BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043J02

Length=810
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786426.1|  PREDICTED: uncharacterized protein LOC104234...    352   4e-112   Nicotiana sylvestris
ref|XP_009628236.1|  PREDICTED: uncharacterized protein LOC104118...    347   1e-110   Nicotiana tomentosiformis
ref|XP_004235711.1|  PREDICTED: uncharacterized protein LOC101250783    339   2e-107   Solanum lycopersicum
ref|XP_006341679.1|  PREDICTED: uncharacterized protein LOC102589286    338   6e-107   Solanum tuberosum [potatoes]
ref|XP_002304191.2|  hypothetical protein POPTR_0003s05360g             286   2e-92    
ref|XP_011072341.1|  PREDICTED: uncharacterized protein LOC105157620    300   3e-92    Sesamum indicum [beniseed]
ref|XP_002279674.1|  PREDICTED: uncharacterized protein LOC100241173    291   5e-89    Vitis vinifera
emb|CDO98057.1|  unnamed protein product                                288   8e-88    Coffea canephora [robusta coffee]
gb|KHN32609.1|  hypothetical protein glysoja_022291                     284   4e-87    Glycine soja [wild soybean]
ref|XP_010545713.1|  PREDICTED: uncharacterized protein LOC104817994    287   6e-87    Tarenaya hassleriana [spider flower]
gb|KDO51231.1|  hypothetical protein CISIN_1g044677mg                   271   7e-87    Citrus sinensis [apfelsine]
gb|KHG04451.1|  Monodehydroascorbate reductase, fruit isozyme           285   1e-86    Gossypium arboreum [tree cotton]
ref|XP_003542101.1|  PREDICTED: uncharacterized protein LOC100791852    284   2e-86    Glycine max [soybeans]
ref|XP_011026550.1|  PREDICTED: uncharacterized protein LOC105127120    281   4e-85    Populus euphratica
ref|XP_002299694.2|  hypothetical protein POPTR_0001s18130g             279   1e-84    Populus trichocarpa [western balsam poplar]
gb|AAK96499.1|  At1g52320/F19K6_7                                       270   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150659.1|  hypothetical protein PHAVU_005G170800g             278   6e-84    Phaseolus vulgaris [French bean]
ref|XP_011001614.1|  PREDICTED: uncharacterized protein LOC105108845    276   7e-84    Populus euphratica
ref|NP_001117469.1|  uncharacterized protein                            270   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007012028.1|  Golgin subfamily A member 4                        276   2e-83    
gb|KHM98761.1|  hypothetical protein glysoja_030814                     274   2e-83    Glycine soja [wild soybean]
gb|EYU21542.1|  hypothetical protein MIMGU_mgv1a001881mg                276   2e-83    Erythranthe guttata [common monkey flower]
ref|XP_002308623.2|  hypothetical protein POPTR_0006s26050g             276   2e-83    Populus trichocarpa [western balsam poplar]
ref|XP_010098052.1|  hypothetical protein L484_026183                   275   5e-83    Morus notabilis
ref|XP_004486732.1|  PREDICTED: uncharacterized protein LOC101506...    275   6e-83    Cicer arietinum [garbanzo]
ref|XP_002324252.2|  hypothetical protein POPTR_0018s00880g             275   1e-82    Populus trichocarpa [western balsam poplar]
gb|KHN10238.1|  hypothetical protein glysoja_017842                     270   1e-82    Glycine soja [wild soybean]
ref|XP_002281782.1|  PREDICTED: uncharacterized protein LOC100259547    273   1e-82    Vitis vinifera
gb|KJB54879.1|  hypothetical protein B456_009G052500                    274   1e-82    Gossypium raimondii
gb|KFK35788.1|  hypothetical protein AALP_AA4G036700                    275   2e-82    Arabis alpina [alpine rockcress]
ref|XP_006465528.1|  PREDICTED: uncharacterized protein LOC102613887    274   2e-82    Citrus sinensis [apfelsine]
ref|XP_011019684.1|  PREDICTED: uncharacterized protein LOC105122326    273   4e-82    Populus euphratica
ref|XP_006392932.1|  hypothetical protein EUTSA_v10011250mg             273   6e-82    Eutrema salsugineum [saltwater cress]
ref|XP_003603595.1|  hypothetical protein MTR_3g109450                  271   8e-82    Medicago truncatula
ref|XP_006427010.1|  hypothetical protein CICLE_v10024988mg             271   1e-81    Citrus clementina [clementine]
emb|CDY52975.1|  BnaA06g01600D                                          271   2e-81    Brassica napus [oilseed rape]
emb|CDY61085.1|  BnaC06g41130D                                          271   2e-81    Brassica napus [oilseed rape]
ref|XP_003523728.1|  PREDICTED: formin-like protein 8-like              270   3e-81    Glycine max [soybeans]
ref|XP_009147692.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    271   4e-81    Brassica rapa
ref|XP_009799127.1|  PREDICTED: uncharacterized protein LOC104245243    268   1e-80    Nicotiana sylvestris
gb|KHN18210.1|  hypothetical protein glysoja_025100                     266   2e-80    Glycine soja [wild soybean]
ref|XP_002891687.1|  hypothetical protein ARALYDRAFT_474348             270   2e-80    
ref|XP_002516584.1|  conserved hypothetical protein                     268   2e-80    Ricinus communis
ref|NP_849796.2|  uncharacterized protein                               269   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462070.1|  PREDICTED: uncharacterized protein LOC104742736    269   3e-80    Camelina sativa [gold-of-pleasure]
dbj|BAF00450.1|  putative bZIP protein                                  269   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597769.1|  hypothetical protein MTR_2g102050                  268   3e-80    Medicago truncatula
ref|XP_007137162.1|  hypothetical protein PHAVU_009G105100g             267   3e-80    Phaseolus vulgaris [French bean]
ref|XP_010479738.1|  PREDICTED: kinesin-related protein 4-like          268   7e-80    Camelina sativa [gold-of-pleasure]
ref|XP_004305292.1|  PREDICTED: uncharacterized protein LOC101294200    267   7e-80    Fragaria vesca subsp. vesca
ref|XP_003527819.1|  PREDICTED: uncharacterized protein LOC100807597    266   1e-79    Glycine max [soybeans]
gb|KJB65700.1|  hypothetical protein B456_010G109200                    265   2e-79    Gossypium raimondii
ref|XP_009616206.1|  PREDICTED: uncharacterized protein LOC104108786    265   4e-79    Nicotiana tomentosiformis
ref|XP_010500831.1|  PREDICTED: uncharacterized protein LOC104778154    266   4e-79    Camelina sativa [gold-of-pleasure]
ref|XP_006356661.1|  PREDICTED: uncharacterized protein LOC102596799    264   5e-79    
ref|XP_004292865.1|  PREDICTED: uncharacterized protein LOC101308445    264   6e-79    Fragaria vesca subsp. vesca
ref|XP_010942485.1|  PREDICTED: uncharacterized protein LOC105060463    264   7e-79    
ref|XP_004245249.1|  PREDICTED: uncharacterized protein LOC101255018    263   2e-78    Solanum lycopersicum
ref|XP_010251918.1|  PREDICTED: uncharacterized protein LOC104593650    263   2e-78    Nelumbo nucifera [Indian lotus]
ref|XP_011007598.1|  PREDICTED: uncharacterized protein LOC105113217    261   4e-78    Populus euphratica
ref|XP_006306796.1|  hypothetical protein CARUB_v10008333mg             263   5e-78    Capsella rubella
ref|XP_009383699.1|  PREDICTED: uncharacterized protein LOC103971407    262   7e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB13152.1|  hypothetical protein B456_002G059600                    261   9e-78    Gossypium raimondii
ref|XP_007024146.1|  Uncharacterized protein isoform 1                  261   1e-77    
ref|XP_009151092.1|  PREDICTED: uncharacterized protein LOC103874418    260   3e-77    Brassica rapa
emb|CDX88193.1|  BnaA06g27840D                                          260   3e-77    
ref|XP_010938806.1|  PREDICTED: uncharacterized protein LOC105057803    258   3e-77    
ref|XP_010049074.1|  PREDICTED: uncharacterized protein LOC104437750    257   6e-77    
ref|XP_008362707.1|  PREDICTED: uncharacterized protein LOC103426...    258   1e-76    
gb|KDP34224.1|  hypothetical protein JCGZ_07795                         258   1e-76    Jatropha curcas
ref|XP_007225191.1|  hypothetical protein PRUPE_ppa002131mg             257   2e-76    Prunus persica
ref|XP_008362706.1|  PREDICTED: uncharacterized protein LOC103426...    258   2e-76    
gb|KCW81524.1|  hypothetical protein EUGRSUZ_C02885                     257   3e-76    Eucalyptus grandis [rose gum]
ref|XP_008220000.1|  PREDICTED: uncharacterized protein LOC103320143    256   6e-76    Prunus mume [ume]
ref|XP_004172478.1|  PREDICTED: uncharacterized protein LOC101231290    255   9e-76    
ref|XP_008378117.1|  PREDICTED: uncharacterized protein LOC103441188    255   1e-75    
ref|XP_004150356.1|  PREDICTED: uncharacterized protein LOC101203914    255   1e-75    Cucumis sativus [cucumbers]
ref|XP_008447501.1|  PREDICTED: uncharacterized protein LOC103489933    254   3e-75    Cucumis melo [Oriental melon]
ref|XP_009368022.1|  PREDICTED: uncharacterized protein LOC103957563    254   3e-75    Pyrus x bretschneideri [bai li]
ref|XP_009338711.1|  PREDICTED: uncharacterized protein LOC103931028    254   3e-75    Pyrus x bretschneideri [bai li]
ref|XP_010667633.1|  PREDICTED: uncharacterized protein LOC104884...    253   4e-75    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004501198.1|  PREDICTED: uncharacterized protein LOC101510604    253   6e-75    
ref|XP_007024149.1|  Uncharacterized protein isoform 4                  254   7e-75    
emb|CDX80528.1|  BnaC07g29160D                                          253   8e-75    
emb|CDP18480.1|  unnamed protein product                                253   1e-74    Coffea canephora [robusta coffee]
ref|XP_010112163.1|  hypothetical protein L484_019902                   254   2e-74    
emb|CBI36151.3|  unnamed protein product                                247   3e-74    Vitis vinifera
ref|XP_008228519.1|  PREDICTED: uncharacterized protein LOC103327921    247   3e-74    Prunus mume [ume]
ref|XP_008393906.1|  PREDICTED: uncharacterized protein LOC103456054    251   4e-74    
ref|XP_009345256.1|  PREDICTED: uncharacterized protein LOC103937065    250   1e-73    
ref|XP_011089542.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    250   1e-73    
ref|XP_004150357.1|  PREDICTED: uncharacterized protein LOC101204163    249   1e-73    
gb|KGN58062.1|  hypothetical protein Csa_3G481220                       250   1e-73    Cucumis sativus [cucumbers]
ref|XP_004169923.1|  PREDICTED: uncharacterized LOC101204163            249   2e-73    
ref|XP_010691307.1|  PREDICTED: uncharacterized protein LOC104904665    250   3e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004141776.1|  PREDICTED: uncharacterized protein LOC101222402    248   4e-73    Cucumis sativus [cucumbers]
gb|KDO79698.1|  hypothetical protein CISIN_1g004600mg                   248   6e-73    Citrus sinensis [apfelsine]
ref|XP_006450611.1|  hypothetical protein CICLE_v10007564mg             248   6e-73    Citrus clementina [clementine]
ref|XP_006476157.1|  PREDICTED: myosin-9-like                           248   6e-73    Citrus sinensis [apfelsine]
ref|XP_008462152.1|  PREDICTED: uncharacterized protein LOC103500575    248   8e-73    Cucumis melo [Oriental melon]
ref|XP_008775372.1|  PREDICTED: uncharacterized protein LOC103695745    243   4e-72    Phoenix dactylifera
gb|EPS57690.1|  hypothetical protein M569_17127                         231   2e-71    Genlisea aurea
ref|XP_008776462.1|  PREDICTED: uncharacterized protein LOC103696569    235   2e-71    
ref|XP_010519919.1|  PREDICTED: uncharacterized protein LOC104799211    244   4e-71    Tarenaya hassleriana [spider flower]
ref|XP_008342705.1|  PREDICTED: uncharacterized protein LOC103405477    243   5e-71    
emb|CDX87081.1|  BnaC09g03960D                                          238   9e-71    
ref|XP_008799874.1|  PREDICTED: uncharacterized protein LOC103714416    239   1e-70    Phoenix dactylifera
ref|XP_010907260.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    242   2e-70    
ref|XP_010931963.1|  PREDICTED: uncharacterized protein LOC105052734    240   7e-70    Elaeis guineensis
emb|CAN72109.1|  hypothetical protein VITISV_044047                     239   2e-69    Vitis vinifera
ref|XP_002516075.1|  conserved hypothetical protein                     238   2e-69    Ricinus communis
ref|XP_008447502.1|  PREDICTED: uncharacterized protein LOC103489935    239   2e-69    Cucumis melo [Oriental melon]
gb|KDP37214.1|  hypothetical protein JCGZ_06270                         236   1e-68    Jatropha curcas
ref|XP_008808244.1|  PREDICTED: uncharacterized protein LOC103720359    234   2e-67    Phoenix dactylifera
gb|EMT28812.1|  hypothetical protein F775_16807                         224   2e-66    
