETRMTPILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWLAHNGERLG---TYRGH  80

Query  578  KKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLG  399
               ++    S D S  ITGS D++AKLWD+++   L T+       +V  S + DH+   
Sbjct  81   NGAVSCCDVSRDSSRLITGSADQTAKLWDVKSGKQLFTFNFGSSARSVDFS-VGDHL---  136

Query  398  GGQDASAVTTTDHRAGKFEAKFYDKIL---QEEIG-GVKGHFGP-----INALAFNPDGK  246
                  AV TTDH  G   A    +I    Q+++G  V     P     IN   + P  +
Sbjct  137  ------AVITTDHFMGVSSAIHVKRIAEDPQDQVGDSVLVLQSPDGKKKINRAVWGPLNQ  190

Query  245  SFASGGEDGYVRL  207
            +  SGGED  +R+
Sbjct  191  TIVSGGEDTVIRI  203



>gb|KJB56103.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=264

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  689  WGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDK  510
            +G   +TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK ITSL KS DGSHF+TGSLDK
Sbjct  92   FGSPARTIVSAGEDAVIRIWDSETGKLLREADKESGHKKTITSLTKSADGSHFLTGSLDK  151

Query  509  SAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFY  330
            SAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQDASAVTTTDHRAGKFEAKF+
Sbjct  152  SAKLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEAKFF  211

Query  329  DKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGYVRLHHFD DYF+IKI
Sbjct  212  DKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDPDYFNIKI  264



>ref|XP_010678072.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGK-LLKESDQESGHKK  573
            QT ES L M+G  GRINRAVWG LNK IIS GED+++R+WD  TG+ ++   D E+GH  
Sbjct  134  QTNESALVMRGPSGRINRAVWGLLNKNIISCGEDAIIRVWDPVTGQEIMSTKDHENGHNN  193

Query  572  GITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGG  393
             ITSL  S D SHF+TGSLDKSAKLWD R+LTL+KTY+T RPVNAVTMSPLLDH+VLGGG
Sbjct  194  AITSLCFSADKSHFLTGSLDKSAKLWDTRSLTLIKTYITGRPVNAVTMSPLLDHVVLGGG  253

Query  392  QDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            QDAS VTT+DHRAGKFEAKF+DKIL+EEIGGVKGHFGPINALAFNPDGKSFASGGEDGY 
Sbjct  254  QDASTVTTSDHRAGKFEAKFFDKILEEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYA  313

Query  212  RLHHFDADYFHIKI  171
            RLHHFD DYF IKI
Sbjct  314  RLHHFDPDYFTIKI  327


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHNPTVWYADNGERLG---TYRGHNGAVWSCDI  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++ KLWD++    L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SWDSSRLITGSADQTVKLWDVKKGEQLYTFNFDAPARSVNFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD    K  A    +I +       E    ++G  G IN   +    K+  S GED  +
Sbjct  111  TTDPFMEKTSAIHVKRIAEDIDEQTNESALVMRGPSGRINRAVWGLLNKNIISCGEDAII  170

Query  212  RL  207
            R+
Sbjct  171  RV  172



>ref|NP_182151.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 ref|NP_850450.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 sp|Q38884.2|EIF3I_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TGF-beta receptor-interacting 
protein 1; Short=TRIP-1; AltName: Full=eIF-3-beta; 
AltName: Full=eIF3 p36 [Arabidopsis thaliana]
 gb|AAC62878.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 dbj|BAE98705.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AEC10670.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
 gb|AEC10671.1| TGF-beta receptor interacting protein 1 [Arabidopsis thaliana]
Length=328

 Score =   311 bits (798),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETGKLLK+SD+E GHK
Sbjct  134  QDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV++SPLL+H+VLGG
Sbjct  194  KDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 79/184 (43%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFA-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL----QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH   +  A    +I     +++   V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDHFVDRTAAIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDK  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>gb|AAG53616.1|AF285835_1 eukaryotic initiation factor 3I1 subunit [Arabidopsis thaliana]
Length=328

 Score =   311 bits (798),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/195 (82%), Positives = 177/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETGKLLK+SD+E GHK
Sbjct  134  QDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV++SPLL+H+VLGG
Sbjct  194  KDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 79/184 (43%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNRQPHLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFA-------VG---DRFAVI  110

Query  371  TTDHRAGKFEAKFYDKIL----QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH   +  A    +I     +++   V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDHFVDRTAAIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDK  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>gb|KDO58631.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=313

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLKESD+E+GHKK 
Sbjct  134  QGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLKESDKETGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  240
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGK +
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKRY  303


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFA-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>gb|AAK43862.1|AF370485_1 eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
 gb|AAL47346.1| eukaryotic translation initiation factor 3 delta subunit [Arabidopsis 
thaliana]
Length=328

 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETGKLLK+SD+E GHK
Sbjct  134  QDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV++SPLL+H+VLGG
Sbjct  194  KDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGK F+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKGFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 79/184 (43%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFA-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL----QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH   +  A    +I     +++   V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDHFVDRTAAIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDK  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>ref|XP_006448046.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
 gb|ESR61286.1| hypothetical protein CICLE_v10015917mg [Citrus clementina]
Length=313

 Score =   309 bits (791),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLKESD+E+GHKK 
Sbjct  134  QGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLKESDKETGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  ITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSF  240
            DASAVTTTDHRAGKFEAKF+DKILQEEIGGVKGHFGPINALAFNPDGK +
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKILQEEIGGVKGHFGPINALAFNPDGKRY  303


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFA-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>dbj|BAH19940.1| AT2G46280 [Arabidopsis thaliana]
Length=328

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL +    G  RINRAVWGPLN+TI+SGGED V+RIWDAETGKLLK+SD+E GHK
Sbjct  134  QDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV++SPLL+H+VLGG
Sbjct  194  KDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDASAVTTTDHRAGKFEAKFYDKILQE IGGVKGHFGPINALAFNPDGKSF+SGGEDGY
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKILQEGIGGVKGHFGPINALAFNPDGKSFSSGGEDGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+ YF+IKI
Sbjct  314  VRLHHFDSGYFNIKI  328


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 79/184 (43%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFA-------VG---DRLAVI  110

Query  371  TTDHRAGKFEAKFYDKIL----QEEIGGVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH   +  A    +I     +++   V     P     IN   + P  ++  SGGED 
Sbjct  111  TTDHFVDRTAAIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDK  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>gb|AAC49079.1| TGF-beta receptor interacting protein 1 homolog [Arabidopsis 
thaliana]
Length=328

 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  ESVL +    G  RINRAVWGPLN+TI+S GED V+RIWDAETGKLLK+SD+E GHK
Sbjct  134  QDAESVLVLHCPDGKKRINRAVWGPLNQTIVSCGEDKVIRIWDAETGKLLKQSDEEVGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHF+TGSLDK+AKLWD+RTLTLLKTY T  PVNAV++SPLL+H+VLGG
Sbjct  194  KDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            G+DASAVTTTDHRAGKFEAKF DKILQEEIGGVKGHFGPINALAFNPDGKSF+SGGE GY
Sbjct  254  GEDASAVTTTDHRAGKFEAKFCDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEGGY  313

Query  215  VRLHHFDADYFHIKI  171
            VRLHHFD+DYF+IKI
Sbjct  314  VRLHHFDSDYFNIKI  328


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 78/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AKLWD+++   L T+    P  +V  +       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFA-------VG---DRLAVI  110

Query  371  TTDH---RAGKFEAKFYDKILQEEIG-GVKGHFGP-----INALAFNPDGKSFASGGEDG  219
            TTDH   R      K Y +  +E+    V     P     IN   + P  ++  S GED 
Sbjct  111  TTDHFVDRTAAIHVKAYCEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSCGEDK  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRI  174



>ref|XP_002988251.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
 ref|XP_002991383.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ07495.1| hypothetical protein SELMODRAFT_236283 [Selaginella moellendorffii]
 gb|EFJ10670.1| hypothetical protein SELMODRAFT_269383 [Selaginella moellendorffii]
Length=323

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = -2

Query  737  SVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSL  558
            S+ T  G  GRINR VWGPLNKTIIS GED+V+RIWD ETG+++K++D+E+GH + ITSL
Sbjct  136  SIKTFTGPTGRINRVVWGPLNKTIISAGEDTVIRIWDVETGEVIKKTDKENGHSRAITSL  195

Query  557  AKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASA  378
            + S DGSHFITGS DK+AKLWD RTLTLLKTY TERPVNAV +SPL++H+V+GGGQ+AS 
Sbjct  196  SLSADGSHFITGSQDKTAKLWDTRTLTLLKTYSTERPVNAVAISPLMNHVVVGGGQEASQ  255

Query  377  VTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHF  198
            VTT+D RAGKFEAKF+ KI  +EIGGV+GHFGPINALAFNPDG+SF+SGGEDGYVRLHHF
Sbjct  256  VTTSDRRAGKFEAKFFHKIFCDEIGGVRGHFGPINALAFNPDGRSFSSGGEDGYVRLHHF  315

Query  197  DADYFHIK  174
            D DY+ ++
Sbjct  316  DPDYYKLQ  323


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 73/182 (40%), Gaps = 22/182 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W    G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHNPTVWYGHNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S   +  ITGS D+S KLWD+ T T L T+    P  AV  +            D  AV 
Sbjct  61   SRHSTRLITGSADQSVKLWDVETGTQLHTFNFVSPARAVDFAE----------GDKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI----LQEEIGGVKGHFGP---INALAFNPDGKSFASGGEDGYV  213
            +TD       A     +    LQ+  G +K   GP   IN + + P  K+  S GED  +
Sbjct  111  STDPFMESVSAIHIKSVESSGLQQ--GSIKTFTGPTGRINRVVWGPLNKTIISAGEDTVI  168

Query  212  RL  207
            R+
Sbjct  169  RI  170



>gb|EAZ42270.1| hypothetical protein OsJ_26838 [Oryza sativa Japonica Group]
Length=380

 Score =   295 bits (754),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 173/247 (70%), Gaps = 54/247 (22%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ ES+L + G +GRINRAVWGPLN+TII+ GED+ +RIWD ETG+ LKESD+E GH+K 
Sbjct  134  QSEESLLVITGIKGRINRAVWGPLNRTIITAGEDATIRIWDTETGQCLKESDKEQGHQKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDH-------  411
            ITSL+KS D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV +SPLLDH       
Sbjct  194  ITSLSKSADWSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVDISPLLDHPCHIGPT  253

Query  410  ----------------IVLG-------------------------------GGQDASAVT  372
                            IV G                               GGQDA  VT
Sbjct  254  SVSSITKCGDSWMPQRIVAGMVLDDGGAMPVVILNVGTWQQPRQSERVVIGGGQDAMNVT  313

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
             TD RAGKFEAKF+ KILQEEIGGVKGHFGPINALAFNPDG+SF+SGGEDGYVRLHHFD+
Sbjct  314  MTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRSFSSGGEDGYVRLHHFDS  373

Query  191  DYFHIKI  171
            DYF+IKI
Sbjct  374  DYFNIKI  380


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 79/185 (43%), Gaps = 26/185 (14%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G  L       GH   + S   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPNVWFADNGDRLGTY---RGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D +  ITGS D++AKLWD++T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSTRLITGSADQTAKLWDVQTGRELFTFRFDAPARSVEFA-------IG---DGLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEE----------IGGVKGHFGPINALAFNPDGKSFASGGED  222
            TTD+           +I ++           I G+KG    IN   + P  ++  + GED
Sbjct  111  TTDNFMENVPTAQVKRIAEDPDDQSEESLLVITGIKGR---INRAVWGPLNRTIITAGED  167

Query  221  GYVRL  207
              +R+
Sbjct  168  ATIRI  172



>ref|XP_007215753.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
 gb|EMJ16952.1| hypothetical protein PRUPE_ppa009367mg [Prunus persica]
Length=295

 Score =   276 bits (707),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 154/191 (81%), Gaps = 25/191 (13%)
 Frame = -2

Query  743  GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGIT  564
            GES L +KG QGR  RAVWGPLN+TIIS GED+V+RIWD+ETGKLLKE+D+E GHKK IT
Sbjct  130  GESALILKGPQGRRQRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKENDKEVGHKKTIT  189

Query  563  SLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDA  384
            SLAKS+DGSHF+TGSLDKSA+LWDIRTLTL+KTYVTERPVNAV MSPLLD +VLGGGQDA
Sbjct  190  SLAKSVDGSHFLTGSLDKSARLWDIRTLTLIKTYVTERPVNAVAMSPLLDDVVLGGGQDA  249

Query  383  SAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLH  204
            SAVTTTDHRAGKFEAKFYD+ L+                          SGGEDGYVRLH
Sbjct  250  SAVTTTDHRAGKFEAKFYDRFLK-------------------------WSGGEDGYVRLH  284

Query  203  HFDADYFHIKI  171
            HFD+DYF+IKI
Sbjct  285  HFDSDYFNIKI  295



>ref|XP_002500789.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62047.1| predicted protein [Micromonas sp. RCC299]
Length=317

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/192 (64%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT E  ++M G +GRINRA+WGPLN+TI++GGED V+R+WD ETGK++ E++    HKK 
Sbjct  129  QTNEIKISMSGPEGRINRALWGPLNRTILTGGEDGVIRLWDVETGKIVHEAND---HKKQ  185

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  L+ S+D +HFI+ SLDK+AKL+D  TL  LKTY  +RPVNA  +SP+LDHI+LGGGQ
Sbjct  186  IQHLSLSVDKTHFISASLDKTAKLFDSETLECLKTYAADRPVNAAILSPILDHIILGGGQ  245

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA AVTTT  +AGKF++K + KI +EEIGG++GHFGPINALA++PDG+SF SGGEDGYVR
Sbjct  246  DAMAVTTTHSKAGKFDSKIFYKIYEEEIGGIRGHFGPINALAWHPDGRSFTSGGEDGYVR  305