gb|KFK27812.1|  hypothetical protein AALP_AA8G433100                    229   2e-65    Arabis alpina [alpine rockcress]
gb|EMS56206.1|  hypothetical protein TRIUR3_11325                       222   3e-65    Triticum urartu
gb|EYU29268.1|  hypothetical protein MIMGU_mgv1a002196mg                226   9e-65    Erythranthe guttata [common monkey flower]
ref|XP_006394813.1|  hypothetical protein EUTSA_v10003682mg             225   3e-64    Eutrema salsugineum [saltwater cress]
gb|EMT20964.1|  hypothetical protein F775_31339                         213   4e-64    
ref|XP_009393120.1|  PREDICTED: uncharacterized protein LOC103978894    221   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006658396.1|  PREDICTED: uncharacterized protein LOC102701368    216   2e-63    
ref|NP_197941.1|  uncharacterized protein                               223   4e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874269.1|  hypothetical protein ARALYDRAFT_910621             222   5e-63    
dbj|BAJ96225.1|  predicted protein                                      221   6e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS63249.1|  hypothetical protein TRIUR3_24469                       210   8e-63    Triticum urartu
ref|XP_006655291.1|  PREDICTED: uncharacterized protein LOC102706661    216   6e-62    
ref|XP_010421421.1|  PREDICTED: DNA ligase 1-like isoform X2            218   1e-61    Camelina sativa [gold-of-pleasure]
ref|XP_006287097.1|  hypothetical protein CARUB_v10000261mg             218   1e-61    Capsella rubella
ref|XP_010421420.1|  PREDICTED: DNA ligase 1-like isoform X1            218   1e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010421422.1|  PREDICTED: DNA ligase 1-like isoform X3            218   2e-61    Camelina sativa [gold-of-pleasure]
emb|CDM83169.1|  unnamed protein product                                211   2e-61    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010454904.1|  PREDICTED: ABC transporter F family member 4...    217   4e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010493822.1|  PREDICTED: DNA ligase 1-like                       217   5e-61    Camelina sativa [gold-of-pleasure]
ref|XP_010228227.1|  PREDICTED: formin-like protein 5                   214   2e-60    
gb|EEE63626.1|  hypothetical protein OsJ_18443                          213   3e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EEE66795.1|  hypothetical protein OsJ_23540                          211   4e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002457866.1|  hypothetical protein SORBIDRAFT_03g017350          202   5e-60    
gb|EAZ03209.1|  hypothetical protein OsI_25359                          211   7e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_010033880.1|  PREDICTED: uncharacterized protein LOC104423116    212   1e-59    Eucalyptus grandis [rose gum]
gb|AAT93897.1|  unknown protein                                         213   1e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EEC79170.1|  hypothetical protein OsI_19854                          211   1e-59    Oryza sativa Indica Group [Indian rice]
dbj|BAC16409.1|  putative bZIP protein                                  211   3e-59    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94711.1|  predicted protein                                      211   4e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM82883.1|  unnamed protein product                                211   6e-59    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ96409.1|  predicted protein                                      210   1e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT10854.1|  hypothetical protein F775_26145                         207   3e-58    
ref|XP_006826988.1|  hypothetical protein AMTR_s00010p00207960          207   5e-58    Amborella trichopoda
ref|XP_003568507.1|  PREDICTED: ras and Rab interactor 3                207   8e-58    Brachypodium distachyon [annual false brome]
gb|EMS61963.1|  hypothetical protein TRIUR3_31953                       206   2e-57    Triticum urartu
ref|NP_001172370.1|  Os01g0500550                                       206   3e-57    
gb|EEC70709.1|  hypothetical protein OsI_02082                          206   3e-57    Oryza sativa Indica Group [Indian rice]
ref|XP_010254134.1|  PREDICTED: uncharacterized protein LOC104595215    205   4e-57    Nelumbo nucifera [Indian lotus]
gb|EPS58005.1|  hypothetical protein M569_16812                         195   5e-57    Genlisea aurea
ref|XP_002439756.1|  hypothetical protein SORBIDRAFT_09g019490          204   1e-56    
ref|XP_010249763.1|  PREDICTED: uncharacterized protein LOC104592...    203   1e-56    
ref|NP_001169630.1|  hypothetical protein                               204   2e-56    Zea mays [maize]
ref|XP_010249762.1|  PREDICTED: uncharacterized protein LOC104592...    203   2e-56    Nelumbo nucifera [Indian lotus]
emb|CBI20923.3|  unnamed protein product                                195   3e-55    Vitis vinifera
ref|XP_010667640.1|  PREDICTED: uncharacterized protein LOC104884...    197   1e-54    
ref|XP_003567735.1|  PREDICTED: uncharacterized protein LOC100824905    198   2e-54    Brachypodium distachyon [annual false brome]
ref|XP_008652191.1|  PREDICTED: uncharacterized protein LOC103632124    197   4e-54    Zea mays [maize]
ref|XP_004506851.1|  PREDICTED: uncharacterized protein LOC101489547    195   4e-54    Cicer arietinum [garbanzo]
ref|XP_004968820.1|  PREDICTED: uncharacterized protein LOC101757982    196   1e-53    Setaria italica
ref|XP_006644200.1|  PREDICTED: uncharacterized protein LOC102708565    195   2e-53    
ref|XP_004955806.1|  PREDICTED: uncharacterized protein LOC101763037    194   6e-53    
ref|XP_002461680.1|  hypothetical protein SORBIDRAFT_02g006420          194   7e-53    Sorghum bicolor [broomcorn]
ref|NP_001168451.1|  uncharacterized protein LOC100382224               193   8e-53    Zea mays [maize]
gb|AFW82165.1|  hypothetical protein ZEAMMB73_214762                    192   1e-52    
ref|XP_009398982.1|  PREDICTED: uncharacterized protein LOC103983491    185   6e-50    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009786427.1|  PREDICTED: uncharacterized protein LOC104234...    172   2e-45    Nicotiana sylvestris
gb|ABR18011.1|  unknown                                                 171   3e-45    Picea sitchensis
ref|XP_003604444.1|  hypothetical protein MTR_4g012430                  165   2e-43    
ref|XP_009628246.1|  PREDICTED: uncharacterized protein LOC104118...    164   8e-43    
ref|XP_010479739.1|  PREDICTED: uncharacterized protein LOC104758551    161   1e-41    Camelina sativa [gold-of-pleasure]
gb|AES86641.2|  BZIP protein                                            154   1e-39    Medicago truncatula
ref|XP_008352156.1|  PREDICTED: uncharacterized protein LOC103415623    143   5e-36    
gb|ABK95129.1|  unknown                                                 124   3e-31    Populus trichocarpa [western balsam poplar]
ref|XP_009391172.1|  PREDICTED: ras and EF-hand domain-containing...    120   7e-27    
ref|XP_011093240.1|  PREDICTED: uncharacterized protein LOC105173250    120   7e-27    Sesamum indicum [beniseed]
ref|XP_007134473.1|  hypothetical protein PHAVU_010G050100g             119   3e-26    Phaseolus vulgaris [French bean]
ref|XP_010941314.1|  PREDICTED: uncharacterized protein LOC105059637    117   7e-26    Elaeis guineensis
ref|XP_004166130.1|  PREDICTED: uncharacterized LOC101224117            112   8e-26    
gb|KHN00204.1|  hypothetical protein glysoja_034735                     114   9e-26    Glycine soja [wild soybean]
ref|XP_006576720.1|  PREDICTED: uncharacterized protein LOC100792843    115   3e-25    Glycine max [soybeans]
ref|XP_010113322.1|  hypothetical protein L484_026653                   114   8e-25    Morus notabilis
ref|XP_007204230.1|  hypothetical protein PRUPE_ppa002657mg             114   8e-25    
ref|XP_008459782.1|  PREDICTED: uncharacterized protein LOC103498813    114   1e-24    Cucumis melo [Oriental melon]
ref|XP_010935104.1|  PREDICTED: uncharacterized protein LOC105055091    112   1e-24    
gb|EYU30808.1|  hypothetical protein MIMGU_mgv1a0195871mg               109   1e-24    Erythranthe guttata [common monkey flower]
ref|XP_006856770.1|  hypothetical protein AMTR_s00055p00070380          112   2e-24    
ref|XP_011099873.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   2e-24    
emb|CDP09433.1|  unnamed protein product                                112   4e-24    Coffea canephora [robusta coffee]
gb|KGN46505.1|  hypothetical protein Csa_6G104620                       112   4e-24    Cucumis sativus [cucumbers]
gb|KJB22870.1|  hypothetical protein B456_004G070400                    112   4e-24    Gossypium raimondii
ref|XP_006445430.1|  hypothetical protein CICLE_v10018930mg             112   5e-24    Citrus clementina [clementine]
ref|XP_007139641.1|  hypothetical protein PHAVU_008G046800g             112   5e-24    Phaseolus vulgaris [French bean]
ref|XP_006464424.1|  PREDICTED: uncharacterized protein LOC102627291    112   5e-24    
gb|KDO85511.1|  hypothetical protein CISIN_1g040600mg                   112   5e-24    Citrus sinensis [apfelsine]
ref|XP_010679893.1|  PREDICTED: uncharacterized protein LOC104895159    111   5e-24    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010919721.1|  PREDICTED: uncharacterized protein LOC105043738    112   5e-24    Elaeis guineensis
gb|ABP88223.1|  transcription factor bZIP54                             103   6e-24    Glycine max [soybeans]
ref|NP_171713.2|  uncharacterized protein                               111   6e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011089387.1|  PREDICTED: uncharacterized protein LOC105170351    112   6e-24    Sesamum indicum [beniseed]
ref|XP_010089322.1|  hypothetical protein L484_021854                   111   1e-23    
ref|XP_004492935.1|  PREDICTED: uncharacterized protein LOC101510124    111   1e-23    Cicer arietinum [garbanzo]
ref|XP_008813601.1|  PREDICTED: uncharacterized protein LOC103724193    110   2e-23    Phoenix dactylifera
gb|EYU42344.1|  hypothetical protein MIMGU_mgv1a020945mg                110   2e-23    Erythranthe guttata [common monkey flower]
ref|XP_002511585.1|  conserved hypothetical protein                     110   2e-23    Ricinus communis
ref|XP_006306896.1|  hypothetical protein CARUB_v10008455mg             110   2e-23    
gb|EPS68751.1|  hypothetical protein M569_06016                         110   2e-23    Genlisea aurea
gb|KDP28858.1|  hypothetical protein JCGZ_14629                         110   2e-23    Jatropha curcas
ref|XP_009383946.1|  PREDICTED: uncharacterized protein LOC103971612    110   2e-23    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN40553.1|  hypothetical protein glysoja_001051                     105   3e-23    Glycine soja [wild soybean]
ref|NP_190697.2|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1       109   3e-23    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008835.1|  PREDICTED: uncharacterized protein LOC105114109    109   3e-23    Populus euphratica
ref|XP_010275436.1|  PREDICTED: uncharacterized protein LOC104610494    109   3e-23    Nelumbo nucifera [Indian lotus]
ref|XP_002990611.1|  hypothetical protein SELMODRAFT_10621              109   3e-23    
ref|XP_010258777.1|  PREDICTED: uncharacterized protein LOC104598423    109   3e-23    Nelumbo nucifera [Indian lotus]
ref|XP_002968724.1|  hypothetical protein SELMODRAFT_145899             109   4e-23    
ref|XP_008352431.1|  PREDICTED: uncharacterized protein LOC103415926    108   4e-23    
ref|NP_001190052.1|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1    109   4e-23    Arabidopsis thaliana [mouse-ear cress]
gb|KEH17841.1|  BZIP transcription factor bZIP80, putative              108   5e-23    Medicago truncatula
ref|XP_006425413.1|  hypothetical protein CICLE_v10025182mg             108   5e-23    Citrus clementina [clementine]
ref|XP_006660902.1|  PREDICTED: uncharacterized protein LOC102703332    106   5e-23    
gb|KFK35242.1|  hypothetical protein AALP_AA5G258900                    108   6e-23    Arabis alpina [alpine rockcress]
ref|XP_010426683.1|  PREDICTED: uncharacterized protein LOC104711...    108   6e-23    Camelina sativa [gold-of-pleasure]
ref|XP_006466986.1|  PREDICTED: uncharacterized protein LOC102630487    108   6e-23    Citrus sinensis [apfelsine]
ref|XP_009398488.1|  PREDICTED: uncharacterized protein LOC103983...    108   6e-23    
ref|XP_009133690.1|  PREDICTED: uncharacterized protein LOC103858146    108   6e-23    Brassica rapa
ref|XP_009398490.1|  PREDICTED: uncharacterized protein LOC103983...    108   6e-23    
ref|XP_010503820.1|  PREDICTED: uncharacterized protein LOC104780964    108   6e-23    Camelina sativa [gold-of-pleasure]
ref|XP_007052313.1|  BZIP domain class transcription factor             108   7e-23    
ref|XP_010426682.1|  PREDICTED: uncharacterized protein LOC104711...    108   7e-23    Camelina sativa [gold-of-pleasure]
emb|CAN79228.1|  hypothetical protein VITISV_011041                     108   7e-23    Vitis vinifera
ref|XP_010692050.1|  PREDICTED: uncharacterized protein LOC104905271    108   8e-23    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002273471.2|  PREDICTED: uncharacterized protein LOC100266818    108   8e-23    Vitis vinifera
ref|XP_006380598.1|  proline-rich family protein                        108   8e-23    
ref|XP_008365863.1|  PREDICTED: uncharacterized protein LOC103429493    108   8e-23    
ref|XP_010515532.1|  PREDICTED: uncharacterized protein LOC104791366    108   8e-23    Camelina sativa [gold-of-pleasure]
ref|XP_004229746.1|  PREDICTED: uncharacterized protein LOC101257405    108   8e-23    Solanum lycopersicum
ref|XP_004515356.1|  PREDICTED: uncharacterized protein LOC101490151    108   9e-23    Cicer arietinum [garbanzo]
ref|XP_009363473.1|  PREDICTED: uncharacterized protein LOC103953463    108   9e-23    Pyrus x bretschneideri [bai li]
emb|CDX73734.1|  BnaC08g22690D                                          107   9e-23    
ref|XP_002526611.1|  conserved hypothetical protein                     108   9e-23    Ricinus communis
ref|XP_008370338.1|  PREDICTED: uncharacterized protein LOC103433829    107   1e-22    
ref|XP_002529641.1|  conserved hypothetical protein                     107   1e-22    Ricinus communis
gb|EYU31892.1|  hypothetical protein MIMGU_mgv1a0019612mg               107   1e-22    Erythranthe guttata [common monkey flower]
gb|KFK42583.1|  hypothetical protein AALP_AA1G014300                    107   1e-22    Arabis alpina [alpine rockcress]
ref|XP_009379364.1|  PREDICTED: uncharacterized protein LOC103967785    107   1e-22    Pyrus x bretschneideri [bai li]
ref|XP_006397664.1|  hypothetical protein EUTSA_v10001315mg             108   1e-22    Eutrema salsugineum [saltwater cress]
gb|KFK37283.1|  hypothetical protein AALP_AA4G237000                    107   1e-22    Arabis alpina [alpine rockcress]
gb|KEH23438.1|  BZIP transcription factor bZIP80                        107   2e-22    Medicago truncatula
ref|XP_009115808.1|  PREDICTED: uncharacterized protein LOC103841050    107   2e-22    Brassica rapa
ref|XP_006290733.1|  hypothetical protein CARUB_v10016827mg             107   2e-22    Capsella rubella
ref|XP_004957489.1|  PREDICTED: uncharacterized protein LOC101781416    107   2e-22    Setaria italica
ref|XP_011032057.1|  PREDICTED: uncharacterized protein LOC105131006    107   2e-22    Populus euphratica
dbj|BAD34385.1|  hypothetical protein                                   103   2e-22    Oryza sativa Japonica Group [Japonica rice]
gb|ABI34654.1|  bZIP transcription factor bZIP80                        104   2e-22    Glycine max [soybeans]
gb|KFK34370.1|  hypothetical protein AALP_AA5G136500                    106   2e-22    Arabis alpina [alpine rockcress]
ref|XP_002892025.1|  proline-rich family protein                        106   3e-22    
ref|XP_008643472.1|  PREDICTED: uncharacterized protein LOC100381...    107   3e-22    Zea mays [maize]
ref|XP_010524436.1|  PREDICTED: uncharacterized protein LOC104802494    107   3e-22    Tarenaya hassleriana [spider flower]
ref|XP_008808616.1|  PREDICTED: uncharacterized protein LOC103720605    105   3e-22    Phoenix dactylifera
ref|XP_006402594.1|  hypothetical protein EUTSA_v10005793mg             107   3e-22    
ref|XP_006403933.1|  hypothetical protein EUTSA_v10010132mg             106   3e-22    
ref|XP_002467482.1|  hypothetical protein SORBIDRAFT_01g028920          106   3e-22    Sorghum bicolor [broomcorn]
ref|XP_009373242.1|  PREDICTED: uncharacterized protein LOC103962279    104   4e-22    Pyrus x bretschneideri [bai li]
ref|XP_002881983.1|  predicted protein                                  106   4e-22    Arabidopsis lyrata subsp. lyrata
gb|EAY79532.1|  hypothetical protein OsI_34661                          106   5e-22    Oryza sativa Indica Group [Indian rice]
ref|NP_001065395.1|  Os10g0562700                                       106   5e-22    
gb|KHG20396.1|  Ferric uptake regulation                                106   5e-22    Gossypium arboreum [tree cotton]
ref|XP_008377795.1|  PREDICTED: uncharacterized protein LOC103440873    102   6e-22    
ref|XP_010544575.1|  PREDICTED: uncharacterized protein LOC104817191    105   8e-22    Tarenaya hassleriana [spider flower]
ref|XP_010518090.1|  PREDICTED: uncharacterized protein LOC104793437    105   8e-22    Camelina sativa [gold-of-pleasure]
ref|XP_011043178.1|  PREDICTED: uncharacterized protein LOC105138705    105   8e-22    Populus euphratica
emb|CBI37845.3|  unnamed protein product                                105   8e-22    Vitis vinifera
ref|XP_006418489.1|  hypothetical protein EUTSA_v10006946mg             105   9e-22    Eutrema salsugineum [saltwater cress]
ref|XP_006837374.1|  hypothetical protein AMTR_s00111p00120840          105   9e-22    
ref|XP_010506417.1|  PREDICTED: uncharacterized protein LOC104783037    105   9e-22    
ref|XP_010508243.1|  PREDICTED: uncharacterized protein LOC104784850    105   1e-21    
ref|NP_001175961.1|  Os09g0538750                                       102   1e-21    
gb|KDP24001.1|  hypothetical protein JCGZ_25389                         104   1e-21    
ref|XP_002986032.1|  hypothetical protein SELMODRAFT_425043             105   1e-21    
ref|XP_010646704.1|  PREDICTED: uncharacterized protein LOC100243514    104   1e-21    
ref|XP_009796808.1|  PREDICTED: uncharacterized protein LOC104243329    104   2e-21    
ref|XP_010512348.1|  PREDICTED: uncharacterized protein LOC104788305    104   2e-21    
ref|XP_004140629.1|  PREDICTED: uncharacterized protein LOC101219960    104   2e-21    
ref|XP_006402593.1|  hypothetical protein EUTSA_v10005793mg             104   2e-21    
ref|XP_010469198.1|  PREDICTED: uncharacterized protein LOC104749302    104   2e-21    
ref|XP_009411587.1|  PREDICTED: uncharacterized protein LOC103993301    104   2e-21    
ref|XP_009796082.1|  PREDICTED: uncharacterized protein LOC104242706    104   2e-21    
ref|XP_009355694.1|  PREDICTED: uncharacterized protein LOC103946664    104   2e-21    
ref|XP_011017344.1|  PREDICTED: protein virilizer homolog               104   2e-21    
ref|XP_008347510.1|  PREDICTED: uncharacterized protein LOC103410601    102   2e-21    
ref|XP_003578529.1|  PREDICTED: uncharacterized protein LOC100833837    103   2e-21    
ref|XP_006587779.1|  PREDICTED: uncharacterized protein LOC778134       104   2e-21    
gb|EPS68914.1|  hypothetical protein M569_05851                         103   3e-21    
ref|XP_008385303.1|  PREDICTED: uncharacterized protein LOC103447...    103   3e-21    
ref|XP_010265980.1|  PREDICTED: uncharacterized protein LOC104603617    103   3e-21    
ref|XP_009373221.1|  PREDICTED: uncharacterized protein LOC103962259    103   3e-21    
ref|NP_001280829.1|  uncharacterized LOC103447875                       103   3e-21    
ref|XP_002460581.1|  hypothetical protein SORBIDRAFT_02g031210          103   4e-21    
ref|XP_009624469.1|  PREDICTED: uncharacterized protein LOC104115517    103   4e-21    
ref|XP_009612588.1|  PREDICTED: uncharacterized protein LOC104105875    103   4e-21    
ref|XP_006375135.1|  hypothetical protein POPTR_0014s04670g             103   4e-21    
gb|EEE70131.1|  hypothetical protein OsJ_30161                          102   4e-21    
gb|EMT28305.1|  hypothetical protein F775_06020                         102   4e-21    
ref|XP_006293710.1|  hypothetical protein CARUB_v10022668mg             103   5e-21    
gb|EEC84963.1|  hypothetical protein OsI_32200                          102   5e-21    
emb|CDY42691.1|  BnaC04g22150D                                          103   5e-21    
gb|EMT24541.1|  hypothetical protein F775_19967                         102   5e-21    
ref|XP_006347962.1|  PREDICTED: uncharacterized protein LOC102598946    103   5e-21    
ref|XP_010550476.1|  PREDICTED: uncharacterized protein LOC104821337    102   6e-21    
ref|XP_010479355.1|  PREDICTED: uncharacterized protein LOC104758214    102   6e-21    
dbj|BAK03784.1|  predicted protein                                      102   6e-21    
emb|CDY56992.1|  BnaA04g27330D                                          102   6e-21    
ref|XP_006383089.1|  hypothetical protein POPTR_0005s11440g             102   7e-21    
ref|XP_006293711.1|  hypothetical protein CARUB_v10022668mg             102   7e-21    
ref|XP_007046645.1|  Uncharacterized protein TCM_000170                 102   7e-21    
gb|EMS48593.1|  hypothetical protein TRIUR3_22003                       102   7e-21    
emb|CDX83412.1|  BnaA03g20940D                                          102   8e-21    
ref|XP_010413572.1|  PREDICTED: uncharacterized protein LOC104699875    102   8e-21    
ref|XP_008232519.1|  PREDICTED: uncharacterized protein DDB_G0284...    102   9e-21    
ref|XP_009138843.1|  PREDICTED: uncharacterized protein LOC103862890    102   9e-21    
emb|CDX95620.1|  BnaC03g25010D                                          102   1e-20    
ref|XP_007157896.1|  hypothetical protein PHAVU_002G106900g             102   1e-20    
gb|KJB24877.1|  hypothetical protein B456_004G165900                    102   1e-20    
ref|XP_010052798.1|  PREDICTED: uncharacterized protein LOC104441367    102   1e-20    
gb|AFW87853.1|  hypothetical protein ZEAMMB73_997437                    101   2e-20    
ref|XP_010496466.1|  PREDICTED: uncharacterized protein LOC104773...    101   2e-20    
ref|NP_001145796.1|  hypothetical protein                               101   2e-20    
gb|KHG10277.1|  hypothetical protein F383_08644                         101   2e-20    
ref|XP_004969399.1|  PREDICTED: uncharacterized protein LOC101757...    101   2e-20    
ref|XP_007220261.1|  hypothetical protein PRUPE_ppa001262mg             101   2e-20    
ref|NP_001146678.1|  uncharacterized protein LOC100280278               100   2e-20    
emb|CBI17341.3|  unnamed protein product                                100   2e-20    
ref|XP_010033513.1|  PREDICTED: uncharacterized protein LOC104422784    100   2e-20    
ref|XP_008658472.1|  PREDICTED: uncharacterized protein LOC100279...    101   2e-20    
ref|XP_010496700.1|  PREDICTED: uncharacterized protein LOC104773746  98.2    2e-20    
ref|XP_008651371.1|  PREDICTED: uncharacterized protein LOC100280...    100   2e-20    
ref|XP_006340943.1|  PREDICTED: uncharacterized protein LOC102600978    100   3e-20    
ref|XP_011046654.1|  PREDICTED: uncharacterized protein LOC105141197    100   3e-20    
ref|XP_011462170.1|  PREDICTED: uncharacterized protein LOC105350878    100   3e-20    
ref|XP_006290620.1|  hypothetical protein CARUB_v10016712mg             100   3e-20    
ref|XP_002305530.1|  hypothetical protein POPTR_0004s18350g             100   3e-20    
ref|XP_010496465.1|  PREDICTED: uncharacterized protein LOC104773...    100   4e-20    
ref|XP_002521270.1|  conserved hypothetical protein                     100   4e-20    
dbj|BAJ93020.1|  predicted protein                                    99.8    4e-20    
dbj|BAJ88203.1|  predicted protein                                      100   5e-20    
ref|XP_009783506.1|  PREDICTED: uncharacterized protein LOC104232105    100   5e-20    
emb|CAN62559.1|  hypothetical protein VITISV_009207                   99.8    5e-20    
ref|XP_002989601.1|  hypothetical protein SELMODRAFT_447743             100   5e-20    
gb|KJB40973.1|  hypothetical protein B456_007G085700                    100   5e-20    
ref|XP_010649002.1|  PREDICTED: uncharacterized protein LOC100245...  99.8    5e-20    
ref|XP_008344422.1|  PREDICTED: uncharacterized protein LOC103407257    100   5e-20    
gb|KDP33297.1|  hypothetical protein JCGZ_13084                         100   5e-20    
gb|EMS65961.1|  hypothetical protein TRIUR3_15371                     98.6    6e-20    