Query  209  LHHFDADYFHIK  174
            +HHFD DYF IK
Sbjct  306  IHHFDNDYFRIK  317


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 80/178 (45%), Gaps = 17/178 (10%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+   N+   G L   + +  +D    +W ++ G+ +       GH   + +   
Sbjct  4    ILLKGHERCYNKE--GDL---LFTCAKDHHPTLWYSDDGERVG---TYIGHNGAVWTCDV  55

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ---DAS  381
            + D    +TGS D + K+WD  T T   T+  E+PV AV +S    H+V+         +
Sbjct  56   TEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMVISSDPFMGVPA  115

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  207
            A+   D  A + E     KI       + G  G IN   + P  ++  +GGEDG +RL
Sbjct  116  ALHIVDVAANREEQTNEIKI------SMSGPEGRINRALWGPLNRTILTGGEDGVIRL  167



>gb|KCW69348.1| hypothetical protein EUGRSUZ_F02830 [Eucalyptus grandis]
Length=280

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  ESVL ++GHQGRI RAVWGPLNKTIIS GED+V+RIWD+ETGKLL+ESD+E+GHKK 
Sbjct  134  QASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVIRIWDSETGKLLRESDKETGHKKA  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            +TSL KS+DGSHF+TGS DKSAKLWDIRTLTL+KTYVTERPVNAVTMSPLLDH+VLGGGQ
Sbjct  194  VTSLMKSVDGSHFVTGSQDKSAKLWDIRTLTLIKTYVTERPVNAVTMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKILQ  315
            DASAVT TDHRAGKFEAKF+DK L+
Sbjct  254  DASAVTMTDHRAGKFEAKFFDKFLK  278


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTFLKYNREGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D +AKLW ++  T L T+  + P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADTTAKLWSVQNGTQLFTFNFDSPARSVDFS-------IG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  ++GH G I    + P  K+  S GED  +
Sbjct  111  TTDPFMELPSAIHVKRIARDPADQASESVLVLRGHQGRIARAVWGPLNKTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_001418365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96658.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=323

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GE V  ++G QGR+ R +WGPLNKT+++GGED ++R WD ETG +LK S +   H K 
Sbjct  135  QRGEVVKRIEGPQGRVTRVMWGPLNKTVVTGGEDGIIRSWDVETGDVLKMSQE---HSKQ  191

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  L  S DGSHFI+ SLDK+AK++D  TL  LKTY  +RPVNA  +SP+ DHIVLGGGQ
Sbjct  192  IQHLVMSDDGSHFISASLDKTAKVFDSETLECLKTYSADRPVNAAILSPIRDHIVLGGGQ  251

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA AVTTT  +AGKF++K Y KI +EEIGG++GHFGPINALAFNPDG+SF SGGEDGYVR
Sbjct  252  DAMAVTTTSSKAGKFDSKIYHKIFEEEIGGIRGHFGPINALAFNPDGRSFTSGGEDGYVR  311

Query  209  LHHFDADYFHI  177
            +H  D  YF I
Sbjct  312  IHPLDNSYFEI  322


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 80/182 (44%), Gaps = 21/182 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + +  +D    +W  + G+ +       GH   + +   
Sbjct  4    ILLKGHERPLTFIKYNREGDLLFTCAKDHHPTLWYGDNGERVG---TYVGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  +TGS D +AKLWD +T     T+  ++PV AV ++        GG Q A    
Sbjct  61   SDDSSTLVTGSADTTAKLWDTKTGECYFTFEFDQPVRAVALN-------AGGTQCA---I  110

Query  371  TTDHRAGKFEA------KFYDKILQ--EEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            TTD   G   A         D+  Q  E +  ++G  G +  + + P  K+  +GGEDG 
Sbjct  111  TTDPFMGVPSAIHIVNVNLGDRAAQRGEVVKRIEGPQGRVTRVMWGPLNKTVVTGGEDGI  170

Query  215  VR  210
            +R
Sbjct  171  IR  172



>gb|KJB56102.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=318

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK 
Sbjct  134  QTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKLLREADKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+VLGGGQ
Sbjct  194  ITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVVLGGGQ  253

Query  389  DASAVTTTDHRAGKFEAKFYDKI  321
            DASAVTTTDHRAGKFEAKF+DK+
Sbjct  254  DASAVTTTDHRAGKFEAKFFDKV  276


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I        +E    +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_003059370.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56502.1| predicted protein [Micromonas pusilla CCMP1545]
Length=334

 Score =   250 bits (638),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 149/193 (77%), Gaps = 4/193 (2%)
 Frame = -2

Query  749  QTGESVLTM-KGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKK  573
            QT E V +   G +GRINRA+WGPLN+TI++GGED V+R WD ETGK+  E+     HKK
Sbjct  145  QTNEIVASFGDGVEGRINRALWGPLNETILTGGEDGVIRAWDVETGKIKLEA---RDHKK  201

Query  572  GITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGG  393
             I  L  S D +HF++ SLDK+AKL+D  TL  LKTYV +RPVNA  +SP+LDHIVLGGG
Sbjct  202  QIQHLCLSEDKTHFVSASLDKTAKLFDSETLECLKTYVADRPVNAAIISPILDHIVLGGG  261

Query  392  QDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            QDA AVTTT  +AGKF++K Y K+ +EEIG ++GHFGP+NALAFNPDG+SF +GGEDGY 
Sbjct  262  QDAMAVTTTSSKAGKFDSKIYFKVYEEEIGSIRGHFGPVNALAFNPDGRSFTTGGEDGYS  321

Query  212  RLHHFDADYFHIK  174
            R+HH D DYF I+
Sbjct  322  RVHHLDNDYFRIR  334



>ref|XP_003079673.1| TGF-beta receptor-interacting protein 1 (ISS) [Ostreococcus tauri]
 emb|CAL53318.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=323

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT   +  + G QGR+ R +WGPLN+T+I+GGED ++R WDAE G++LK S +   H K 
Sbjct  135  QTARVIRRIDGPQGRVTRVLWGPLNRTVITGGEDGIIRSWDAENGEVLKISQE---HSKQ  191

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  L+ S DGSHFI+ SLDK+AK++D  TL  +KTY  +RPVNA  +SP+ DHIVLGGGQ
Sbjct  192  IQHLSMSEDGSHFISASLDKTAKVFDSETLECMKTYSADRPVNAAILSPIRDHIVLGGGQ  251

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA +VTTT  +AGKF++K Y KI +EEIGG++GHFGPINALAFNPDG+SF SGGEDGYVR
Sbjct  252  DAMSVTTTSSKAGKFDSKIYHKIFEEEIGGIRGHFGPINALAFNPDGRSFTSGGEDGYVR  311

Query  209  LHHFDADYFHI  177
            +H  D  YF I
Sbjct  312  IHPLDNSYFEI  322


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 81/182 (45%), Gaps = 21/182 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +KGH+  +    +      + +  +D    +W  +TG+ +       GH   + +   
Sbjct  4    ILLKGHERPLTFIRYNREGDLLFTCAKDHHPTLWYGDTGERVG---TYVGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  +TGS D +AKLWD +T     T+  ++PV AV ++         GG+ A+   
Sbjct  61   SDDSSTLLTGSADTTAKLWDAKTGECYFTFTFDQPVRAVALA--------HGGKRAA--I  110

Query  371  TTDHRAGKFEAKFYDKILQEE--------IGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            TTD   G   A    +I  E+        I  + G  G +  + + P  ++  +GGEDG 
Sbjct  111  TTDPFMGVPSAIHIVEIDLEDRSRQTARVIRRIDGPQGRVTRVLWGPLNRTVITGGEDGI  170

Query  215  VR  210
            +R
Sbjct  171  IR  172



>ref|XP_007512918.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16476.1| predicted protein [Bathycoccus prasinos]
Length=327

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 144/196 (73%), Gaps = 6/196 (3%)
 Frame = -2

Query  749  QTGESVLTMKGH---QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGH  579
            QT + + T+ G     GR+NR  WG LN+T ++ GED VLR+WD ETGK+L E+     H
Sbjct  134  QTSKILKTISGDGIVNGRLNRVAWGALNETFLTAGEDGVLRVWDVETGKVLHEA--RDAH  191

Query  578  K-KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVL  402
            K K I  L  S D +H IT SLDK+AK++D + L LLKTYV +RPVNA  +SP+ +HI+L
Sbjct  192  KGKPIQHLELSADKTHAITASLDKTAKIFDAQNLELLKTYVADRPVNAAIISPIREHIIL  251

Query  401  GGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGED  222
            GGGQDA AVTTT  +AGKF++K Y KI +EEIGG++GHFGPINALAF PDGKSF SGGED
Sbjct  252  GGGQDAMAVTTTSSKAGKFDSKIYHKIFEEEIGGIRGHFGPINALAFCPDGKSFTSGGED  311

Query  221  GYVRLHHFDADYFHIK  174
            GY R+HH D  YF IK
Sbjct  312  GYARIHHLDNTYFDIK  327



>ref|XP_011401093.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
 gb|KFM28081.1| Eukaryotic translation initiation factor 3 subunit I [Auxenochlorella 
protothecoides]
Length=324

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 140/193 (73%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  E+V T++G +GRI R  W   N+T+I+  ED  +R WD ETGK L     E  H+K 
Sbjct  134  QGEEAVQTLRGPRGRIARVEWTDQNRTLITASEDGFVRRWDVETGKELAA---EHVHEKN  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  L  S+DG+HFIT S+D S+KL D +TL +LKTY +  PVN+  +SP+ DH++LGGGQ
Sbjct  191  IQDLQMSVDGTHFITASVDCSSKLVDTQTLAVLKTYQSNVPVNSAALSPVYDHVILGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTT  RAG+FE++F+ K+ QEE G V+GHFGPINA++F+PDG  FASGGE+GYVR
Sbjct  251  DASQVTTTSSRAGRFESRFFHKVFQEEFGNVRGHFGPINAVSFSPDGTGFASGGEEGYVR  310

Query  209  LHHFDADYFHIKI  171
            LH FDADYF  K 
Sbjct  311  LHKFDADYFTTKF  323



>ref|XP_006395438.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
 gb|ESQ32724.1| hypothetical protein EUTSA_v10004580mg [Eutrema salsugineum]
Length=289

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 2/145 (1%)
 Frame = -2

Query  749  QTGESVLTMKGHQG--RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q  +SVL ++   G  RINRAVWGPLN+TI+SGGED+V+R+WD ETGKL+KES++E GHK
Sbjct  134  QIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDAVIRVWDTETGKLIKESNEEEGHK  193

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
            K ITSL K+ D SHFITGSLDK+AKLWD+RTLTL+KTY T  PVNAV MSPLL+H+VLGG
Sbjct  194  KTITSLCKAADDSHFITGSLDKTAKLWDMRTLTLIKTYTTGVPVNAVAMSPLLNHVVLGG  253

Query  395  GQDASAVTTTDHRAGKFEAKFYDKI  321
            GQDASAVTTTDHRAGKFEAKFYDK+
Sbjct  254  GQDASAVTTTDHRAGKFEAKFYDKV  278


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 77/184 (42%), Gaps = 22/184 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+         GH   + S   
Sbjct  4    ILMKGHERPLTFLRYNRDGDLLFSCAKDHTPTLWYADNGE---RHGTYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D S  ITGS D++AK+W+++T   L ++    P  +V  S       +G   D  AV 
Sbjct  61   SRDSSRLITGSADQTAKIWEVKTGRQLFSFKFGSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHF----GP-----INALAFNPDGKSFASGGEDG  219
            TTD    +  A    +I ++    +         P     IN   + P  ++  SGGED 
Sbjct  111  TTDPFMERTSAIHVKRIAEDPEDQIDDSVLILQNPDGKKRINRAVWGPLNETIVSGGEDA  170

Query  218  YVRL  207
             +R+
Sbjct  171  VIRV  174



>gb|KDD75202.1| hypothetical protein H632_c812p0 [Helicosporidium sp. ATCC 50920]
Length=318

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 137/193 (71%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ E V T+ G +GRI R  W   ++T+IS  +D V+R WD ETGK+L E+   + H++ 
Sbjct  128  QSDEVVQTLTGPRGRIARLEWVDGDRTLISASDDGVVRRWDVETGKILVEN---TIHERN  184

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  L  S DG+HF+T S D+SAKL D  TL ++KTY +  PVN+  +SPL DH+++GGGQ
Sbjct  185  IQDLQMSTDGTHFVTASADRSAKLVDAETLEVMKTYQSTVPVNSAAISPLYDHVLIGGGQ  244

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTT  RAGKFE++ + K+  EE   ++GHFGPINA+AF PDG  F SGGE+GY+R
Sbjct  245  EASQVTTTAGRAGKFESRIFHKVFAEEFANIRGHFGPINAVAFMPDGSGFVSGGEEGYIR  304

Query  209  LHHFDADYFHIKI  171
            LHHFDADYF  K 
Sbjct  305  LHHFDADYFTTKF  317



>gb|EMT33770.1| hypothetical protein F775_29343 [Aegilops tauschii]
Length=406

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  620  TGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVN  441
            TGKLLKESD+E GH+K I+SL+KS+D SHF+TGSLDKSAKLWD RTLTL+KTYVTERPVN
Sbjct  276  TGKLLKESDKEVGHQKAISSLSKSLDWSHFLTGSLDKSAKLWDARTLTLIKTYVTERPVN  335

Query  440  AVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAF  261
            AV +SP LDH+V+GGGQDA  VT TD RAGKFEAKF+ KIL+EEIGGVKGHFGPINALAF
Sbjct  336  AVDISPTLDHVVIGGGQDAMNVTMTDRRAGKFEAKFFHKILEEEIGGVKGHFGPINALAF  395