ref|XP_010649000.1|  PREDICTED: uncharacterized protein LOC100245...  99.8    6e-20    
ref|XP_004134851.1|  PREDICTED: uncharacterized protein LOC101220098  99.4    7e-20    
ref|XP_008457723.1|  PREDICTED: uncharacterized protein LOC103497347  99.8    7e-20    
ref|XP_002301229.1|  hypothetical protein POPTR_0002s13850g           99.8    7e-20    
ref|XP_001762208.1|  predicted protein                                99.4    7e-20    
ref|XP_010235002.1|  PREDICTED: uncharacterized protein LOC100823...  99.4    7e-20    
ref|XP_008440844.1|  PREDICTED: uncharacterized protein LOC103485...  99.4    8e-20    
ref|XP_008440843.1|  PREDICTED: uncharacterized protein LOC103485...  99.4    8e-20    
gb|KGN48936.1|  hypothetical protein Csa_6G507110                     99.4    8e-20    
emb|CDP01871.1|  unnamed protein product                              99.4    8e-20    
ref|XP_006573547.1|  PREDICTED: uncharacterized protein LOC102662030  99.4    8e-20    
ref|XP_006486545.1|  PREDICTED: uncharacterized protein LOC102622893  97.1    9e-20    
ref|XP_003574338.1|  PREDICTED: uncharacterized protein LOC100823...  99.4    1e-19    
ref|XP_008236050.1|  PREDICTED: uncharacterized protein LOC103334853  96.7    1e-19    
ref|XP_010316432.1|  PREDICTED: uncharacterized protein LOC101264882  98.6    1e-19    
ref|XP_009358153.1|  PREDICTED: uncharacterized protein LOC103948808  98.6    2e-19    
ref|XP_006448941.1|  hypothetical protein CICLE_v10014533mg           98.2    2e-19    
gb|AAN05792.1|  unknown                                               97.4    3e-19    
ref|XP_002878328.1|  DNA binding protein                              97.8    3e-19    
gb|KJB17616.1|  hypothetical protein B456_003G008100                  97.1    4e-19    
ref|XP_004512154.1|  PREDICTED: uncharacterized protein LOC101508512  97.4    4e-19    
ref|XP_009358043.1|  PREDICTED: uncharacterized protein LOC103948707  97.4    4e-19    
ref|XP_002530629.1|  conserved hypothetical protein                   97.4    4e-19    
ref|XP_006468274.1|  PREDICTED: uncharacterized protein LOC102624...  97.1    4e-19    
gb|KJB40156.1|  hypothetical protein B456_007G049300                  97.1    5e-19    
ref|XP_009358050.1|  PREDICTED: uncharacterized protein LOC103948716  97.4    5e-19    
emb|CDX71821.1|  BnaC08g30530D                                        97.1    5e-19    
ref|XP_006468273.1|  PREDICTED: uncharacterized protein LOC102624...  97.1    5e-19    
ref|XP_009589344.1|  PREDICTED: uncharacterized protein LOC104086728  97.1    6e-19    
gb|EPS64716.1|  hypothetical protein M569_10064                       96.7    8e-19    
gb|KHG27172.1|  Holliday junction ATP-dependent DNA helicase RuvB     96.3    9e-19    
ref|XP_010465893.1|  PREDICTED: uncharacterized protein LOC104746...  95.9    1e-18    
gb|KHG27804.1|  hypothetical protein F383_01358                       95.5    1e-18    
ref|XP_010465886.1|  PREDICTED: uncharacterized protein LOC104746...  95.5    1e-18    
gb|KJB15855.1|  hypothetical protein B456_002G199800                  95.9    1e-18    
emb|CDY41178.1|  BnaA09g38370D                                        95.9    1e-18    
ref|XP_009116713.1|  PREDICTED: uncharacterized protein LOC103841881  95.9    1e-18    
gb|KHG14505.1|  Pyridoxal-phosphate-dependent serine hydroxymethy...  95.5    1e-18    
ref|XP_009418803.1|  PREDICTED: uncharacterized protein LOC103998915  95.5    1e-18    
ref|XP_006367871.1|  PREDICTED: uncharacterized protein LOC102582747  95.9    1e-18    
emb|CDX77992.1|  BnaA09g31870D                                        95.5    2e-18    
ref|XP_010266884.1|  PREDICTED: uncharacterized protein LOC104604293  95.5    2e-18    
ref|XP_010266047.1|  PREDICTED: uncharacterized protein LOC104603664  95.1    3e-18    
ref|XP_007201549.1|  hypothetical protein PRUPE_ppa017556mg           95.1    3e-18    
gb|EAY74707.1|  hypothetical protein OsI_02600                        94.7    3e-18    
gb|EEE54881.1|  hypothetical protein OsJ_02382                        94.7    3e-18    
ref|NP_001043426.1|  Os01g0585600                                     94.7    3e-18    
ref|XP_003635164.1|  PREDICTED: uncharacterized protein LOC100855179  94.4    4e-18    
ref|XP_006644314.1|  PREDICTED: uncharacterized protein LOC102718120  94.0    5e-18    
ref|XP_011088630.1|  PREDICTED: uncharacterized protein LOC105169807  93.6    7e-18    
gb|EMT31600.1|  hypothetical protein F775_01622                       94.0    7e-18    
gb|KFK28273.1|  hypothetical protein AALP_AA8G495200                  92.8    1e-17    
ref|XP_002455853.1|  hypothetical protein SORBIDRAFT_03g026230        93.2    1e-17    
gb|KGN61947.1|  hypothetical protein Csa_2G271390                     93.2    1e-17    
ref|XP_010241199.1|  PREDICTED: uncharacterized protein LOC104585875  92.8    1e-17    
ref|XP_004147076.1|  PREDICTED: uncharacterized protein LOC101207270  92.8    1e-17    
ref|XP_010547414.1|  PREDICTED: formin-like protein 2 isoform X2      92.8    1e-17    
ref|XP_003612207.1|  hypothetical protein MTR_5g022530                92.4    2e-17    
ref|XP_011022260.1|  PREDICTED: uncharacterized protein LOC105124090  92.0    3e-17    
ref|XP_004290739.2|  PREDICTED: uncharacterized protein LOC101292471  91.7    3e-17    
ref|XP_010231954.1|  PREDICTED: uncharacterized protein LOC100827...  91.7    3e-17    
ref|XP_003569275.1|  PREDICTED: uncharacterized protein LOC100827...  91.7    3e-17    
ref|XP_006383045.1|  hypothetical protein POPTR_0005s11020g           91.7    3e-17    
ref|XP_010941533.1|  PREDICTED: uncharacterized protein LOC105059789  91.3    4e-17    
gb|KHG24815.1|  DNA ligase                                            91.3    5e-17    
ref|XP_008675404.1|  PREDICTED: uncharacterized protein LOC103651534  90.5    7e-17    
ref|XP_004231454.1|  PREDICTED: uncharacterized protein LOC101255743  90.5    7e-17    
gb|KJB17572.1|  hypothetical protein B456_003G006300                  89.7    8e-17    
ref|XP_008812622.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    1e-16    
gb|KJB17571.1|  hypothetical protein B456_003G006300                  89.7    1e-16    
ref|XP_002313698.2|  hypothetical protein POPTR_0009s13960g           89.7    1e-16    
gb|KJB17570.1|  hypothetical protein B456_003G006300                  89.7    1e-16    
ref|XP_006603964.1|  PREDICTED: uncharacterized protein LOC102664706  86.3    2e-16    
ref|XP_007041768.1|  Uncharacterized protein isoform 1                89.0    3e-16    
ref|XP_010028766.1|  PREDICTED: uncharacterized protein LOC104418979  88.6    4e-16    
ref|XP_011045822.1|  PREDICTED: uncharacterized protein LOC105140622  88.2    4e-16    
ref|XP_007041129.1|  Uncharacterized protein isoform 1                87.8    5e-16    
ref|XP_007046600.1|  Uncharacterized protein TCM_000136               87.8    5e-16    
ref|XP_010540216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  87.0    6e-16    
gb|EYU37975.1|  hypothetical protein MIMGU_mgv1a026155mg              87.8    6e-16    
ref|XP_007041131.1|  Uncharacterized protein isoform 3                87.8    6e-16    
gb|KDP34961.1|  hypothetical protein JCGZ_09249                       87.4    7e-16    
gb|EMS55915.1|  hypothetical protein TRIUR3_26441                     87.4    7e-16    
ref|XP_008444972.1|  PREDICTED: uncharacterized protein LOC103488153  86.7    1e-15    
ref|XP_010056962.1|  PREDICTED: uncharacterized protein LOC104444883  86.3    2e-15    
emb|CDP14548.1|  unnamed protein product                              86.3    2e-15    
ref|XP_006828819.1|  hypothetical protein AMTR_s00001p00134970        85.5    2e-15    
gb|KCW55583.1|  hypothetical protein EUGRSUZ_I01453                   85.5    3e-15    
emb|CAB87869.1|  bZIP protein                                         84.3    5e-15    
ref|NP_191591.2|  uncharacterized protein                             84.3    7e-15    
gb|EYU19135.1|  hypothetical protein MIMGU_mgv1a002741mg              84.0    8e-15    
ref|XP_004135735.1|  PREDICTED: uncharacterized protein LOC101216940  84.0    8e-15    
gb|KDP23957.1|  hypothetical protein JCGZ_25345                       84.0    1e-14    
emb|CBI16665.3|  unnamed protein product                              82.4    1e-14    
ref|XP_003576784.1|  PREDICTED: uncharacterized protein LOC100844006  83.6    1e-14    
ref|XP_006425369.1|  hypothetical protein CICLE_v10027576mg           83.6    2e-14    
ref|XP_008646006.1|  PREDICTED: uncharacterized protein LOC103627496  82.8    2e-14    
gb|KHN45577.1|  hypothetical protein glysoja_033556                   82.0    2e-14    
ref|XP_010086828.1|  hypothetical protein L484_006057                 82.8    3e-14    
ref|XP_010935171.1|  PREDICTED: uncharacterized protein LOC105055134  82.4    3e-14    
ref|XP_011092957.1|  PREDICTED: uncharacterized protein LOC105173018  82.4    3e-14    
ref|XP_006467173.1|  PREDICTED: uncharacterized protein LOC102606809  82.4    3e-14    
ref|XP_003547572.1|  PREDICTED: uncharacterized protein LOC100809...  82.0    4e-14    
ref|XP_010496482.1|  PREDICTED: uncharacterized protein LOC104773542  78.6    4e-14    
emb|CDP19649.1|  unnamed protein product                              81.6    5e-14    
ref|XP_010275925.1|  PREDICTED: uncharacterized protein LOC104610...  81.6    5e-14    
ref|XP_004289069.1|  PREDICTED: uncharacterized protein LOC101292260  81.6    5e-14    
gb|AAN01518.1|  bZIP-like protein                                     77.8    7e-14    
gb|KDO71340.1|  hypothetical protein CISIN_1g014022mg                 80.5    7e-14    
ref|XP_010519079.1|  PREDICTED: uncharacterized protein LOC104798610  80.9    8e-14    
ref|XP_007204798.1|  hypothetical protein PRUPE_ppa018170mg           81.3    9e-14    
dbj|BAD25321.1|  putative bZIP protein                                80.5    1e-13    
ref|XP_010540610.1|  PREDICTED: uncharacterized protein LOC104814319  80.9    1e-13    
ref|NP_001047613.2|  Os02g0654600                                     80.5    1e-13    
emb|CBI30984.3|  unnamed protein product                              80.5    1e-13    
gb|AAC24369.1|  bZIP-like protein                                     80.5    1e-13    
ref|XP_002274665.1|  PREDICTED: uncharacterized protein LOC100249833  80.5    1e-13    
ref|XP_004497191.1|  PREDICTED: uncharacterized protein LOC101502337  79.7    3e-13    
gb|AFG49741.1|  hypothetical protein CL3375Contig1_01                 73.2    3e-13    
ref|XP_008806165.1|  PREDICTED: uncharacterized protein LOC103718930  79.3    3e-13    
gb|ABI34689.1|  bZIP transcription factor bZIP79                      77.4    4e-13    
ref|XP_010113292.1|  hypothetical protein L484_026622                 79.0    4e-13    
gb|ABP88246.1|  transcription factor bZIP22                           74.7    4e-13    
ref|XP_008383425.1|  PREDICTED: uncharacterized protein LOC103446...  78.6    5e-13    
gb|KJB14759.1|  hypothetical protein B456_002G142000                  77.8    5e-13    
ref|XP_007142804.1|  hypothetical protein PHAVU_007G018200g           78.6    6e-13    
ref|XP_008383427.1|  PREDICTED: uncharacterized protein LOC103446...  78.6    6e-13    
gb|EEC73715.1|  hypothetical protein OsI_08319                        78.2    6e-13    
emb|CAC39057.1|  putative protein                                     78.2    6e-13    
ref|XP_003535757.1|  PREDICTED: uncharacterized protein LOC100801471  78.6    6e-13    
ref|XP_002986031.1|  hypothetical protein SELMODRAFT_425042           78.6    7e-13    
gb|KHN37389.1|  hypothetical protein glysoja_013604                   78.2    7e-13    
gb|KJB14751.1|  hypothetical protein B456_002G142000                  78.2    7e-13    
ref|XP_002989600.1|  hypothetical protein SELMODRAFT_428168           78.2    7e-13    
ref|XP_009399233.1|  PREDICTED: uncharacterized protein LOC103983692  77.8    9e-13    
gb|ABF69980.1|  hypothetical protein MA4_106O17.26                    77.8    9e-13    
gb|KHG11338.1|  Benzoyl-CoA reductase subunit C                       77.8    9e-13    
ref|XP_008383423.1|  PREDICTED: uncharacterized protein LOC103446128  77.4    1e-12    
ref|XP_007138530.1|  hypothetical protein PHAVU_009G217000g           77.4    1e-12    
ref|XP_007215312.1|  hypothetical protein PRUPE_ppa003521mg           77.0    1e-12    
emb|CAB62651.1|  putative protein                                     77.0    2e-12    
ref|XP_002876080.1|  proline-rich family protein                      76.6    2e-12    



>ref|XP_009786426.1| PREDICTED: uncharacterized protein LOC104234548 isoform X1 [Nicotiana 
sylvestris]
Length=756

 Score =   352 bits (902),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET+EHH+ERT QL VVVQEWHSQF+K++ HQK YI+ LN+WLKLNL+PIDTNLKEKVS
Sbjct  524  PKETTEHHHERTLQLYVVVQEWHSQFDKLVTHQKHYIKALNNWLKLNLIPIDTNLKEKVS  583

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SPQRPQ PPIL+L+HAW D + KLPDELA+TAIY+FSAV+NTI ++Q +EMKLKDRC+DT
Sbjct  584  SPQRPQTPPILSLIHAWHDYLDKLPDELARTAIYNFSAVINTIFEYQKEEMKLKDRCEDT  643

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+EL K+TR++EDWYHKYMQRRTP D+ + D  HED+ V++RQLQLEAL+++L++EEEAY
Sbjct  644  RRELNKKTRQYEDWYHKYMQRRTPPDEMDPDQAHEDSLVVDRQLQLEALRKKLEDEEEAY  703

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
             RQC+QVR KSLTSLR+ LPELF AMS+FS AC+ MY+ L SI    NR
Sbjct  704  QRQCLQVRDKSLTSLRSRLPELFEAMSDFSLACADMYRDLRSIAKHRNR  752



>ref|XP_009628236.1| PREDICTED: uncharacterized protein LOC104118644 isoform X1 [Nicotiana 
tomentosiformis]
Length=739

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 200/229 (87%), Gaps = 0/229 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET+EHH+ERT QL VVVQEWHSQF+K++ HQK+YI+ LN+WLKLNL+PIDTNLKEKVS
Sbjct  507  PKETTEHHHERTLQLYVVVQEWHSQFDKLVTHQKQYIKALNNWLKLNLIPIDTNLKEKVS  566

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SPQRPQNPPIL+L+HAW D + KLPDELA+TAIY+FSAV+NTI ++Q +EMKLKDRC+DT
Sbjct  567  SPQRPQNPPILSLIHAWHDYLDKLPDELARTAIYNFSAVINTIFEYQKEEMKLKDRCEDT  626