Query  260  NPDGKS  243
            NPDG+S
Sbjct  396  NPDGRS  401


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 82/179 (46%), Gaps = 19/179 (11%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L + G  GRINRAVWGP N+TII+ GED+ +RIWD+ET   L +    +   K 
Sbjct  100  QTEESALVISGITGRINRAVWGPGNRTIITAGEDATIRIWDSET---LTKKLNWNLFSKE  156

Query  569  ITSLAKSIDGSHFI-TGSLDKSAKLWDIRTLTL-LKTYVTERPVNAVTMSPLLDHIVLGG  396
                +  +   H I  G    + K  D+   T+ ++TYV   P N +  S          
Sbjct  157  YEFASMMVSKLHTIYCGDTHCNQKCEDLVPCTVSMRTYVMLLP-NFLCAS------CNQS  209

Query  395  GQDASAVTTTDHR---AGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGG  228
             Q    +  +D +    GK E K Y+    E+I    G    I+ L FN D   F  G 
Sbjct  210  TQTCDGLANSDEQIQEMGKKELKNYNASNNEKIFLAWG----IDTLTFNSDQGLFKEGN  264



>gb|ETO77218.1| hypothetical protein F444_07544 [Phytophthora parasitica P1976]
Length=327

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 138/193 (72%), Gaps = 5/193 (3%)
 Frame = -2

Query  749  QTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D  TG+LL+  D  +G  
Sbjct  134  QSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPTTGQLLESHDIHTGE-  192

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
              IT++A +   +  IT S D +AKL DI TL +LK Y T+RPVN+  +SP+ +H+VLGG
Sbjct  193  --ITNVAFNKTKTLAITSSKDNTAKLLDIETLKVLKVYETDRPVNSAAISPIKEHVVLGG  250

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P+GKS+ASG EDGY
Sbjct  251  GQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHPNGKSYASGAEDGY  310

Query  215  VRLHHFDADYFHI  177
            VRLHHFD DY  +
Sbjct  311  VRLHHFDNDYLKL  323



>ref|XP_008904158.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETI48440.1| hypothetical protein F443_07533 [Phytophthora parasitica P1569]
 gb|ETK88380.1| hypothetical protein L915_07354 [Phytophthora parasitica]
 gb|ETL41778.1| hypothetical protein L916_07299 [Phytophthora parasitica]
 gb|ETL94935.1| hypothetical protein L917_07189 [Phytophthora parasitica]
 gb|ETM48172.1| hypothetical protein L914_07247 [Phytophthora parasitica]
 gb|ETN10397.1| hypothetical protein PPTG_10533 [Phytophthora parasitica INRA-310]
 gb|ETP18232.1| hypothetical protein F441_07512 [Phytophthora parasitica CJ01A1]
 gb|ETP46176.1| hypothetical protein F442_07542 [Phytophthora parasitica P10297]
Length=327

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 138/193 (72%), Gaps = 5/193 (3%)
 Frame = -2

Query  749  QTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D  TG+LL+  D  +G  
Sbjct  134  QSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPTTGQLLESHDIHTGE-  192

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
              IT++A +   +  IT S D +AKL D+ TL +LK Y T+RPVN+  +SP+ +H+VLGG
Sbjct  193  --ITNVAFNKTKTLAITSSKDNTAKLLDVETLKVLKVYETDRPVNSAAISPIKEHVVLGG  250

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P+GKS+ASG EDGY
Sbjct  251  GQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHPNGKSYASGAEDGY  310

Query  215  VRLHHFDADYFHI  177
            VRLHHFD DY  +
Sbjct  311  VRLHHFDNDYLKL  323



>ref|XP_009538303.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
 gb|EGZ06406.1| hypothetical protein PHYSODRAFT_551045 [Phytophthora sojae]
Length=327

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 139/193 (72%), Gaps = 5/193 (3%)
 Frame = -2

Query  749  QTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q+ E VLT+   GH+GRI  A W PLN+ I++ G D  ++++D +TG+LL+  D  +G  
Sbjct  134  QSAEPVLTIANHGHEGRITGAYWTPLNEAIMTTGGDGCIKLFDPQTGELLESHDIHTGE-  192

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
              IT++A +   +  IT S D +AKL D+ T+ +LK Y T+RPVN+  +SP+ +H+VLGG
Sbjct  193  --ITNVAFNKTKTLAITSSKDNTAKLLDVETMKVLKVYETDRPVNSAAISPIKEHVVLGG  250

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P+GKS+ASG EDGY
Sbjct  251  GQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHPNGKSYASGAEDGY  310

Query  215  VRLHHFDADYFHI  177
            VRLHHFD DY  +
Sbjct  311  VRLHHFDNDYLKL  323



>gb|KIZ03352.1| Eukaryotic translation initiation factor 3 subunit I [Monoraphidium 
neglectum]
Length=329

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            LT    +GRI R  W   NK +++  +   +R WDAETG+LL+E+     H+  I  +  
Sbjct  145  LTFDAPKGRITRIGWVEQNKVLLTSHDGGFVRRWDAETGELLEEAQV---HEDAIQDMQF  201

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S DGS+ +T SLDK+AKL D+ TL +LKTY T R V +  +SPL+DH++ GGGQDAS VT
Sbjct  202  SQDGSYVVTASLDKTAKLVDVCTLEVLKTYKTGRFVQSAAISPLMDHVLAGGGQDASQVT  261

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  +AG FEA+F+ KI QEE G V+GHFGPIN++AF PDG+SFA+GGEDGYVR+HHFD 
Sbjct  262  TTAAKAGGFEARFFHKIYQEEFGNVRGHFGPINSVAFAPDGRSFATGGEDGYVRIHHFDM  321

Query  191  DYFHIK  174
            +YF  K
Sbjct  322  EYFSAK  327



>ref|XP_005647023.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22479.1| TGF-beta receptor-interacting protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=324

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 132/189 (70%), Gaps = 3/189 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q+ + V  ++G   RINR  +  LN  +IS GED  +R WD ETGK+ +E+     H+K 
Sbjct  134  QSDQPVQRLEGFSKRINRVTFTDLNTVLISAGEDGFVRRWDVETGKVKEEAKL---HEKE  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +    DG+H +T S+DK  KL D +TL +LK + T+RP NA  +SP+ D +++GGGQ
Sbjct  191  IRDMQLYKDGTHMVTASVDKLVKLVDTQTLEVLKFFNTDRPANAAALSPVFDQVLIGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DA+ VTTT  RAG F+++F  KI  EEIG V+GHFGPINA+AF PDG+SFA+GGEDGY+R
Sbjct  251  DAADVTTTSDRAGGFQSRFIHKIFMEEIGSVRGHFGPINAVAFRPDGRSFATGGEDGYIR  310

Query  209  LHHFDADYF  183
            ++HFD DY 
Sbjct  311  INHFDNDYL  319


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 12/175 (7%)
 Frame = -2

Query  725  MKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSI  546
            +KGH+  + +  +      + S  +D    +W +E G  +       GH   + +   S+
Sbjct  6    LKGHERPLTQLKYNREGDLLFSCAKDHHPTLWFSEDGARIGTY---VGHNGAVNTCDVSM  62

Query  545  DGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTT  366
            D +  +TGS D +AKLW++ T   + T+  + P  AV+ S  +D  +     D    TT 
Sbjct  63   DSTRLLTGSSDSTAKLWEVETGRNVFTFKYQAPCRAVSFS--IDEQLAALSTDPFMTTTP  120

Query  365  D---HRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
                 R  +  ++  D+ +Q     ++G    IN + F        S GEDG+VR
Sbjct  121  AINIVRISEDPSEQSDQPVQR----LEGFSKRINRVTFTDLNTVLISAGEDGFVR  171



>ref|XP_002899797.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
 gb|EEY60851.1| eukaryotic translation initiation factor 3 subunit, putative 
[Phytophthora infestans T30-4]
Length=327

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 138/193 (72%), Gaps = 5/193 (3%)
 Frame = -2

Query  749  QTGESVLTMK--GHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            Q+ E VLT+   GH+GRI  A W PLNK I++ G D  ++++D +TG+LL+     +G  
Sbjct  134  QSAEPVLTITNHGHEGRITGAYWMPLNKAIMTTGGDGTIKLFDPKTGQLLESYVIHTGE-  192

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
              IT++A +   +  IT S D +AKL D+ TL +LK Y T+RPVN+  +SP+ +H+VLGG
Sbjct  193  --ITNVAFNKSKTLAITSSKDNTAKLLDVETLKVLKVYETDRPVNSAAISPIKEHVVLGG  250

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQ+A +VTTT  R GKFEA+F+  + QEE G VKGHFGPIN +AF+P+GKS+ASG EDGY
Sbjct  251  GQEAMSVTTTSGRVGKFEARFFHMVFQEEFGRVKGHFGPINTIAFHPNGKSYASGAEDGY  310

Query  215  VRLHHFDADYFHI  177
            VRLHHFD DY  +
Sbjct  311  VRLHHFDNDYLKL  323



>ref|XP_008553489.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 133/187 (71%), Gaps = 3/187 (2%)
 Frame = -2

Query  743  GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGIT  564
            G +++ +  +  RI+  +WG L++TII+G ED  + IWD  TGK L   + + GHK  I 
Sbjct  137  GSAIIRIPINGPRISSILWGALDETIITGHEDGEINIWDVSTGKKL---NSQKGHKSLIN  193

Query  563  SLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDA  384
             +  S DG+ FIT S D +AKL+D  +L  LKTY TERPVN+ T+SP+ DH++LGGGQDA
Sbjct  194  DMQPSKDGTMFITASKDHTAKLFDSESLMHLKTYQTERPVNSATISPIFDHVILGGGQDA  253

Query  383  SAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLH  204
              VTTT  R GKF+A+FY  + +EE   +KGHFGPIN+LAF+PDG+SF SGGEDG++R++
Sbjct  254  MDVTTTSARQGKFDARFYHLVFEEEFARLKGHFGPINSLAFHPDGRSFCSGGEDGFIRIN  313

Query  203  HFDADYF  183
             FD  YF
Sbjct  314  PFDKSYF  320



>ref|XP_001693266.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP03292.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=324

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT  + +     +GR+ R  W   N+ +I+  +  +LR WD ETG LL+E   +  H+  
Sbjct  134  QTATAAIEWTVPKGRVTRVFWTDCNRKLITSHDGGILRRWDVETGALLQE---QQVHEDA  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D +H IT SLDK+A+L D+ T  ++KTY T R V +  +SPL DH+V+GGGQ
Sbjct  191  IQDMQMSPDETHVITASLDKTARLIDVDTFEVMKTYKTGRFVQSAAISPLFDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            DAS VTTT  +AG FEA+F+ KI QEE G V+GHFGPIN +AF+P GKSF +GGEDGYVR
Sbjct  251  DASQVTTTAAQAGGFEARFFHKIFQEEFGRVRGHFGPINTVAFHPSGKSFTTGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            LHH D DYF  K 
Sbjct  311  LHHMDMDYFTTKF  323



>ref|XP_008549768.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Microplitis demolitor]
Length=326

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  + IWD  TGK L   + + GHK  I  +  S DG+ FI
Sbjct  149  RISAILWGALDETIITGHEDGEINIWDVRTGKKL---NSQKGHKSQINDMQASKDGTMFI  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L  LKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSESLMHLKTYKTERPVNSATISPIYDHVVLGGGQDAMDVTTTSTRQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+A+FY  + +EE   +KGHFGPIN+LAF+P+G+SF+SGGEDGYVR++ FD  YF
Sbjct  266  FDARFYHLVFEEEFARLKGHFGPINSLAFHPNGRSFSSGGEDGYVRINTFDQSYF  320



>gb|KDO58632.1| hypothetical protein CISIN_1g020461mg [Citrus sinensis]
Length=305

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q GESVL +KG QGRINRAVWGPLN+TIIS GED+++RIWD ETGKLLKESD+E+GHKK 
Sbjct  134  QGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIVRIWDTETGKLLKESDKETGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            ITSLAK+ DGSHF+TGSLDKSAKLWD RTL L+KTYVTERPVNAVTMSPLLDH+ +G  Q
Sbjct  194  ITSLAKAADGSHFLTGSLDKSAKLWDARTLELIKTYVTERPVNAVTMSPLLDHVCIGEPQ  253


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 77/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   +     
Sbjct  4    ILMKGHERPLTYLKYNKDGDLLFSCAKDHTPTVWFADNGERLG---TYRGHNGAVWCCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++AKLW++ T   L T+  + P  +V  +       +G   D  AV 
Sbjct  61   SRDSMTLITGSADQTAKLWNVETGAQLFTFNFDSPARSVDFA-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQ-------EEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I +       E +  +KG  G IN   + P  ++  S GED  V
Sbjct  111  TTDPFMELNSAIHVKRIARDPADQGGESVLILKGPQGRINRAVWGPLNRTIISAGEDAIV  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_008613397.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|EQC33274.1| translation initiation factor 3 subunit I [Saprolegnia diclina 
VS20]
 gb|KDO31229.1| hypothetical protein SPRG_03847 [Saprolegnia parasitica CBS 223.65]
Length=325

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            +T  GH+GR+  A W PLN+ I++ GED ++++++ ETG L+ E    +G    ITSL+ 
Sbjct  142  ITKHGHKGRVTGAYWMPLNEGILTTGEDGMVKLFNPETGALISEHKVHNG---SITSLSF  198

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            + D +  IT S D +AKL D+ TL +LKTY T+RPVN+ ++SP  +H+VLGGGQ+A  VT
Sbjct  199  NKDKTLAITSSKDNTAKLLDVETLEVLKTYETDRPVNSASISPTKEHVVLGGGQEAMTVT  258

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
             T  RAGKFEA+F+ ++ +EE G VKGHFGPIN++ F+PDGKS+ SG EDGYVR+HHFD 
Sbjct  259  VTAGRAGKFEARFFHQVYEEEFGRVKGHFGPINSITFHPDGKSYTSGAEDGYVRIHHFDQ  318