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+EL K+TR++EDWY ++MQRRTP D+ + D  H D+ V++RQLQLEAL+++L++EEEAY
Sbjct  627  RRELNKKTRQYEDWYQRHMQRRTPPDEMDPDQAHVDSLVVDRQLQLEALRKKLEDEEEAY  686

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
             RQC+QVR KSLTSLR+ LPELF AMSEFS AC+ MY+ L SI+   NR
Sbjct  687  QRQCLQVRDKSLTSLRSRLPELFGAMSEFSLACADMYRDLRSISKHRNR  735



>ref|XP_004235711.1| PREDICTED: uncharacterized protein LOC101250783 [Solanum lycopersicum]
Length=754

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET+EHH+ERT QL VVVQEWHSQF+K++I+QK+YI+ LN+WLKLNL+PIDTNLKEKVS
Sbjct  523  PKETTEHHHERTLQLYVVVQEWHSQFDKLVIYQKQYIKALNNWLKLNLIPIDTNLKEKVS  582

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SPQRPQNPPILAL+HAW D + KLPDELA+TAIY+FSAV+NTI ++Q +EMKL+DRC+DT
Sbjct  583  SPQRPQNPPILALIHAWHDDLEKLPDELARTAIYNFSAVINTIFEYQKEEMKLRDRCEDT  642

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+EL K+TR++EDWYHK+MQRR P D+ + +   ED  V++RQLQLEAL++RL++EE++Y
Sbjct  643  RRELNKKTRQYEDWYHKHMQRRIP-DEMDPESAQEDTLVVDRQLQLEALRKRLEDEEDSY  701

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
             RQC+QVR KSLTSLR+ LPELF AMSEFS AC+ MY+ L SI    NR
Sbjct  702  QRQCLQVRDKSLTSLRSRLPELFGAMSEFSLACADMYRDLRSIAKHRNR  750



>ref|XP_006341679.1| PREDICTED: uncharacterized protein LOC102589286 [Solanum tuberosum]
Length=755

 Score =   338 bits (867),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET+EHH+ERT QL VVVQEWHSQF+K++I+QK+YI+ LN WLKLNL+PIDTNLKEKVS
Sbjct  524  PKETTEHHHERTLQLYVVVQEWHSQFDKLVIYQKQYIKALNSWLKLNLIPIDTNLKEKVS  583

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SPQRPQNPPILAL+HAW D + KLPDELA+TAIY+FSAV+NTI ++Q +EMKL+DRC+DT
Sbjct  584  SPQRPQNPPILALIHAWHDYLEKLPDELARTAIYNFSAVINTIFEYQKEEMKLRDRCEDT  643

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+EL K+TR++EDWYHK+MQR+TP D+ + +   ED  V++RQLQLEAL+++L++EE++Y
Sbjct  644  RRELNKKTRQYEDWYHKHMQRKTP-DEIDPESAQEDTLVVDRQLQLEALRKKLEDEEDSY  702

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
             RQC+QVR KSLTSLR+ LPELF AMSE+S AC+ MY+ L SI    NR
Sbjct  703  QRQCLQVRDKSLTSLRSRLPELFGAMSEYSLACADMYRDLRSIAKHRNR  751



>ref|XP_002304191.2| hypothetical protein POPTR_0003s05360g [Populus trichocarpa]
 gb|EEE79170.2| hypothetical protein POPTR_0003s05360g [Populus trichocarpa]
Length=261

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 182/226 (81%), Gaps = 4/226 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETSEHH++RT+QL VVVQEW SQF K+I +QK YI+ LN WLKLNL+PI++NLKEKVSS
Sbjct  29   KETSEHHHDRTFQLLVVVQEWQSQFCKLIDNQKAYIKSLNSWLKLNLIPIESNLKEKVSS  88

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R +NPPI  LL AW D + KLPDE+A+TAI +F+AV++TI+QHQ +EMKLK++C++TR
Sbjct  89   PPRVRNPPIQPLLIAWHDFLDKLPDEVARTAINNFAAVIHTILQHQEEEMKLKEKCEETR  148

Query  447  KELEKRTRKFEDWYHKYMQRRTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            KEL ++ RK+EDW+ KYMQ+RTP++   +  +D  H D  + ERQ  ++A+K RLKEEEE
Sbjct  149  KELSQKMRKYEDWWRKYMQQRTPDELDPERTEDNSHND-AIAERQSVVDAVKNRLKEEEE  207

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            AY +QC+QVR KS+ SL+T LPELF AMSE + ACS MY+ L SI+
Sbjct  208  AYRKQCLQVREKSMASLKTRLPELFRAMSEVAHACSEMYKNLRSIS  253



>ref|XP_011072341.1| PREDICTED: uncharacterized protein LOC105157620 [Sesamum indicum]
Length=743

 Score =   300 bits (767),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 181/229 (79%), Gaps = 0/229 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HH+ERT QLG VVQEW++ F +++  QKEYI+ LN WLKLNL+PIDTN KEKVS
Sbjct  512  PKETSDHHHERTRQLGGVVQEWYTNFSELMSQQKEYIKALNSWLKLNLIPIDTNWKEKVS  571

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RPQNPPI  LLHAW D + KLPDE AK +I +F+A++ TI Q+Q +E+  ++RC D+
Sbjct  572  SPGRPQNPPIQILLHAWHDYLEKLPDEPAKASINNFAAIIKTIWQYQKEELDFRNRCADS  631

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RK+L ++TR FE+WY+KYMQ+RTP DD + D  H+ + + E+QL +EA KQ+L+E+EEAY
Sbjct  632  RKDLIRKTRDFENWYNKYMQKRTPPDDMDPDRTHDKDLIAEKQLMVEAAKQKLEEDEEAY  691

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
             RQC+QVR KSL SL++ LPELF A+S+FS ACS MY TL SI+   NR
Sbjct  692  QRQCIQVREKSLMSLKSHLPELFRALSDFSLACSDMYSTLRSISRSRNR  740



>ref|XP_002279674.1| PREDICTED: uncharacterized protein LOC100241173 [Vitis vinifera]
Length=722

 Score =   291 bits (744),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 179/227 (79%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH++RT QL +VVQEWHSQF+K++ +QK YI  L  WL+LNL+PI++NLKEKVS
Sbjct  489  PKETSEHHHKRTIQLWIVVQEWHSQFDKLVTNQKNYITALKKWLRLNLIPIESNLKEKVS  548

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RPQNPPI ALL AW D + KLPDELAKT+I +F+A++ TI+QHQ DEM+LK +C++T
Sbjct  549  SPPRPQNPPIQALLQAWNDHLEKLPDELAKTSISNFAAIIETIMQHQQDEMRLKAKCEET  608

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEE  280
             KELE++TR+F DW+ KYMQ+R P+++  +   D PH D  VIER+L +E L  RLK+EE
Sbjct  609  AKELERKTRQFNDWHSKYMQKRIPDENDREHSGDDPH-DEVVIERKLVVETLSNRLKDEE  667

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            E Y ++C+ VR KSL SL+  LPELF A+SEFS ACS MY  L SI+
Sbjct  668  ETYQKECVLVRDKSLASLKNHLPELFRALSEFSYACSDMYSRLRSIS  714



>emb|CDO98057.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   288 bits (737),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 188/232 (81%), Gaps = 0/232 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT+QL +VV+EWH QF+K+I +Q +YIR LN+WLKLNL+PIDTNLKEKVS
Sbjct  518  PKETSEHHHERTFQLLLVVKEWHMQFDKLIKNQLDYIRALNNWLKLNLIPIDTNLKEKVS  577

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SPQRP NPPI  LLHAW D + K PDELA++AI +F+ VV+ IV++Q+DEMKL+++C+DT
Sbjct  578  SPQRPANPPICVLLHAWHDYLEKAPDELARSAINNFAHVVDHIVEYQIDEMKLRNKCEDT  637

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+EL K+T +F+DWY KYMQRRTP D+ + +   + + ++ERQ+Q+E L+++L+EEE  Y
Sbjct  638  RRELAKKTEQFKDWYRKYMQRRTPPDELDPERAQDKDLIVERQIQVETLEKKLEEEEAEY  697

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNREST  115
             +QC+QVR KSL SLRTGLP LF AMS FS ACS MY+ L SI+   +R  +
Sbjct  698  KKQCIQVREKSLASLRTGLPNLFLAMSGFSLACSDMYRNLRSISQKRSRSES  749



>gb|KHN32609.1| hypothetical protein glysoja_022291 [Glycine soja]
Length=640

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 177/235 (75%), Gaps = 3/235 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK TSEHHY+RTYQL +VVQ+WHS FEK++ HQK YI+ LN WLKLN++PI++NLKEKVS
Sbjct  406  PKTTSEHHYDRTYQLVLVVQQWHSHFEKLVNHQKGYIKALNTWLKLNIIPIESNLKEKVS  465

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PPI  LL+AW D + KLPDELA+TAI +F  V+ TI   Q +E+ LK +C+DT
Sbjct  466  SPPRVRSPPIQGLLNAWNDRLDKLPDELARTAIGNFVNVIETIYHQQEEEIALKRKCEDT  525

Query  450  RKELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKEL ++TR+FEDWY+KYMQ++ P   N D  +D    D  V ERQ  +E +K+RL++EE
Sbjct  526  RKELSRKTRQFEDWYNKYMQKKIPDEYNPDRAEDANAPDEVVTERQFAVELVKKRLEDEE  585

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNREST  115
            EAY RQC+QVR K+L SL+  +PELF AMS+FS  CS MY  L SI+  L + S+
Sbjct  586  EAYARQCLQVRQKTLGSLKNRMPELFRAMSDFSLECSRMYSELRSISQHLGQSSS  640



>ref|XP_010545713.1| PREDICTED: uncharacterized protein LOC104817994 [Tarenaya hassleriana]
Length=834

 Score =   287 bits (735),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 177/224 (79%), Gaps = 9/224 (4%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ LN WLKLNL+PI++ LKEKVSS
Sbjct  578  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKFLNSWLKLNLIPIESTLKEKVSS  637

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NPPI  LL AW D + KLPDE+A+TAI +F+AV++TI+Q Q +EMKL+D+C++TR
Sbjct  638  PPRVPNPPIQRLLIAWYDRLDKLPDEMARTAIINFAAVISTIMQQQEEEMKLRDKCEETR  697

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN-----VIERQLQLEALKQRLKEE  283
            +EL ++TR FEDWYHKYMQ+R P    E+  P EDN+     VIERQL +E +++RL+EE
Sbjct  698  RELARKTRNFEDWYHKYMQKRIP----EEINPEEDNDAHKDVVIERQLAVEQVRKRLEEE  753

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EE Y RQC+QVR KSL SLRT LPELF AMSE + ACS MY+ L
Sbjct  754  EEVYQRQCVQVREKSLASLRTRLPELFQAMSEVAYACSDMYRAL  797



>gb|KDO51231.1| hypothetical protein CISIN_1g044677mg, partial [Citrus sinensis]
Length=250