Query  191  DYF  183
            +Y 
Sbjct  319  EYL  321



>emb|CCA18540.1| eukaryotic translation initiation factor 3 subunit p [Albugo 
laibachii Nc14]
Length=331

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            +T  G  GRI  A W PLNK+I++ G D  L+++D ++GK+LKE    SG    +T+++ 
Sbjct  142  ITNHGFNGRITGAYWMPLNKSILASGGDGGLKVFDPKSGKVLKECKIHSG---DVTNISF  198

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            +   +  IT S D +AKL D+ TL +LKTY T+RPVN+  MSP+ +H+VLGGGQ+A +VT
Sbjct  199  NKLKTLAITSSKDNTAKLLDVETLDVLKTYETDRPVNSAAMSPIREHVVLGGGQEAMSVT  258

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  + GKFEA+F+  + QEE   VKGHFGPIN +AF+PDGKS+ SG EDGYVRLHHFD 
Sbjct  259  TTSGQVGKFEARFFHMVFQEEFARVKGHFGPINTIAFHPDGKSYVSGAEDGYVRLHHFDE  318

Query  191  DYF  183
            DYF
Sbjct  319  DYF  321



>ref|XP_011314062.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fopius arisanus]
Length=326

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  + IWD  TGK+L  +    GH+  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGEINIWDVRTGKILTSA---KGHRSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D   L  LKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSEQLVHLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+A+F+  + +EE   +KGHFGPIN+LAF+P+GKSF+SGGEDGYVR++ FD  YF
Sbjct  266  FDARFFHMVFEEEFARLKGHFGPINSLAFHPNGKSFSSGGEDGYVRINTFDQSYF  320



>ref|XP_316636.4| AGAP006607-PA [Anopheles gambiae str. PEST]
 sp|Q7PP77.4|EIF3I_ANOGA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Anopheles gambiae]
 gb|EAA10908.5| AGAP006607-PA [Anopheles gambiae str. PEST]
Length=327

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 130/183 (71%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            LTM   Q +I   +WG L++T+I+G E+  LRIWD    + +KE +  + H   IT +  
Sbjct  143  LTMNEQQSKITSMLWGALDETVITGHENGSLRIWDL---RAVKELNSVNDHTASITDMQM  199

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S DG+ F++ S D SAKL+D  +L  LKT+ TERPVN+  +SPL +H+ LGGGQDA  VT
Sbjct  200  SSDGTMFVSSSKDCSAKLFDSDSLMCLKTFKTERPVNSACISPLFEHVALGGGQDAMEVT  259

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  +AGKF+++F+  + +EE   VKGHFGPIN++AF+PDGKSFA+GGEDG+VRL  FD+
Sbjct  260  TTSTQAGKFDSRFFHLVYEEEFARVKGHFGPINSMAFHPDGKSFATGGEDGFVRLQVFDS  319

Query  191  DYF  183
             Y+
Sbjct  320  SYY  322



>ref|XP_011337589.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Cerapachys biroi]
 gb|EZA54998.1| Eukaryotic translation initiation factor 3 subunit I [Cerapachys 
biroi]
Length=326

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGEIKLWDVRTGKKLTSV---KGHKSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  TL LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSETLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  320



>ref|XP_011254946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Camponotus floridanus]
Length=326

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGEIKLWDVRTGKKLSSV---KGHKSQINDMQCNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  320



>sp|B4LUA5.2|EIF3I_DROVI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
virilis]
Length=322

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  134  EPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHTAGIND  191

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA 
Sbjct  192  MQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAM  251

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  252  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQS  311

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  312  FDSTYFE  318



>ref|XP_011160448.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Solenopsis invicta]
Length=326

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  L++WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGELKLWDVRTGKKLSSV---KGHKSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSESLVLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  320



>gb|EFZ22632.1| hypothetical protein SINV_00160 [Solenopsis invicta]
Length=326

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  L++WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGELKLWDVRTGKKLSSV---KGHKSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSESLVLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  320



>gb|ETN60290.1| eukaryotic translation initiation factor 3 subunit [Anopheles 
darlingi]
Length=327

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            LTM   Q +I   +WG L++T+I+G E+  +RIWD    + +KE +  + H   IT +  
Sbjct  143  LTMGEQQSKITSMLWGALDETVITGHENGSIRIWDL---RAVKELNSVNDHTANITDMQM  199

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S DG+ FI+ S D +AKL+D  +L  LKTY TERPVN+  +SPL +H+ LGGGQDA  VT
Sbjct  200  SHDGTMFISSSKDTTAKLFDSESLVCLKTYKTERPVNSAAISPLYEHVALGGGQDAMEVT  259

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  +AGKF+++F+  + +EE   VKGHFGPIN+LAF+PDGKSF +GGEDG+VR+  FD+
Sbjct  260  TTSTQAGKFDSRFFHLVYEEEFARVKGHFGPINSLAFHPDGKSFTTGGEDGFVRVQVFDS  319

Query  191  DYFHIKI  171
             YF  ++
Sbjct  320  SYFEFQL  326



>ref|XP_002051937.1| GJ17275 [Drosophila virilis]
 gb|EDW64092.1| GJ17275, partial [Drosophila virilis]
Length=325

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  137  EPTLRIPMVESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHTAGIND  194

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA 
Sbjct  195  MQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAM  254

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  255  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQS  314

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  315  FDSTYFE  321



>ref|XP_002078185.1| GD22675 [Drosophila simulans]
 sp|B4Q354.1|EIF3I_DROSI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
simulans]
 gb|EDX03770.1| GD22675 [Drosophila simulans]
Length=326

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  138  EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGIND  195

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP++DH+VLGGGQDA 
Sbjct  196  MQLSKDGTMFVTASRDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAM  255

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  256  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQT  315

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  316  FDSTYFE  322



>gb|KFQ29136.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Merops nubicus]
Length=242

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  51   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLANIKE---HTKQ  107

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  108  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  167

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  168  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  227

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  228  IHYFDPQYFEFEF  240



>gb|EGI64611.1| Eukaryotic translation initiation factor 3 subunit I [Acromyrmex 
echinatior]
Length=322

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  145  RISAILWGALDETIITGHEDGEIKLWDVRTGKKLSSV---KGHKSQINDMQCNKDGTMFV  201

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  202  TASKDHTAKLFDSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  261

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  262  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  316



>ref|XP_001968738.1| GG24335 [Drosophila erecta]
 sp|B3N4C7.1|EIF3I_DROER RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
erecta]
 gb|EDV57797.1| GG24335 [Drosophila erecta]
Length=326

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  138  EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGIND  195

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP++DH+VLGGGQDA 
Sbjct  196  MQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAM  255

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  256  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQT  315

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  316  FDSTYFE  322



>ref|XP_002001737.1| GI15375 [Drosophila mojavensis]
 sp|B4KGX9.1|EIF3I_DROMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
mojavensis]
 gb|EDW11179.1| GI15375 [Drosophila mojavensis]
Length=322

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSH  534
            + +I   +WGPL++TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ 
Sbjct  143  ESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGSDHTAGINDMQLSKDGTM  200

Query  533  FITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRA  354
            F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +A
Sbjct  201  FVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKA  260

Query  353  GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  180
            GKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  261  GKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  318



>gb|KFO76878.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Cuculus canorus]
Length=263

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  72   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  128

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  129  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  188

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  189  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  248

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  249  IHYFDPQYFEFEF  261



>ref|XP_009560176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Cuculus canorus]
Length=266

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  75   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  131

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  132  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  191

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  192  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  251

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  252  IHYFDPQYFEFEF  264



>ref|NP_523478.1| Trip1 [Drosophila melanogaster]
 ref|XP_002037884.1| GM18055 [Drosophila sechellia]
 sp|O02195.1|EIF3I_DROME RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog; AltName: 
Full=eIF-3-beta [Drosophila melanogaster]
 sp|B4I195.1|EIF3I_DROSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
sechellia]
 gb|AAB53431.1| TRIP-1 homolog [Drosophila melanogaster]
 gb|AAF52183.1| Trip1 [Drosophila melanogaster]
 gb|AAM49896.1| LD24026p [Drosophila melanogaster]
 gb|EDW54302.1| GM18055 [Drosophila sechellia]
 gb|ACL84827.1| Trip1-PA, partial [synthetic construct]
 gb|ACL89803.1| Trip1-PA [synthetic construct]
Length=326

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  138  EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGIND  195

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP++DH+VLGGGQDA 
Sbjct  196  MQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAM  255

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  256  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQT  315

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  316  FDSTYFE  322



>sp|B3MVL6.2|EIF3I_DROAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
ananassae]
Length=322

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSH  534
            + +I   +WGPL++TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ 
Sbjct  143  ESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGSDHTAGINDMQLSKDGTM  200

Query  533  FITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRA  354
            F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +A
Sbjct  201  FVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKA  260

Query  353  GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  180
            GKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  261  GKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  318



>ref|XP_005427180.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Geospiza fortis]
Length=249

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  58   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  114

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  115  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  174

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  175  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  234

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  235  IHYFDPQYFEFEF  247



>ref|XP_004364074.2| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=325

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            +I  AV+GPL+KT+I+G +D  + +WD ETGK++K S +   H+K I S+  + D + F+
Sbjct  148  KITAAVFGPLDKTLITGHDDGTINVWDVETGKIIKSSQE---HEKYINSIQLNGDQTSFV  204

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            + S D +AKL+D  TL +LKTY T   VN+  +SPL  H+VLGGGQ+A  VTTT  R GK
Sbjct  205  SASKDSTAKLFDTETLEVLKTYKTPTNVNSAAISPLRPHVVLGGGQEAREVTTTSTRVGK  264

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            FE +F+  I +EEIG VKGHFGPIN +AF+P GKSFASGGEDG++R+H FD DY+  + 
Sbjct  265  FEVRFFHLIFEEEIGRVKGHFGPINTVAFHPSGKSFASGGEDGFIRVHAFDPDYYEFEF  323



>ref|NP_001040433.1| eukaryotic translation initiation factor 3 subunit I [Bombyx 
mori]
 sp|Q1HPW4.1|EIF3I_BOMMO RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i [Bombyx mori]
 gb|ABF51377.1| eukaryotic translation initiation factor 3 subunit 2 beta [Bombyx 
mori]
Length=329

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            ++   +WG L++TII+G E   L  WD  TGK +    +   H   IT +  S DG+ F+
Sbjct  149  KVTSMIWGSLDETIITGHEAGDLIQWDLRTGKKIHSVKE---HTHQITDMQLSRDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDTNSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+A+F+  + +EE G VKGHFGPIN+LAF+PDGKS+ASGGEDGYVR+H+FD  YF
Sbjct  266  FDARFFHLVFEEEFGRVKGHFGPINSLAFHPDGKSYASGGEDGYVRVHNFDQSYF  320



>ref|XP_011055583.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Acromyrmex echinatior]
Length=326

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  +++WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGEIKLWDVRTGKKLSSV---KGHKSQINDMQCNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYMRINNFDQSYF  320



>ref|XP_001965147.1| GF23646 [Drosophila ananassae]
 gb|EDV33281.1| GF23646 [Drosophila ananassae]
Length=332

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSH  534
            + +I   +WGPL++TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ 
Sbjct  153  ESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGSDHTAGINDMQLSKDGTM  210

Query  533  FITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRA  354
            F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +A
Sbjct  211  FVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKA  270

Query  353  GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  180
            GKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  271  GKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  328



>ref|XP_002957235.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
 gb|EFJ41733.1| eukaryotic translation initiation factor 3i [Volvox carteri f. 
nagariensis]
Length=324

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 124/181 (69%), Gaps = 3/181 (2%)
 Frame = -2

Query  713  QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSH  534
            +GRI R  W   N+ +I+  +  +LR WD ETG++L+E      H+  I  +  S D +H
Sbjct  146  KGRITRIFWTDCNRKVITSHDYGILRRWDVETGQMLQEVQV---HEDAIQDMQMSPDETH  202

Query  533  FITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRA  354
             IT SLDK+A+L DI T T+LK Y T R V +  +SPL DH+++GGGQDAS VTTT   A
Sbjct  203  VITASLDKTARLIDIETFTVLKVYKTGRFVQSAAISPLFDHVLMGGGQDASQVTTTAAGA  262

Query  353  GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  174
            G FEA+F+ K+ QEE G V+GHFGP+N +AF+P G+SF +GGEDGYVRLHH D DYF  K
Sbjct  263  GGFEARFFHKVFQEEFGRVRGHFGPVNTVAFHPSGRSFTTGGEDGYVRLHHMDLDYFTTK  322

Query  173  I  171
             
Sbjct  323  F  323



>ref|XP_008937943.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Merops nubicus]
Length=258

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  67   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLANIKE---HTKQ  123

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  124  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  183

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  184  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  243

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  244  IHYFDPQYFEFEF  256



>gb|KJE92223.1| Trip1-PA [Capsaspora owczarzaki ATCC 30864]
Length=329

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 129/179 (72%), Gaps = 3/179 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            +I  AV+GPL+KT+I+G +D  + +WD ETGK++K S +   H+K I S+  + D + F+
Sbjct  152  KITAAVFGPLDKTLITGHDDGTINVWDVETGKIIKSSQE---HEKYINSIQLNGDQTSFV  208

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            + S D +AKL+D  TL +LKTY T   VN+  +SPL  H+VLGGGQ+A  VTTT  R GK
Sbjct  209  SASKDSTAKLFDTETLEVLKTYKTPTNVNSAAISPLRPHVVLGGGQEAREVTTTSTRVGK  268

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            FE +F+  I +EEIG VKGHFGPIN +AF+P GKSFASGGEDG++R+H FD DY+  + 
Sbjct  269  FEVRFFHLIFEEEIGRVKGHFGPINTVAFHPSGKSFASGGEDGFIRVHAFDPDYYEFEF  327



>sp|B4NW98.2|EIF3I_DROYA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
yakuba]
Length=322

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  134  EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGIND  191

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LK+Y TERPVN+  +SP+LDH+VLGGGQDA 
Sbjct  192  MQLSKDGTMFVTASKDTTAKLFDSESLMCLKSYKTERPVNSAAISPILDHVVLGGGQDAM  251

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  252  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQT  311

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  312  FDSTYFE  318



>ref|XP_010083431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pterocles gutturalis]
 ref|XP_010121524.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Chlamydotis macqueenii]
Length=263

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  72   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  128

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  129  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  188

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  189  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  248

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  249  IHYFDPQYFEFEF  261



>ref|XP_002021487.1| GL26537 [Drosophila persimilis]
 ref|XP_001355946.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
 sp|B4GSH1.1|EIF3I_DROPE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
persimilis]
 sp|Q29L19.2|EIF3I_DROPS RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
pseudoobscura pseudoobscura]
 gb|EDW25330.1| GL26537 [Drosophila persimilis]
 gb|EAL33005.2| GA21387 [Drosophila pseudoobscura pseudoobscura]
Length=326

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSH  534
            + +I    WGPL++TII+G ++  + IWD   G+  K  D  S H  GI  +  S DG+ 
Sbjct  147  ESKITSMQWGPLDETIITGHDNGNIAIWDVRKGQ--KVVDSGSDHAAGINDMQLSKDGTM  204

Query  533  FITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRA  354
            F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +A
Sbjct  205  FVTASRDTTAKLFDSESLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKA  264

Query  353  GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  180
            GKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  265  GKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFDSTYFE  322



>ref|XP_002088703.1| Trip1 [Drosophila yakuba]
 gb|EDW88415.1| Trip1 [Drosophila yakuba]
Length=325

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H  GI  
Sbjct  137  EPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQ--KVVDSGTDHSAGIND  194

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LK+Y TERPVN+  +SP+LDH+VLGGGQDA 
Sbjct  195  MQLSKDGTMFVTASKDTTAKLFDSESLMCLKSYKTERPVNSAAISPILDHVVLGGGQDAM  254

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  255  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQT  314

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  315  FDSTYFE  321



>ref|XP_009821601.1| hypothetical protein H257_00561 [Aphanomyces astaci]
 gb|ETV89201.1| hypothetical protein H257_00561 [Aphanomyces astaci]
Length=325

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 132/183 (72%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            +T  GHQGR+  A W  LN+ II+ GED  +++++ ETG L+ E+   +G    IT+LA 
Sbjct  142  ITKHGHQGRVTGAYWTALNEAIITTGEDGYVKLFNPETGALISETKVHNG---VITNLAF  198

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            + D +  IT S D +AKL D+  + +LKTY T+RPVN+ ++SP  +H+VLGGGQ+A  VT
Sbjct  199  NKDKTLGITSSKDNTAKLIDLDAMQVLKTYETDRPVNSASISPTKEHVVLGGGQEAMTVT  258

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
             T  RAGKFEA+F+ ++ +EE   VKGHFGPIN++ F+PDGKS++SG EDGYVR+HHFD 
Sbjct  259  VTAGRAGKFEARFFHQVFEEEFARVKGHFGPINSITFHPDGKSYSSGAEDGYVRIHHFDQ  318

Query  191  DYF  183
            DY 
Sbjct  319  DYL  321



>emb|CCI46504.1| unnamed protein product [Albugo candida]
Length=317

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 131/183 (72%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            +T  G  GRI  A W PLN +I++ G D  L+++D ++GK+LKE    SG    IT+++ 
Sbjct  128  ITNHGFNGRITGAYWMPLNTSILASGGDGGLKLFDPKSGKVLKECKIHSG---DITNISF  184

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            +   +  IT S D +AKL D+ TL +LKTY T+RPVN+  +SP+ +H+VLGGGQ+A +VT
Sbjct  185  NKLKTLAITSSKDNTAKLVDVETLDVLKTYETDRPVNSAAISPIREHVVLGGGQEAMSVT  244

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  + GKFEA+F+  + QEE   VKGHFGPIN +AF+PDGKS+ SG EDGYVRLHHFD 
Sbjct  245  TTSGQVGKFEARFFHMVFQEEFARVKGHFGPINTIAFHPDGKSYVSGAEDGYVRLHHFDE  304

Query  191  DYF  183
            DYF
Sbjct  305  DYF  307



>ref|XP_010012332.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Nestor notabilis]
Length=263

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  72   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  128

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  129  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  188

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  189  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  248

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  249  IHYFDPQYFEFEF  261



>ref|XP_007067631.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chelonia mydas]
Length=217

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 133/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            ++ E  + +  ++ +I  AVWGPL + II+G E+  L  + A++G++L    +   H K 
Sbjct  26   ESDEPYMKIPCNESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEVLVNVKE---HTKQ  82

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D SAKL+D  TL   K++ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  83   INDIQTSRDMTMFITASKDNSAKLFDSTTLEHQKSFRTERPVNSAALSPIFDHVVLGGGQ  142

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+   ++EE G +KGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  143  EAMDVTTTSTRIGKFEARFFHLGVEEEFGRIKGHFGPINSVAFHPDGKSYSSGGEDGYVR  202

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  203  IHYFDPQYFEFEF  215



>gb|KJB26173.1| hypothetical protein B456_004G228300 [Gossypium raimondii]
Length=250

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ESVL +KG QGRINRAVWGPLN+TIIS GED+V+RIWD+ETGKLLKESD+ESGHKK 
Sbjct  134  QTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVIRIWDSETGKLLKESDKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVL  402
            ITSL K+ DGSHF++GSLDKSAKLWD RTLTL+KTY TERPVNAV MSPLLDH+ +
Sbjct  194  ITSLTKAADGSHFLSGSLDKSAKLWDTRTLTLIKTYSTERPVNAVAMSPLLDHVSM  249


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + +   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWTCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW+++  T L T+    P  +V          +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQKGTQLYTFNFGSPARSV-------EFAIG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKI-------LQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I        +E +  +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIAGDSTEQTEESVLVIKGPQGRINRAVWGPLNRTIISAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_009330494.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pygoscelis adeliae]
Length=279

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  88   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  144

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  145  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  204

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  205  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  264

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  265  IHYFDPQYFEFEF  277



>ref|XP_010731470.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Larimichthys crocea]
Length=296

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  L++     +I  AVWGPL + +I+G E+  L  + A++G +LK + +   H K 
Sbjct  105  EDNQPYLSIPCSDHKITSAVWGPLGEFVIAGHENGELNQFSAKSGDILKSAKE---HTKQ  161

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D + FI+ S D SAKL+D  +L  +KT+ TERPVN+  +SP++DH+V+GGGQ
Sbjct  162  INDIQTSVDLTMFISASKDNSAKLFDCTSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQ  221

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGY R
Sbjct  222  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTR  281

Query  209  LHHFDADYFHIKI  171
            +H+FD+ YF  ++
Sbjct  282  IHYFDSQYFDFEL  294



>gb|KJB56104.1| hypothetical protein B456_009G106100 [Gossypium raimondii]
Length=269

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            QT ES L +KG QGRINRAVWGPLN+TI+S GED+V+RIWD+ETGKLL+E+D+ESGHKK 
Sbjct  134  QTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVIRIWDSETGKLLREADKESGHKKT  193

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLG  399
            ITSL KS DGSHF+TGSLDKSAKLWD RTLTL+KTYVTERPVNAV MSPLLDH+ + 
Sbjct  194  ITSLTKSADGSHFLTGSLDKSAKLWDTRTLTLIKTYVTERPVNAVAMSPLLDHVSMN  250


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 76/182 (42%), Gaps = 20/182 (11%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + MKGH+  +    +      + S  +D    +W A+ G+ L       GH   + S   
Sbjct  4    ILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTVWFADNGERL---GTYRGHNGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D    ITGS D++ KLW+++T   L T+    P  +V  S       +G   D  AV 
Sbjct  61   SRDSMRLITGSADQTVKLWNVQTGAQLYTFNFGSPARSVDFS-------VG---DKLAVI  110

Query  371  TTDHRAGKFEAKFYDKILQEEIGG-------VKGHFGPINALAFNPDGKSFASGGEDGYV  213
            TTD       A    +I ++           +KG  G IN   + P  ++  S GED  +
Sbjct  111  TTDPFMELTSAIHVKRIARDPTEQTEESELVIKGPQGRINRAVWGPLNRTIVSAGEDAVI  170

Query  212  RL  207
            R+
Sbjct  171  RI  172



>ref|XP_002431936.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
 gb|EEB19198.1| eukaryotic translation initiation factor 3 subunit, putative 
[Pediculus humanus corporis]
Length=320

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = -2

Query  743  GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGIT  564
            G S+L M   + +I   +WG +++TII+G ++  L+ WD + GK +  +    G    I 
Sbjct  131  GNSILRMTFDEAKITSLLWGSVDETIITGHDNGELQQWDMKNGKKIVSTKDHFGM---IN  187

Query  563  SLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDA  384
             +  + D + FIT S D +AKL+D  TL  LKTY TERPVN+  +SPLLDH+VLGGGQDA
Sbjct  188  DMQMNKDSTFFITASKDYTAKLFDSDTLFCLKTYKTERPVNSAAISPLLDHVVLGGGQDA  247

Query  383  SAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLH  204
              VTTT  R GKF+++F+  + +EE G VKGHFGPIN++AF+PDG+S++SGGEDGY+R+H
Sbjct  248  MEVTTTSTRIGKFDSRFFHMVFEEEFGRVKGHFGPINSVAFHPDGRSYSSGGEDGYIRVH  307

Query  203  HFDADYF  183
            +FD  YF
Sbjct  308  YFDNSYF  314



>ref|XP_011180318.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera cucurbitae]
Length=326

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = -2

Query  734  VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLA  555
            +L +     +I   +WGPL++TII+G ++  + IWD   G   +E +  + H  GI  + 
Sbjct  140  ILRLPMVPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG--REINSVNDHTAGINDMQ  197

Query  554  KSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAV  375
             + DG+ F+T S D SAKL+D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  V
Sbjct  198  MNKDGTMFVTASKDTSAKLFDSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEV  257

Query  374  TTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD  195
            TTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD
Sbjct  258  TTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFD  317

Query  194  ADYF  183
            + YF
Sbjct  318  STYF  321



>ref|XP_009482861.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Pelecanus crispus]
Length=270

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  79   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  135

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  136  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  195

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  196  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  255

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  256  IHYFDPQYFEFEF  268



>ref|XP_005823889.1| translation initiation factor 3, subunit I [Guillardia theta 
CCMP2712]
 gb|EKX36909.1| translation initiation factor 3, subunit I [Guillardia theta 
CCMP2712]
Length=319

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 125/179 (70%), Gaps = 3/179 (2%)
 Frame = -2

Query  710  GRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHF  531
             +  RA+WGPLNK I+   E   +  ++A TG+ L E       ++ I     S D   F
Sbjct  144  AKATRALWGPLNKKILVSNEAGGILSYEAATGECLIE---RCDFEQEIPDFTYSQDMMTF  200

Query  530  ITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAG  351
            I  S D +A L+D  TL  ++ YV++RP+N+  +SPL+DH+V+GGGQDASAVTTT  R+G
Sbjct  201  IVASKDHTAMLYDTNTLEPIRKYVSDRPINSAAISPLMDHVVIGGGQDASAVTTTAGRSG  260

Query  350  KFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIK  174
            +F+A FY KI + EIG V+GHFGPIN+LAFNPDG+SF SGGEDGYVR+HHFD +YF ++
Sbjct  261  RFQALFYHKIFENEIGSVQGHFGPINSLAFNPDGRSFTSGGEDGYVRVHHFDPEYFSLE  319



>ref|XP_011198986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Bactrocera dorsalis]
Length=326

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 131/184 (71%), Gaps = 2/184 (1%)
 Frame = -2

Query  734  VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLA  555
            +L +     +I   +WGPL++TII+G ++  + IWD   G   +E +  + H  GI  + 
Sbjct  140  ILRIPMLPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG--REINSVNDHTAGINDMQ  197

Query  554  KSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAV  375
             + DG+ F+T S D SAKL+D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  V
Sbjct  198  MNKDGTMFVTASKDTSAKLFDSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEV  257

Query  374  TTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD  195
            TTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD
Sbjct  258  TTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFD  317

Query  194  ADYF  183
            + YF
Sbjct  318  STYF  321



>ref|XP_004531427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Ceratitis capitata]
Length=326

 Score =   198 bits (503),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 131/185 (71%), Gaps = 2/185 (1%)
 Frame = -2

Query  734  VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLA  555
            +L +     +I   +WGPL++TII+G ++  + IWD   G   +E +  + H  GI  + 
Sbjct  140  ILRIPMVPSKITSMLWGPLDETIITGHDNGQISIWDIRKGG--REINSVNDHTAGINDMQ  197

Query  554  KSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAV  375
             + DG+ F+T S D SAKL+D  +L  LKTY TERPVN+ ++SP++DH+VLGGGQDA  V
Sbjct  198  MNKDGTMFVTASKDTSAKLFDSESLMCLKTYKTERPVNSASISPIMDHVVLGGGQDAMEV  257

Query  374  TTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD  195
            TTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD
Sbjct  258  TTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQTFD  317

Query  194  ADYFH  180
            + YF 
Sbjct  318  STYFE  322



>ref|XP_006806095.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Neolamprologus brichardi]
Length=325

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 136/193 (70%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  LT+     +I  AVWGPL + +I+G E+  +  + A++G++LK++ +   H K 
Sbjct  134  EDNQPYLTVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEILKKAKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D + FI+ S D +AKL+D  +L  +KT+ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQTSVDLTMFISASKDNTAKLFDSTSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  ++
Sbjct  311  IHYFDPQYFDFEL  323



>gb|EHJ63876.1| eukaryotic translation initiation factor 3 subunit I [Danaus 
plexippus]
Length=325