 Score =   271 bits (693),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 178/228 (78%), Gaps = 1/228 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  VVQEW+SQF K+I HQK YI+ LN WLKLNL+PI+++L+EKVS
Sbjct  18   PKETSEHHHERTIQLWAVVQEWNSQFCKLIDHQKAYIKALNSWLKLNLIPIESSLREKVS  77

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AW DL+ KLPDE+A++AI +F+A++NTI+ HQ +EMKLK+RC++T
Sbjct  78   SPPRIQTPPIQRLLLAWHDLLQKLPDEIARSAIGNFAALINTIMHHQEEEMKLKERCEET  137

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            +KEL ++TR+FEDWY+KY+ RRT  ++ + D     + V ER+  ++ LK+RL+EEEEAY
Sbjct  138  KKELSRKTRQFEDWYNKYITRRT-QEELDADDTTLKDAVTERKFVVDVLKKRLEEEEEAY  196

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             RQC  VR KSLTSLR  LPELF AMSE S ACS MY+ L++I    N
Sbjct  197  QRQCGAVREKSLTSLRNHLPELFKAMSEISFACSGMYRDLKNIAQHKN  244



>gb|KHG04451.1| Monodehydroascorbate reductase, fruit isozyme [Gossypium arboreum]
Length=741

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 179/230 (78%), Gaps = 2/230 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT+QL  +VQ+WH QF K+I HQKEYI+ LN+WL+LNL+PI+++LKEK S
Sbjct  507  PKETSEHHHERTFQLLAIVQDWHMQFCKLIDHQKEYIKALNNWLRLNLIPIESSLKEKGS  566

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PPI  L+ AWQD + KLPDE+A+TAI +F+ V++ I+QHQ DEMKLK++C+++
Sbjct  567  SPPRVESPPIQRLILAWQDKLDKLPDEIARTAINNFAHVIDAIMQHQRDEMKLKEKCEES  626

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            RKEL K+ R+FEDWY+KYMQRRTP   D T  D    ++ V ERQ  +EA+K+RL EEEE
Sbjct  627  RKELAKKQRQFEDWYNKYMQRRTPEELDPTRTDDNPNNDAVTERQFMVEAVKRRLGEEEE  686

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            AY   C+QVR KSL SL+T LPELF AMS  + ACS MY  L +I+H  N
Sbjct  687  AYRILCIQVREKSLVSLKTRLPELFRAMSTIAVACSKMYGELRAISHSRN  736



>ref|XP_003542101.1| PREDICTED: uncharacterized protein LOC100791852 [Glycine max]
Length=749

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 177/235 (75%), Gaps = 3/235 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK TSEHHY+RTYQL +VVQ+WHS FEK++ HQK YI+ LN WLKLN++PI++NLKEKVS
Sbjct  515  PKTTSEHHYDRTYQLVLVVQQWHSHFEKLVNHQKGYIKALNTWLKLNIIPIESNLKEKVS  574

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PPI  LL+AW D + KLPDELA+TAI +F  V+ TI   Q +E+ LK +C+DT
Sbjct  575  SPPRVRSPPIQGLLNAWNDRLDKLPDELARTAIGNFVNVIETIYHQQEEEIALKRKCEDT  634

Query  450  RKELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKEL ++TR+FEDWY+KYMQ++ P   N D  +D    D  V ERQ  +E +K+RL++EE
Sbjct  635  RKELSRKTRQFEDWYNKYMQKKIPDEYNPDRAEDANAPDEVVTERQFAVELVKKRLEDEE  694

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNREST  115
            EAY RQC+QVR K+L SL+  +PELF AMS+FS  CS MY  L SI+  L + S+
Sbjct  695  EAYARQCLQVRQKTLGSLKNRMPELFRAMSDFSLECSRMYSELRSISQHLGQSSS  749



>ref|XP_011026550.1| PREDICTED: uncharacterized protein LOC105127120 [Populus euphratica]
Length=755

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 177/226 (78%), Gaps = 4/226 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQ WHS FEK++ HQK+YI  L  WLKLNL+PI++NLKEK+SS
Sbjct  521  KETTKHHHERTIQLLKVVQGWHSHFEKLVTHQKQYIHTLTSWLKLNLIPIESNLKEKISS  580

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALLH+W D + KLPDELAK+AI SF+AVV TIV HQ +EMKLK++C++TR
Sbjct  581  PPRAQNPPIQALLHSWHDYLEKLPDELAKSAISSFAAVVETIVHHQEEEMKLKEKCEETR  640

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            +E  ++++ FE+WY KYMQRRTP D+T+ D   ED N   V ERQ  +E+LK+RL+EE E
Sbjct  641  REFLRKSQAFEEWYQKYMQRRTPTDETDADRG-EDANPNPVSERQFVVESLKKRLEEEIE  699

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            A+ + C+QVR KS+ SL+  LPELF AMS+++ ACS  Y+ L SIT
Sbjct  700  AHGKHCLQVREKSVGSLKIRLPELFRAMSDYAHACSDAYEKLRSIT  745



>ref|XP_002299694.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
 gb|EEE84499.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
Length=696

 Score =   279 bits (713),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 183/230 (80%), Gaps = 2/230 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH++RT+QL VVVQ W SQF K+I +QK YIR LN WLKLNL+PI+++LKEKVS
Sbjct  465  PKETSEHHHDRTFQLLVVVQGWQSQFCKLIDNQKGYIRALNSWLKLNLIPIESSLKEKVS  524

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI +LL AW D + KLPDE+A+TAI +F++V++TI+QHQ +EMKLK++C++T
Sbjct  525  SPPRVQNPPIQSLLIAWHDFLDKLPDEVARTAINNFASVIHTILQHQEEEMKLKEKCEET  584

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNNVI-ERQLQLEALKQRLKEEEE  277
            RKEL ++TRKFEDWYHKYMQ++ P + D E      DN+ I +RQ  ++A+K+RL+EEEE
Sbjct  585  RKELFQKTRKFEDWYHKYMQQKMPAEFDPELTEDKSDNDAIADRQFVVDAVKKRLEEEEE  644

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            AY +Q +QVR KSL S++T LPELF AM + ++ACS MY+ L  I+   N
Sbjct  645  AYKKQRLQVREKSLASIKTCLPELFRAMFDIAQACSEMYRNLRFISQRRN  694



>gb|AAK96499.1| At1g52320/F19K6_7 [Arabidopsis thaliana]
 gb|AAN18183.1| At1g52320/F19K6_7 [Arabidopsis thaliana]
 dbj|BAD94485.1| bZIP protein [Arabidopsis thaliana]
Length=398

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 175/232 (75%), Gaps = 6/232 (3%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  157  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSS  216

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLHAW D + K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TR
Sbjct  217  PPRVPNPAIQKLLHAWYDRLDKIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETR  276

Query  447  KELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            KEL ++ R+FEDWYHKY+Q+R P   +  E D  H D  V  RQ  +E +K+RL+EEEEA
Sbjct  277  KELGRKIRQFEDWYHKYIQKRGPEGMNPDEADNDHND-EVAVRQFNVEQIKKRLEEEEEA  335

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
            Y RQ  QVR KSL SLRT LPELF AMSE + +CS MY+   +IT+   R+S
Sbjct  336  YHRQSHQVREKSLASLRTRLPELFQAMSEVAYSCSDMYR---AITYASKRQS  384



>ref|XP_007150659.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
 gb|ESW22653.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
Length=744

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/235 (57%), Positives = 177/235 (75%), Gaps = 3/235 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK+TS+HH++RTYQL +VVQ+WHSQFE +  HQK YI  LN WLKLNL+PI+++LKEKVS
Sbjct  510  PKQTSDHHHDRTYQLLLVVQQWHSQFEMLANHQKGYIMALNTWLKLNLIPIESSLKEKVS  569

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++ PI  LL AW D + KLPDELAKT I +F AV++TI   Q DE+ +K +C+DT
Sbjct  570  SPPRVRSTPIQGLLLAWNDRLEKLPDELAKTNIGNFVAVIDTIFHQQADEITMKRKCEDT  629

Query  450  RKELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKEL ++TR+FEDWY+KYMQ++ P   N DT +D    D  V ERQ+ +E +K+RL++EE
Sbjct  630  RKELSRKTRQFEDWYNKYMQKKIPDEYNPDTAEDSNGPDEAVTERQVAVEQVKKRLEDEE  689

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNREST  115
            EAY RQC+QVR K+L SL+  +P+LF AMS+FS  CS MY  L SI+  L + S+
Sbjct  690  EAYARQCLQVRQKTLGSLKNLMPDLFRAMSDFSLECSKMYSELRSISQNLGQSSS  744



>ref|XP_011001614.1| PREDICTED: uncharacterized protein LOC105108845 [Populus euphratica]
Length=698

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 180/226 (80%), Gaps = 4/226 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETSEHH++RT+QL VVVQEW SQF K+I +QK YI+ LN WL+LNL+PI+++LKEKVSS
Sbjct  466  KETSEHHHDRTFQLLVVVQEWQSQFCKLIDNQKAYIKALNSWLRLNLIPIESSLKEKVSS  525

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R +NPPI  L+ AW D + KLPDE+A+TAI +F+AV++ I+QHQ +EMKLK++C++TR
Sbjct  526  PPRVRNPPIQPLIIAWHDFLDKLPDEVARTAINTFAAVIHAILQHQEEEMKLKEKCEETR  585

Query  447  KELEKRTRKFEDWYHKYMQRRTPND-DTE--QDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            KEL ++TRKFE+W  KYM++RTP++ D E  +D  H D  + ERQ  ++A+K RLKEEEE
Sbjct  586  KELSQKTRKFEEWRRKYMRQRTPDELDPERTEDNSHND-AIAERQSVVDAVKNRLKEEEE  644

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            AY + C+QVR KS+ SL+  LPELF AMSE + ACS MY+ L SI+
Sbjct  645  AYWKHCLQVREKSMASLKARLPELFRAMSEVAHACSEMYKNLRSIS  690



>ref|NP_001117469.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001117470.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_564604.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32782.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
 gb|AEE32784.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
 gb|AEE32785.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=472

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 175/232 (75%), Gaps = 6/232 (3%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  231  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSS  290

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLHAW D + K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TR
Sbjct  291  PPRVPNPAIQKLLHAWYDRLDKIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETR  350

Query  447  KELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            KEL ++ R+FEDWYHKY+Q+R P   +  E D  H D  V  RQ  +E +K+RL+EEEEA
Sbjct  351  KELGRKIRQFEDWYHKYIQKRGPEGMNPDEADNDHND-EVAVRQFNVEQIKKRLEEEEEA  409

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
            Y RQ  QVR KSL SLRT LPELF AMSE + +CS MY+   +IT+   R+S
Sbjct  410  YHRQSHQVREKSLASLRTRLPELFQAMSEVAYSCSDMYR---AITYASKRQS  458



>ref|XP_007012028.1| Golgin subfamily A member 4 [Theobroma cacao]
 gb|EOY29647.1| Golgin subfamily A member 4 [Theobroma cacao]
Length=741

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH QF+K++ HQK+YI+ LN WLKLNL+PI+++LKEK+SS
Sbjct  506  KETTKHHHERTIQLHNVVQEWHLQFDKLVTHQKQYIQALNSWLKLNLIPIESSLKEKISS  565