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 127/188 (68%), Gaps = 3/188 (2%)
 Frame = -2

Query  746  TGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGI  567
            T   +L  +    ++   VWG L++TII+G E   L  WD  TGK +    +   H   I
Sbjct  132  TQSPILKWEITDSKVTSMVWGTLDETIITGHEAGDLIQWDLRTGKKVHSVKE---HTHQI  188

Query  566  TSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQD  387
              +  S DG+ FIT S D++AKL+D  +L LLK Y TERPVN+  +SP+LDH+VLGGGQD
Sbjct  189  NDMQLSRDGTMFITASKDQTAKLFDTSSLELLKEYKTERPVNSAALSPILDHVVLGGGQD  248

Query  386  ASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRL  207
            A  VTTT  R GKF+A+F+  + +EE G VKGHFGPIN+LAF+PDGKSFASGGEDGY+R+
Sbjct  249  AMEVTTTSTRQGKFDARFFHLVFEEEFGRVKGHFGPINSLAFHPDGKSFASGGEDGYIRV  308

Query  206  HHFDADYF  183
              FD  YF
Sbjct  309  QSFDQSYF  316



>ref|XP_001989068.1| GH10244 [Drosophila grimshawi]
 sp|B4JB43.1|EIF3I_DROGR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
grimshawi]
 gb|EDW03935.1| GH10244 [Drosophila grimshawi]
Length=326

 Score =   198 bits (503),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 2/187 (1%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  L +   + +I    WGPL++TII+G ++  + IWD   G+  K  D    H  GI  
Sbjct  138  EPTLRIPMVESKITSMQWGPLDETIITGHDNGNIAIWDVRKGQ--KVVDSGVDHAAGIND  195

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S DG+ F+T S D +AKL+D  +L  LKTY TERPVN+  +SP+ DH+VLGGGQDA 
Sbjct  196  MQLSKDGTMFVTASKDNTAKLFDAESLMCLKTYKTERPVNSAAISPIFDHVVLGGGQDAM  255

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  +AGKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  
Sbjct  256  EVTTTSTKAGKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQS  315

Query  200  FDADYFH  180
            FD+ YF 
Sbjct  316  FDSTYFE  322



>ref|XP_003443814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Oreochromis niloticus]
 ref|XP_004563737.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Maylandia zebra]
 ref|XP_005745286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Pundamilia nyererei]
 ref|XP_005950654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Haplochromis burtoni]
Length=325

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 136/193 (70%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  LT+     +I  AVWGPL + +I+G E+  +  + A++G++LK++ +   H K 
Sbjct  134  EDNQPYLTVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEILKKAKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D + FI+ S D +AKL+D  +L  +KT+ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQTSVDLTMFISASKDNTAKLFDSTSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  ++
Sbjct  311  IHYFDPQYFDFEL  323



>ref|XP_009814792.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I, partial [Gavia stellata]
Length=292

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  101  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  157

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  158  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  217

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  218  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  277

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  278  IHYFDPQYFEFEF  290



>ref|XP_005707349.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
 gb|EME30829.1| translation initiation factor eIF-3 subunit 2 [Galdieria sulphuraria]
Length=324

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = -2

Query  734  VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLA  555
            + T  GH   + R V  P  KT+IS GED  +R WD ETG+    ++  + H+K I  L 
Sbjct  139  IRTFSGHSATVTRVVCHPTEKTLISTGEDGTVRKWDIETGR---NTETVTIHQKPINDLQ  195

Query  554  KSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAV  375
             S  G   IT S D SAK+ D R+L +LKT++T+RPVN+  +SP+L H++LGGGQ+AS V
Sbjct  196  LSKSGGQLITASSDFSAKILDFRSLKVLKTFLTDRPVNSAAISPILPHVLLGGGQEASQV  255

Query  374  TTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD  195
            TTT  RAG+FEA+ +  I ++EIG ++GHFGPIN +AF+PDG  FASG E+G++RLH+FD
Sbjct  256  TTTGDRAGRFEARLFHLIYEDEIGIIRGHFGPINTVAFSPDGLQFASGAEEGFIRLHNFD  315

Query  194  ADYFH  180
             +YF 
Sbjct  316  EEYFQ  320


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 71/182 (39%), Gaps = 22/182 (12%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            L +KGH+  +    +      + S  +DS   +W    G+ +       GH   + S+  
Sbjct  4    LILKGHERPLTMLKYNSEGDLLFSTAKDSTPTVWWTSNGERI---GTYRGHNGAVWSIDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            + D +  +TGS D SAK W   T   + T+  + PV  V+ S            D     
Sbjct  61   NNDSTRVVTGSADNSAKFWRAETGECILTWTHKSPVRCVSFS----------SDDQFVFV  110

Query  371  TTDHRAGKFEAKFYDKILQEE--------IGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
             T    G+  ++ Y  ++  E        I    GH   +  +  +P  K+  S GEDG 
Sbjct  111  ATAMLMGQ-SSEIYQYLVDSESLEEASVPIRTFSGHSATVTRVVCHPTEKTLISTGEDGT  169

Query  215  VR  210
            VR
Sbjct  170  VR  171



>gb|KFP30991.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Colius striatus]
Length=305

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  114  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  170

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  171  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  230

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  231  EAMDVTTTSTRIGKFEARFFHWAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  290

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  291  IHYFDPQYFEFEF  303



>ref|XP_002066637.1| GK24461 [Drosophila willistoni]
 sp|B4N0L0.1|EIF3I_DROWI RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=TRIP-1 homolog [Drosophila 
willistoni]
 gb|EDW77623.1| GK24461 [Drosophila willistoni]
Length=322

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -2

Query  713  QGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSH  534
            + +I   +WGPL++TII+G ++  + IWD   G+  K  D  + H   I  +  S DG+ 
Sbjct  143  ESKITSMLWGPLDETIITGHDNGNIAIWDVRKGQ--KVVDSGTDHTGVINDMQLSKDGTM  200

Query  533  FITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRA  354
            F+T S D +AKL+D  TL  LKTY TERPVN+  +SP+LDH+VLGGGQDA  VTTT  +A
Sbjct  201  FVTASKDATAKLFDSETLMCLKTYKTERPVNSAAISPILDHVVLGGGQDAMEVTTTSTKA  260

Query  353  GKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFH  180
            GKF+++F+  I +EE   +KGHFGPIN+LAF+PDGKS+ASGGEDG+VR+  FD+ YF 
Sbjct  261  GKFDSRFFHLIYEEEFARLKGHFGPINSLAFHPDGKSYASGGEDGFVRVQSFDSTYFE  318



>gb|EMC82690.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Columba livia]
Length=293

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  102  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  158

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  159  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  218

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  219  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  278

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  279  IHYFDPQYFEFEF  291



>ref|XP_392780.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Apis mellifera]
 ref|XP_003693606.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Apis florea]
 ref|XP_006570172.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Apis mellifera]
 ref|XP_006612554.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X1 [Apis dorsata]
 ref|XP_006612555.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like isoform X2 [Apis dorsata]
Length=326

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  + +WD  T K L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGEITLWDVRTRKKLTSV---KGHKSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDNTAKLFDSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+SF++GGEDGYVR++ FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSYF  320



>ref|XP_010198429.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Colius striatus]
Length=306

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  115  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  171

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  172  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  231

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  232  EAMDVTTTSTRIGKFEARFFHWAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  291

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  292  IHYFDPQYFEFEF  304



>emb|CDQ91911.1| unnamed protein product [Oncorhynchus mykiss]
Length=332

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++LK+  +   H K 
Sbjct  141  EDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEVLKKVKE---HNKQ  197

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D +  IT S D S+KL+D  TL  +K++ TERPVN+  +SP++DH+V+GGGQ
Sbjct  198  INDIQTSVDLTMVITASKDCSSKLFDSTTLDHIKSFKTERPVNSAAISPIMDHVVMGGGQ  257

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGY R
Sbjct  258  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTR  317

Query  209  LHHFDADYFHIKI  171
            +HHFD  YF  ++
Sbjct  318  IHHFDPQYFDFEL  330



>gb|KFB49333.1| AGAP006607-PA-like protein [Anopheles sinensis]
Length=342

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 128/183 (70%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            LTM   Q +I   +WG L++T+I+G E+  LRIWD    + +KE +  + H   IT +  
Sbjct  158  LTMSEQQSKITSMLWGALDETVITGHENGSLRIWDL---RAVKELNSVNDHTASITDMQM  214

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D + F++ S D SAKL+D  +L  LKTY TERPVN+  +SPL +H+ LGGGQDA  VT
Sbjct  215  SNDATMFVSSSKDSSAKLFDSESLMNLKTYKTERPVNSACISPLYEHVALGGGQDAMEVT  274

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  +AGKF+++F+  + +EE   VKGHFGPIN++AF+PDGKSFA+GGEDG+VR+  FD 
Sbjct  275  TTSTQAGKFDSRFFHLVYEEEFARVKGHFGPINSMAFHPDGKSFATGGEDGFVRVQVFDN  334

Query  191  DYF  183
             Y+
Sbjct  335  SYY  337



>ref|XP_008862518.1| hypothetical protein H310_01239 [Aphanomyces invadans]
 gb|ETW08713.1| hypothetical protein H310_01239 [Aphanomyces invadans]
Length=325

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 131/183 (72%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            +T  GHQGR+  A W  LN  II+ GED  +++++ ETG L+ E+   +G    IT+LA 
Sbjct  142  ITKHGHQGRVTGAYWTSLNDGIITTGEDGYVKLFNPETGALITEAKVHNG---VITNLAF  198

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            +   +  IT S D +AKL D+ T  +LKTY T+RPVN+ ++SP+ +H+VLGGGQ+A +VT
Sbjct  199  NKTKTLGITSSKDNTAKLIDLETFEVLKTYETDRPVNSASISPIKEHVVLGGGQEAMSVT  258

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
             T  RAGKFEA+F+ ++ +EE   VKGHFGPIN++ F+PDGKS+ SG EDGYVR+HHFD 
Sbjct  259  ITAGRAGKFEARFFHQVFEEEFARVKGHFGPINSITFHPDGKSYTSGAEDGYVRIHHFDQ  318

Query  191  DYF  183
            DY 
Sbjct  319  DYL  321



>ref|XP_009283047.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Aptenodytes forsteri]
Length=331

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  140  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  196

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  197  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  256

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  257  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  316

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  317  IHYFDPQYFEFEF  329



>ref|XP_005509744.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Columba livia]
Length=307

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  116  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  172

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  173  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  232

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  233  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  292

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  293  IHYFDPQYFEFEF  305



>ref|NP_001133273.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI32945.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68205.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI68969.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ACI70142.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16123.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
 gb|ADM16168.1| Eukaryotic translation initiation factor 3 subunit I [Salmo salar]
Length=325

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++LK+  +   H K 
Sbjct  134  EDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEVLKKVKE---HNKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D +  IT S D S+KL+D  TL  +K++ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQTSVDLTMVITASKDCSSKLFDSTTLDHIKSFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGY R
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTR  310

Query  209  LHHFDADYFHIKI  171
            +HHFD  YF  ++
Sbjct  311  IHHFDPQYFDFEL  323



>dbj|BAM18089.1| eukaryotic translation initiation factor 3 subunit I [Papilio 
xuthus]
Length=329

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            ++   VWG L++TII+G E   L  WD  TGK +  S +E  H+  I  +  S DG+ FI
Sbjct  149  KVTSMVWGTLDETIITGHEAGDLIQWDLRTGKKV-HSIKEHNHQ--INDMQLSRDGTMFI  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D++AKL+D  +L LLK Y TERPVN+  +SP+LDH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDQTAKLFDTSSLELLKEYKTERPVNSAALSPILDHVVLGGGQDAMEVTTTSTRQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+A+F+  + +EE G VKGHFGPIN+LAF+PDGKS+ASGGEDGYVR+  FD  YF
Sbjct  266  FDARFFHLVFEEEFGRVKGHFGPINSLAFHPDGKSYASGGEDGYVRVQSFDQSYF  320



>gb|EFN69223.1| Eukaryotic translation initiation factor 3 subunit I [Camponotus 
floridanus]
Length=322

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  +++WD    K L       GHK  I  +  + DG+ F+
Sbjct  145  RISAILWGALDETIITGHEDGEIKLWDVRARKKLSSV---KGHKSQINDMQCNKDGTMFV  201

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  202  TASKDHTAKLFDSESLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  261

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  262  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  316



>ref|XP_009977243.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Tauraco erythrolophus]
Length=338

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  147  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  203

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  204  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  263

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  264  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  323

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  324  IHYFDPQYFEFEF  336



>ref|XP_009927166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Haliaeetus albicilla]
Length=300

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 127/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL   II+G E   L  + A++G+ L    +   H K 
Sbjct  109  ENNEPYMKIPCSDSKITSAVWGPLGDFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  165

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  166  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  225

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  226  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  285

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  286  IHYFDPQYFEFEF  298



>gb|KFP00122.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Calypte anna]
Length=325

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>gb|KFP52286.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Cathartes aura]
 gb|KFV16729.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Pterocles gutturalis]
Length=263

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 126/193 (65%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A+  + L    +   H K 
Sbjct  72   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKVREQLSNIKE---HTKQ  128

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  129  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  188

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  189  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  248

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  249  IHYFDPQYFEFEF  261



>ref|NP_001157867.1| eukaryotic translation initiation factor 3 subunit I [Gallus 
gallus]
 ref|XP_009469099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Nipponia nippon]
 ref|XP_009998862.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Chaetura pelagica]
Length=325

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_003707661.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Megachile rotundata]
Length=326

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  + +WD  T K L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGEITLWDVRTRKKLSSV---KGHKSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKTY TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDNTAKLFDSDSLMLLKTYKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSTRQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+SF++GGEDGYVR++ FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSFSTGGEDGYVRINTFDQSYF  320



>gb|EOB00694.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Anas platyrhynchos]
 gb|KFU91822.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Chaetura pelagica]
Length=325

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_009579506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Fulmarus glacialis]
Length=331

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  140  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  196

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  197  INDIQTSRDMTMFITASKDNTAKLFDCTTLQHLKTFRTERPVNSAALSPIFDHVVLGGGQ  256

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  257  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  316

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  317  IHYFDPQYFEFEF  329



>ref|XP_009708532.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I [Cariama cristata]
Length=329

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  138  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  194

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  195  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  254

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  255  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  314

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  315  IHYFDPQYFEFEF  327



>ref|XP_005239876.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco peregrinus]
 ref|XP_005432815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Falco cherrug]
 ref|XP_009946176.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Leptosomus discolor]
 ref|XP_010180366.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Mesitornis unicolor]
Length=331

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  140  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  196

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  197  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  256

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  257  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  316

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  317  IHYFDPQYFEFEF  329



>ref|XP_009646824.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit I [Egretta garzetta]
Length=331

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  140  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  196

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  197  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  256

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  257  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  316

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  317  IHYFDPQYFEFEF  329



>gb|KFV75063.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Picoides pubescens]
Length=324

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  133  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  189

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  190  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  249

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  250  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  309

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  310  IHYFDPQYFEFEF  322



>ref|XP_009679337.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Struthio camelus australis]
Length=338

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  147  EKNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  203

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  204  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  263

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  264  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  323

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  324  IHYFDPQYFEFEF  336



>ref|XP_010168387.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Caprimulgus carolinensis]
Length=331

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  140  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  196

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  197  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  256

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  257  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  316

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  317  IHYFDPQYFEFEF  329



>ref|XP_010902262.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Esox lucius]
Length=325

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  LT+   + +I  AVWGPL + +I+G E+  +  + A++G++LK+  +   H K 
Sbjct  134  EDNQPYLTVPCAESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEILKKVKE---HSKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D +  IT S D S+KL+D  TL  +KT+ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQTSVDLTMVITASKDCSSKLFDSTTLDHIKTFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGY R
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  ++
Sbjct  311  IHYFDPQYFDFEL  323



>ref|XP_011145247.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
 ref|XP_011145248.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Harpegnathos saltator]
Length=326

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            RI+  +WG L++TII+G ED  + +WD  TGK L       GHK  I  +  + DG+ F+
Sbjct  149  RISAILWGALDETIITGHEDGDITLWDVRTGKKLSNV---KGHKSQINDMQFNKDGTMFV  205

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +AKL+D  +L LLKT+ TERPVN+ T+SP+ DH+VLGGGQDA  VTTT  R GK
Sbjct  206  TASKDHTAKLFDSDSLMLLKTFKTERPVNSATISPIFDHVVLGGGQDAMDVTTTSARQGK  265

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYF  183
            F+++F+  + +EE   +KGHFGPIN+LAF+P+G+S+++GGEDGY+R+++FD  YF
Sbjct  266  FDSRFFHLVFEEEFARLKGHFGPINSLAFHPNGRSYSTGGEDGYIRINNFDQSYF  320


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 88/195 (45%), Gaps = 27/195 (14%)
 Frame = -2

Query  743  GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGIT  564
            GE + T  GH G +           ++SG  D+ LR+WD +TGK + + D  S  +    
Sbjct  42   GERLGTFNGHNGSVWCIDVNWDTTRLLSGSGDNSLRVWDCQTGKEIGQLDTNSSVR--TC  99

Query  563  SLAKSIDGSHFITG-SLDKSAKLW--DIRTL--TLLKTYVTER-PVNAVTMSPL----LD  414
              + S + + F T  +L    +++  DIR +  TL +     R  VN   +S +    LD
Sbjct  100  GFSYSANLAVFSTDKALGHQCEMFIMDIRNVDSTLSQDDAISRISVNGPRISAILWGALD  159

Query  413  HIVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFAS  234
              ++ G +D   +T  D R GK            ++  VKGH   IN + FN DG  F +
Sbjct  160  ETIITGHEDGD-ITLWDVRTGK------------KLSNVKGHKSQINDMQFNKDGTMFVT  206

Query  233  GGEDGYVRLHHFDAD  189
              +D   +L  FD+D
Sbjct  207  ASKDHTAKL--FDSD  219



>gb|KDR14214.1| hypothetical protein L798_11754 [Zootermopsis nevadensis]
Length=338

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 126/179 (70%), Gaps = 3/179 (2%)
 Frame = -2

Query  707  RINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFI  528
            ++   +WGPL+K++I+G E+  L  WD   GK +  ++  SG    I  +  S  G  FI
Sbjct  160  KVTSMLWGPLDKSVITGHENGELTQWDLRMGKTMNSTNDHSG---SINDMQMSKHGIMFI  216

Query  527  TGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGK  348
            T S D +A+L+D  TL+ LKTY TERPVN+  +SP+ DH+V+GGGQDA  VTTT  R GK
Sbjct  217  TASKDYTARLFDTDTLSCLKTYKTERPVNSAAISPIYDHVVVGGGQDAMDVTTTSTRIGK  276

Query  347  FEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            F+++F+  + +EE G VKGHFGPIN++AF+PDGKS++SGGEDGY+R+H+FD+ YF    
Sbjct  277  FDSRFFHLVFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYIRIHNFDSAYFEFNF  335



>ref|XP_009882825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Charadrius vociferus]
Length=339

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  148  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  204

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  205  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  264

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  265  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  324

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  325  IHYFDPQYFEFEF  337



>ref|XP_010721802.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Meleagris gallopavo]
Length=351

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  160  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  216

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  217  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  276

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  277  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  336

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  337  IHYFDPQYFEFEF  349



>gb|KFQ49075.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Nestor notabilis]
Length=263

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 127/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A+  + L    +   H K 
Sbjct  72   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKVREQLSNIKE---HTKQ  128

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  129  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  188

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  189  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  248

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  249  IHYFDPQYFEFEF  261



>gb|ACD65081.1| eukaryotic translation initiation factor [Forcipomyia taiwana]
Length=325

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 131/187 (70%), Gaps = 3/187 (2%)
 Frame = -2

Query  743  GESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGIT  564
            G+++L +   Q +I   +WG L++TII+G E+  + +WD   G+   E +  + H   I 
Sbjct  137  GDAILKIPISQSKITAMIWGTLDETIITGHENGQITLWDLRIGR---EINSVNDHMGAIN  193

Query  563  SLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDA  384
             L  S DG+ F++ S D +AKL+D  +L  LKTY TERPVN+  +SPLL+H+VLGGGQDA
Sbjct  194  DLQLSKDGTMFVSSSRDTTAKLFDSDSLMCLKTYKTERPVNSAAISPLLEHVVLGGGQDA  253

Query  383  SAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLH  204
              VTTT  R GKF+++F+  I +EE   VKGHFGPIN+LAF+PDG+S+A+GGEDG+VRL 
Sbjct  254  MEVTTTSARQGKFDSRFFHLIYEEEFARVKGHFGPINSLAFHPDGRSYATGGEDGFVRLQ  313

Query  203  HFDADYF  183
             FD+ Y+
Sbjct  314  TFDSSYY  320



>ref|XP_008491107.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Calypte anna]
Length=340

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  149  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  205

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  206  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  265

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  266  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  325

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  326  IHYFDPQYFEFEF  338



>ref|XP_010280277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Phaethon lepturus]
Length=336

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  145  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  201

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  202  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  261

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  262  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  321

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  322  IHYFDPQYFEFEF  334



>ref|XP_009068306.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Acanthisitta chloris]
Length=324

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  133  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  189

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  190  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  249

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  250  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  309

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  310  IHYFDPQYFEFEF  322



>ref|NP_001157823.1| eukaryotic translation initiation factor 3 subunit I [Taeniopygia 
guttata]
 sp|B5FZ19.2|EIF3I_TAEGU RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Taeniopygia guttata]
 gb|ACH44281.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44283.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44284.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44285.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
 gb|ACH44286.1| putative eukaryotic translation initiation factor 3 subunit 2 
beta 36 kDa variant 1 [Taeniopygia guttata]
Length=325

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTSLKHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_005535289.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79003.1| eukaryotic translation initiation factor eIF-3 subunit I [Cyanidioschyzon 
merolae strain 10D]
Length=327

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 124/189 (66%), Gaps = 3/189 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            Q  E  L ++GH   I   VW    + ++S  ED  +R WD ETGK   E D+   HKK 
Sbjct  136  QETEPFLVLRGHTATITGVVWYNTAEYMLSVSEDGTVRKWDVETGK---EVDRAKRHKKA  192

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            IT +  S D   F+TGS D +A LWD   +  ++++V +RP+NAV +SPL+ H V+GGGQ
Sbjct  193  ITDIKFSKDHQMFLTGSADGTAVLWDTHAMQEIRSFVLDRPLNAVDLSPLMPHAVVGGGQ  252

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +AS VTTT  +AGKF A F   I  EEI  VKGHFGPIN L+F PDG+ FASGGEDGYVR
Sbjct  253  EASQVTTTAGKAGKFAATFLHLIYGEEIFSVKGHFGPINCLSFTPDGRGFASGGEDGYVR  312

Query  209  LHHFDADYF  183
            LHHFD +Y+
Sbjct  313  LHHFDEEYY  321


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 77/178 (43%), Gaps = 12/178 (7%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            L +KGH+  + +  + P    + +  +D+   +W A TG+ L   D   GH   + S   
Sbjct  4    LLLKGHERPLTQLKFNPEGDLLFTTAKDTRPTVWWASTGERLGTYD---GHTGAVWSCDV  60

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG----GQDA  384
              D +  +TGS D +A+LWD++T   L  +     V +V ++P    + L      GQ++
Sbjct  61   FWDSTRLLTGSADNTARLWDVQTGRELFRWSLRSSVRSVGVAPGCRLMHLANSKLLGQES  120

Query  383  SAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
                      G ++ +  +  L      ++GH   I  + +    +   S  EDG VR
Sbjct  121  CIHLFRLKSDGNWQEQETEPFLV-----LRGHTATITGVVWYNTAEYMLSVSEDGTVR  173



>gb|KFP75614.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Acanthisitta chloris]
Length=325

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_005058303.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Ficedula albicollis]
 ref|XP_005529814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Pseudopodoces humilis]
 ref|XP_009096805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Serinus canaria]
Length=325

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_010574327.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X2 [Haliaeetus leucocephalus]
Length=325

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 127/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL   II+G E   L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGDFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_003228758.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anolis carolinensis]
Length=325

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 133/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +  ++ +I  AVWGPL + II+G E+  L  + A++G++L  + +   H K 
Sbjct  134  EDNEPYMKIPCNESKITSAVWGPLGEFIIAGHENGELNQYSAKSGEVLMNAKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +A+L+D   L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTARLFDSTNLDHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+   ++EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLGVEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>gb|KFW72870.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Pygoscelis adeliae]
Length=277

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 127/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A+  + L    +   H K 
Sbjct  86   ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKVREQLSNIKE---HTKQ  142

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  143  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  202

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  203  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  262

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  263  IHYFDPQYFEFEF  275



>ref|XP_009906815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Picoides pubescens]
Length=340

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  149  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  205

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  206  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  265

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  266  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  325

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  326  IHYFDPQYFEFEF  338



>ref|XP_005020506.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Anas platyrhynchos]
Length=359

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  168  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  224

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  225  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  284

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  285  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  344

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  345  IHYFDPQYFEFEF  357



>ref|XP_006676014.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83190.1| hypothetical protein BATDEDRAFT_84729 [Batrachochytrium dendrobatidis 
JAM81]
Length=337

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 132/197 (67%), Gaps = 7/197 (4%)
 Frame = -2

Query  749  QTGESV--LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHK  576
            QTGE    + +KG +  +  A+WG LNKTII+G +  ++ +WDAETG+L+   +    H 
Sbjct  136  QTGEFTREIIIKGQRATV--ALWGKLNKTIITGHDKGLVSLWDAETGELI---NSVQAHT  190

Query  575  KGITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGG  396
              I  L    +  +FIT S D SA++ D  TL +LK +  ERPVN+  +SP+   I+LGG
Sbjct  191  GPIQDLQFGPEKEYFITASKDNSAQIIDATTLEVLKRFEVERPVNSAAISPIRQQIMLGG  250

Query  395  GQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGY  216
            GQDA  VTTT  R GKFE +F+  + +EEIG V+GHFGPIN LAF+PDGKSF+SGGEDGY
Sbjct  251  GQDAMNVTTTSARQGKFEVRFFHLVFREEIGRVRGHFGPINTLAFHPDGKSFSSGGEDGY  310

Query  215  VRLHHFDADYFHIKI*G  165
            VR+H FD DYF  K  G
Sbjct  311  VRVHFFDNDYFTFKFPG  327



>ref|XP_009964403.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Tyto alba]
Length=324

 Score =   195 bits (496),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  133  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  189

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  190  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  249

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  250  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  309

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  310  IHYFDPQYFEFEF  322



>ref|XP_010574326.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I isoform X1 [Haliaeetus leucocephalus]
Length=332

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 127/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL   II+G E   L  + A++G+ L    +   H K 
Sbjct  141  ENNEPYMKIPCSDSKITSAVWGPLGDFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  197

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  198  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  257

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  258  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  317

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  318  IHYFDPQYFEFEF  330



>ref|XP_010295903.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Balearica regulorum gibbericeps]
Length=329

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  138  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  194

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  195  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  254

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  255  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  314

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  315  IHYFDPQYFEFEF  327



>emb|CAF99511.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=325

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  L++   + +I  AVWGPL   +I+G E+  +  + A++G +LK+  +   H + 
Sbjct  134  EDNQPYLSLPCSEHKITSAVWGPLGDFVIAGHENGEINQFSAKSGDILKKVKE---HSRQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D + FIT S D +AKL+D  +L  +K++ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQTSVDLTMFITASKDNTAKLFDSNSLDHIKSFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  ++
Sbjct  311  IHYFDPQYFDFEL  323



>ref|NP_001279068.1| eukaryotic translation initiation factor 3, subunit I [Callorhinchus 
milii]
 gb|AFK11321.1| eukaryotic translation initiation factor 3 subunit I-like protein 
[Callorhinchus milii]
Length=325

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 134/190 (71%), Gaps = 3/190 (2%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  + +   + +I  AVWGPL + +I+G E+  L  + A++G++L ++ +   H K I  
Sbjct  137  EPYMKVPCSESKITSAVWGPLGEYVIAGHENGELIQYSAKSGEVLVKAKE---HTKQIND  193

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S+D + FIT S D +AKL+D  TL  LK++ TERPVN+  +SP+L+H+VLGGGQ+A 
Sbjct  194  IQTSLDLTMFITASKDNTAKLFDSATLEHLKSFKTERPVNSAAISPILEHVVLGGGQEAM  253

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+
Sbjct  254  DVTTTSTRIGKFEARFFHLSFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHN  313

Query  200  FDADYFHIKI  171
            FD  YF  + 
Sbjct  314  FDPPYFEFEF  323



>gb|KFO60217.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Corvus brachyrhynchos]
Length=325

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  134  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_008633416.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Corvus brachyrhynchos]
 ref|XP_010406518.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Corvus cornix cornix]
Length=326

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A++G+ L    +   H K 
Sbjct  135  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKSGEQLSNIKE---HTKQ  191

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  192  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  251

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  252  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  311

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  312  IHYFDPQYFEFEF  324



>ref|XP_008188704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like, partial [Acyrthosiphon pisum]
Length=191

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 127/183 (69%), Gaps = 3/183 (2%)
 Frame = -2

Query  734  VLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLA  555
            +L M     ++   +WG L+ TII+G ED  +  WD  TGK ++       H+  I  + 
Sbjct  5    ILRMTVPDSKVTSLIWGTLDHTIITGHEDGAITQWDLRTGKSIETV---KDHQGSINDMQ  61

Query  554  KSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAV  375
            K+  G+ F+T S DK++KL+D+  L++ K YVTERPVN+ ++SP+ DH+VLGGGQDA  V
Sbjct  62   KNRQGTMFVTASKDKTSKLFDVDDLSVHKVYVTERPVNSASLSPVYDHVVLGGGQDAMDV  121

Query  374  TTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFD  195
            TTT  +AGKF+A+F+  I +EE   VKGHFGPIN+LAF+PDG+SF++GGEDG++R+  FD
Sbjct  122  TTTAAQAGKFDARFFHVIFEEEFARVKGHFGPINSLAFHPDGESFSTGGEDGFIRVQSFD  181

Query  194  ADY  186
              Y
Sbjct  182  PSY  184



>ref|XP_005142501.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Melopsittacus undulatus]
Length=347

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 129/193 (67%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  156  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLSNIKE---HTKQ  212

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  +L  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  213  INDIQTSRDMTMFITASKDNTAKLFDCTSLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  272

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  273  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  332

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  333  IHYFDPQYFEFEF  345



>ref|XP_008294825.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Stegastes partitus]
Length=325

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 133/190 (70%), Gaps = 3/190 (2%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            +  L++     +I  AVWGPL + +I+G E+  +  + A++G++LK+  +   H K I  
Sbjct  137  QPYLSVPCSDHKITSAVWGPLGEFVIAGHENGEINQFSAKSGEVLKKIKE---HTKQIND  193

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S+D + FIT S D SAKL+D  +L  +KT+ TERPVN+  +SP++DH+V+GGGQ+A 
Sbjct  194  IQPSVDLTIFITASKDNSAKLFDSTSLDHIKTFKTERPVNSAAISPIMDHVVMGGGQEAM  253

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGY R+H+
Sbjct  254  EVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTRIHY  313

Query  200  FDADYFHIKI  171
            FD  YF  ++
Sbjct  314  FDPQYFDFEL  323



>ref|NP_998155.1| eukaryotic translation initiation factor 3 subunit I [Danio rerio]
 sp|Q7ZV55.1|EIF3I_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
I; Short=eIF3i; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 2; AltName: Full=eIF-3-beta; AltName: 
Full=eIF3 p36 [Danio rerio]
 gb|AAH45995.1| Eukaryotic translation initiation factor 3, subunit 2 beta [Danio 
rerio]
 gb|AAH65874.1| Eif3s2 protein [Danio rerio]
Length=325

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 136/193 (70%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  +++   + +I  AVWGPL + +I+G E+  +  + A++G++LK++ +   H K 
Sbjct  134  EDNQPYISVPCSESKITSAVWGPLGEFVIAGHENGEINQFSAKSGEVLKKAKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D +  I+ S D +AK++D  TL  +KT+ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQSSVDLTMIISASKDCTAKMFDSSTLEHVKTFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  ++
Sbjct  311  IHYFDPHYFDFEL  323



>ref|XP_006019466.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I, partial [Alligator sinensis]
Length=329

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  138  ENDEPYMKIPCSESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLTNVKE---HTKQ  194

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  195  INDIQTSRDMTMFITASKDNTAKLFDSTTLDHLKTFRTERPVNSAALSPIFDHVVLGGGQ  254

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+   ++EE G +KGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  255  EAMDVTTTSTRIGKFEARFFHLGVEEEFGRIKGHFGPINSVAFHPDGKSYSSGGEDGYVR  314

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  315  IHYFDPQYFEFEF  327



>gb|EFX80147.1| hypothetical protein DAPPUDRAFT_304176 [Daphnia pulex]
Length=327

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 123/174 (71%), Gaps = 3/174 (2%)
 Frame = -2

Query  692  VWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKSIDGSHFITGSLD  513
            VWG L++ +ISG ++  L  WD  TGK   +++  S H K I  +  S DG+  IT S D
Sbjct  155  VWGNLDEVVISGHDNGDLAQWDLRTGK---KNNLVSEHAKSINDMQLSKDGALLITASKD  211

Query  512  KSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTTTDHRAGKFEAKF  333
             +AKL++  TL  LKTY TERPVN+  +SP++DH+VLGGGQDA  VTTT  R GKF+A+F
Sbjct  212  CTAKLFNAETLECLKTYKTERPVNSAAISPIMDHVVLGGGQDAMDVTTTSTRVGKFDARF  271

Query  332  YDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDADYFHIKI  171
            +  + +EE   VKGHFGPIN+LAF+PDGK++ASGGEDGYVRL+ FD  YF  K 
Sbjct  272  FHLVFEEEFARVKGHFGPINSLAFHPDGKTYASGGEDGYVRLNQFDQSYFDFKF  325



>ref|XP_006274867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Alligator mississippiensis]
Length=325

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +   + +I  AVWGPL + II+G E+  L  + A++G+ L    +   H K 
Sbjct  134  ENDEPYMKIPCSESKITSAVWGPLGEFIIAGHENGELNQFSAKSGEQLTNVKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  191  INDIQTSRDMTMFITASKDNTAKLFDSTTLDHLKTFRTERPVNSAALSPIFDHVVLGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+   ++EE G +KGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  251  EAMDVTTTSTRIGKFEARFFHLGVEEEFGRIKGHFGPINSVAFHPDGKSYSSGGEDGYVR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  311  IHYFDPQYFEFEF  323



>ref|XP_004074467.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I [Oryzias latipes]
Length=325

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            L++  ++ +I  AVWGPL + +I+G E+  +  + A++G+ LK+  +   H K I  +  
Sbjct  140  LSVPCNESKITSAVWGPLGEFVIAGHENGEISQFSAKSGEALKKVKE---HTKQINDIQS  196

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S+D +  IT S D SAKL+D  +L  +KT+ TERPVN+  +SP+ DH+V+GGGQ+A  VT
Sbjct  197  SVDLTMVITASKDNSAKLFDSTSLENIKTFRTERPVNSAAISPIKDHVVMGGGQEAMDVT  256

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGYVR+H+FD 
Sbjct  257  TTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDP  316

Query  191  DYFHIKI  171
             YF  ++
Sbjct  317  QYFDFEL  323



>dbj|BAE01324.1| unnamed protein product [Macaca fascicularis]
Length=186

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 126/187 (67%), Gaps = 3/187 (2%)
 Frame = -2

Query  731  LTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAK  552
            + +  +  +I  AVWGPL + II+G E   L  + A++G++L    +   H + I  +  
Sbjct  1    MKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKE---HSRQINDIQL  57

Query  551  SIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVT  372
            S D + F++ S D +AKL+D  TL   KT+ TERPVN+  +SP  DH+VLGGGQ+A  VT
Sbjct  58   SRDMTMFVSASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVT  117

Query  371  TTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDA  192
            TT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+FD 
Sbjct  118  TTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDP  177

Query  191  DYFHIKI  171
             YF  + 
Sbjct  178  QYFEFEF  184



>gb|ACQ58286.1| Eukaryotic translation initiation factor 3 subunit I [Anoplopoma 
fimbria]
Length=325

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  +  L++     +I  AVWGPL + +I+G E+     + A++G+++K++ +   H K 
Sbjct  134  EDNQPYLSIPCADHKITSAVWGPLGEFVIAGHENGEFNQFSAKSGEIIKKAKE---HTKQ  190

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S+D + FI+ S D +AKL+D  T+  +KT+ TERPVN+  +SP++DH+V+GGGQ
Sbjct  191  INDIQTSVDLTMFISASKDNTAKLFDSATMDHIKTFKTERPVNSAAISPIMDHVVMGGGQ  250

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGY R
Sbjct  251  EAMEVTTTSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYTR  310

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  ++
Sbjct  311  IHYFDPQYFDFEL  323



>gb|KFV10110.1| Eukaryotic translation initiation factor 3 subunit I, partial 
[Tauraco erythrolophus]
Length=321

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 126/193 (65%), Gaps = 3/193 (2%)
 Frame = -2

Query  749  QTGESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKG  570
            +  E  + +     +I  AVWGPL + II+G E   L  + A+  + L    +   H K 
Sbjct  130  ENNEPYMKIPCSDSKITSAVWGPLGEFIIAGHESGELNQFSAKVREQLSNIKE---HTKQ  186

Query  569  ITSLAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQ  390
            I  +  S D + FIT S D +AKL+D  TL  LKT+ TERPVN+  +SP+ DH+VLGGGQ
Sbjct  187  INDIQTSRDMTMFITASKDNTAKLFDCTTLEHLKTFRTERPVNSAALSPIFDHVVLGGGQ  246

Query  389  DASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVR  210
            +A  VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR
Sbjct  247  EAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVR  306

Query  209  LHHFDADYFHIKI  171
            +H+FD  YF  + 
Sbjct  307  IHYFDPQYFEFEF  319



>ref|XP_003969003.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
I-like [Takifugu rubripes]
Length=325

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 132/186 (71%), Gaps = 3/186 (2%)
 Frame = -2

Query  728  TMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITSLAKS  549
            ++   + +I  AVWGPL   +I+G E+  +  + A++G++LK+  +   H + I  +  S
Sbjct  141  SLPCSEHKITSAVWGPLGDFVIAGHENGEINQFSAKSGEILKKVKE---HSRQINDIQTS  197

Query  548  IDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDASAVTT  369
            +D + FIT S D +AKL+D  +L  +K++ TERPVN+  +SP++DH+V+GGGQ+A  VTT
Sbjct  198  VDLTMFITASKDNTAKLFDSNSLDHIKSFKTERPVNSAAISPIMDHVVMGGGQEAMEVTT  257

Query  368  TDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDAD  189
            T  R GKFEA+F+    +EE G VKGHFGPIN +AF+PDGKS++SGGEDGYVR+H+FD  
Sbjct  258  TSTRIGKFEARFFHAAYEEEFGRVKGHFGPINCVAFHPDGKSYSSGGEDGYVRIHYFDPQ  317

Query  188  YFHIKI  171
            YF  ++
Sbjct  318  YFDFEL  323



>gb|AHH54970.1| eukaryotic translation initiation factor 3 subunit I, partial 
[Panthera tigris altaica]
Length=246

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  + +  +  +I  AVWGPL + II+G E   L  + A++G++L    +   H + I  
Sbjct  58   EPYMKIPCNDSKITSAVWGPLGECIIAGHEGGELNQYSAKSGEVLVNVKE---HSRQIND  114

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S D + F+T S D +AKL+D  TL   KT+ TERPVN+  +SP  DH+VLGGGQ+A 
Sbjct  115  IQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAM  174

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+
Sbjct  175  DVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHY  234

Query  200  FDADYFHIKI  171
            FD  YF  + 
Sbjct  235  FDPQYFEFEF  244



>dbj|BAE90204.1| unnamed protein product [Macaca fascicularis]
Length=265

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 3/190 (2%)
 Frame = -2

Query  740  ESVLTMKGHQGRINRAVWGPLNKTIISGGEDSVLRIWDAETGKLLKESDQESGHKKGITS  561
            E  + +  +  +I  AVWGPL + II+G E   L  + A++G++L    +   H + I  
Sbjct  77   EPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKE---HSRQIND  133

Query  560  LAKSIDGSHFITGSLDKSAKLWDIRTLTLLKTYVTERPVNAVTMSPLLDHIVLGGGQDAS  381
            +  S D + F+T S D +AKL+D  TL   KT+ TERPVN+  +SP  DH+VLGGGQ+A 
Sbjct  134  IQLSRDMTMFVTASKDNTAKLFDSTTLERQKTFRTERPVNSAALSPNYDHVVLGGGQEAM  193

Query  380  AVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHH  201
             VTTT  R GKFEA+F+    +EE G VKGHFGPIN++AF+PDGKS++SGGEDGYVR+H+
Sbjct  194  DVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHY  253

Query  200  FDADYFHIKI  171
            FD  YF  + 
Sbjct  254  FDPQYFEFEF  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840