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALLHAW D + KLPDE+AK++I SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  566  PPRAQNPPIQALLHAWHDYLEKLPDEVAKSSILSFAAVIKTIIIHQDEEMKLKEKCEETR  625

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            KE  ++ + FE+WY KY QRRT +D+ + +   + N    V ERQ  +++LK+RL+EE E
Sbjct  626  KEFFRKNQAFEEWYQKYKQRRTASDEIDAERGEDANAKDPVSERQFAVDSLKKRLEEEVE  685

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            AY + C+QVR KSL SL+  LPELF AMS++SRACS  Y+ L +IT
Sbjct  686  AYQKHCIQVREKSLGSLKIRLPELFRAMSDYSRACSDAYEKLRTIT  731



>gb|KHM98761.1| hypothetical protein glysoja_030814 [Glycine soja]
Length=636

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 174/232 (75%), Gaps = 4/232 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK TSEHHY+RTYQL +VVQ+WHS FE ++ HQK YI+ LN WLKLN++PI+++LKEKVS
Sbjct  403  PKTTSEHHYDRTYQLFLVVQQWHSHFENLVNHQKGYIKALNTWLKLNIIPIESSLKEKVS  462

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PPI  LL+AW D + KLPDELA+TAI +F AV+ TI   Q +E+ LK +C+DT
Sbjct  463  SPPRVRSPPIQGLLYAWNDRLDKLPDELARTAIGNFVAVIETIYHQQQEEIALKRKCEDT  522

Query  450  RKELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKEL ++TR+FEDWY+KYMQ++ P   N D  +D    D  V+ RQ  +E +K+RL++EE
Sbjct  523  RKELSRKTRQFEDWYNKYMQKKIPDEYNPDRAEDANAPD-EVVTRQSAVEQVKKRLEDEE  581

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
            EAY RQC+QVR K+L SL+  +PELF AMS+FS  CS MY  L  I+  L +
Sbjct  582  EAYARQCLQVRQKTLVSLKNRMPELFRAMSDFSLECSRMYSELRPISQNLGQ  633



>gb|EYU21542.1| hypothetical protein MIMGU_mgv1a001881mg [Erythranthe guttata]
Length=745

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 175/229 (76%), Gaps = 0/229 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HH+ERT QLG VVQ+W + F +++  QKEYIR LN WLKLNLVPIDTN KEK +
Sbjct  514  PKETSDHHHERTRQLGGVVQDWFTNFTELMSQQKEYIRALNTWLKLNLVPIDTNWKEKPT  573

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R  +PPI  LL+AW D + KLPDE A+  I +F+A+V TI Q+Q +E++ +++C D+
Sbjct  574  SPNRHHSPPIQTLLNAWHDHLEKLPDEPARATINNFAAIVKTIWQYQKEELEFRNKCSDS  633

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RK+L ++TR+FE WY+K+MQ+R P DDT+ D  H+ +++ ERQL +E  K +L+E+EE Y
Sbjct  634  RKDLVRKTREFESWYNKFMQKRGPPDDTDPDRVHDSDHIAERQLIVEIAKHKLEEDEEGY  693

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
             + C+QVR KSL SL++ LPELF A+SEFS ACS MY  L SI+HP +R
Sbjct  694  RKLCVQVREKSLVSLKSHLPELFRALSEFSLACSDMYSNLRSISHPRHR  742



>ref|XP_002308623.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
 gb|EEE92146.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
Length=767

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 178/227 (78%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETS+HH+ERT QL  VVQ WHSQFEK++ HQK+YI  L  WLKLNL+PI+++LKEK SS
Sbjct  533  KETSKHHHERTIQLWKVVQGWHSQFEKLVTHQKQYIHTLTSWLKLNLIPIESSLKEKTSS  592

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALLH+W D + KLPD+LAK+AI+SF+AV+ TIV+HQ +EMKLK++C++TR
Sbjct  593  PLRAQNPPIQALLHSWHDNLEKLPDDLAKSAIFSFAAVIETIVRHQEEEMKLKEKCEETR  652

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            KEL ++ + FE+W+ KYMQRRTP D T+ D   ED N   V ERQL +E+L  RLKEE E
Sbjct  653  KELLRKNQAFEEWHQKYMQRRTP-DGTDADRG-EDTNPNPVSERQLAVESLNIRLKEELE  710

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            A+ + C+QVR KS+ SL+  LPELF A+S+++ ACS  Y+ L SITH
Sbjct  711  AHQKHCLQVREKSVGSLKLRLPELFRALSDYAHACSDSYEKLRSITH  757



>ref|XP_010098052.1| hypothetical protein L484_026183 [Morus notabilis]
 gb|EXB74489.1| hypothetical protein L484_026183 [Morus notabilis]
Length=743

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 175/228 (77%), Gaps = 0/228 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  VV EWH QFEK++  QK+Y++ L  WLKLNL+P +++LKEKVS
Sbjct  510  PKETSEHHHERTVQLYAVVNEWHLQFEKLVFKQKDYMKALTTWLKLNLIPTESSLKEKVS  569

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AWQ+ + KLPDELA++AI++F+AV++TIV  Q++EM+L+++CKDT
Sbjct  570  SPPRQQTPPIQKLLMAWQEHLEKLPDELARSAIFNFAAVIDTIVHQQVEEMRLREKCKDT  629

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             KEL ++ R+FEDWY KYM+R+ PN+    +    +N + ERQ  +++L++RL+EE+E Y
Sbjct  630  EKELSRKKRQFEDWYRKYMERQIPNEGEPAEDTTSNNGLAERQFMVDSLEKRLEEEQEDY  689

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             R C+ VR KSL S++T LPELF A+S+F+ ACS MY+ L S + P N
Sbjct  690  QRHCLHVREKSLASVKTRLPELFRALSDFAVACSEMYRDLRSRSPPQN  737



>ref|XP_004486732.1| PREDICTED: uncharacterized protein LOC101506888 isoform X1 [Cicer 
arietinum]
 ref|XP_004486733.1| PREDICTED: uncharacterized protein LOC101506888 isoform X2 [Cicer 
arietinum]
Length=753

 Score =   275 bits (704),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 179/235 (76%), Gaps = 3/235 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK+TSEHH+ERTYQL VVVQ+WHSQFEK++ +QK YI+ LN+WLKLNL+PI++NLKEKVS
Sbjct  519  PKQTSEHHHERTYQLLVVVQQWHSQFEKLVNNQKGYIKSLNNWLKLNLIPIESNLKEKVS  578

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PP+  LLHAW D + KLPDELA+TAI +F+AV++TI   Q +EM  K +C+D+
Sbjct  579  SPPRVRSPPVQGLLHAWHDRLEKLPDELARTAIGNFAAVLDTIFNQQDEEMIKKRKCEDS  638

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKEL ++TR+F+DWYHKYMQR+TP +   D  +D    D  V E+Q+ +E +++RL+ EE
Sbjct  639  RKELARKTRQFDDWYHKYMQRKTPEEFDPDKAEDPNAPDEVVTEKQILVEQVRKRLEAEE  698

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNREST  115
              Y +QC+QVR K+L SL+  +PELF AM +FS  CS MY  L SI   L + S+
Sbjct  699  ADYEKQCLQVRQKTLGSLKNRMPELFRAMCDFSLECSKMYIELCSIAQHLGQNSS  753



>ref|XP_002324252.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
 gb|EEF02817.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
Length=764

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 175/226 (77%), Gaps = 4/226 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQ W S FEK++ HQK+YI  L  WLKLNL+PI+++LKEK+SS
Sbjct  530  KETTKHHHERTIQLLKVVQGWLSHFEKLVTHQKQYIHTLTSWLKLNLIPIESSLKEKISS  589

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALLH+W D + KLPDELAK+AI SF+AVV TIV HQ +EMKLK++C++TR
Sbjct  590  PPRAQNPPIQALLHSWHDYLEKLPDELAKSAISSFAAVVETIVHHQEEEMKLKEKCEETR  649

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            +E  ++ + FE+WY KYMQRRTP D+T+ D   ED N   V ERQ  +E+LK+RL+EE E
Sbjct  650  REFMRKNQAFEEWYQKYMQRRTPTDETDADR-GEDANPNPVSERQFVVESLKKRLEEEIE  708

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            A+ + C+QVR KS+ SL+  LPELF AMS+++ ACS  Y+ L SIT
Sbjct  709  AHGKHCLQVREKSVGSLKIRLPELFRAMSDYAHACSDAYEKLRSIT  754



>gb|KHN10238.1| hypothetical protein glysoja_017842 [Glycine soja]
Length=547

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 176/233 (76%), Gaps = 2/233 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHY+RT QL  V+QEWH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+S
Sbjct  315  PKETTKHHYDRTVQLEKVIQEWHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKIS  374

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP + QNPPI ALLHAW D + KLPDELAK+AI SF AV+ TI+  Q +EMKLK+RC++T
Sbjct  375  SPPKAQNPPIQALLHAWHDYVDKLPDELAKSAISSFVAVIKTIILQQEEEMKLKERCEET  434

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEE  277
            RKE  K+ + FE+WY K++ RR P++   + G   + +N V ERQ  +E+LK+RL+EE E
Sbjct  435  RKEYFKKKQAFEEWYQKHLMRRGPDEAEHERGEEVNANNPVSERQFVVESLKKRLEEEIE  494

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
            ++ + C+QVR KSL SL+T LPELF A+S+++ AC+  Y+ L+ IT     E+
Sbjct  495  SHQKHCVQVREKSLQSLKTRLPELFRALSDYAHACADAYEKLKLITQSRGGEA  547



>ref|XP_002281782.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
 ref|XP_010648551.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
Length=707

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 179/227 (79%), Gaps = 3/227 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HH+ERT QL   +Q WHSQFEK++ H+K+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  471  PKETSKHHHERTIQLWNEIQGWHSQFEKLVTHEKQYIQALNSWLKLNLIPIESSLKEKIS  530

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RPQ+PPI ALLH+W D + KLP ELAK+AI SF+AV+ TI+ HQ +EMKLK++C++T
Sbjct  531  SPPRPQHPPIQALLHSWHDSLEKLPHELAKSAISSFAAVIKTIILHQEEEMKLKEKCEET  590

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            +KE  ++ + F+DWY KYMQRRTP D+T+ +   E N    + E+Q  +E+LK++L+EE 
Sbjct  591  QKEYSRKHQAFQDWYQKYMQRRTPPDETDPEKGDEANPKDPISEKQFVVESLKKKLEEEV  650

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EA+ R C+QVR KSL SL+  LPELF A+++++ ACS  YQ L++IT
Sbjct  651  EAHQRHCVQVREKSLGSLKLRLPELFRALTDYTHACSDAYQRLKAIT  697



>gb|KJB54879.1| hypothetical protein B456_009G052500 [Gossypium raimondii]
Length=736

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 177/225 (79%), Gaps = 3/225 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWHSQF+K++ HQK+YI+ LN+WLKLNL+PI+++LKEKVSS
Sbjct  500  KETTKHHHERTIQLHNVVQEWHSQFDKLVTHQKQYIQALNNWLKLNLIPIESSLKEKVSS  559

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI  LLH W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  560  PPRAQNPPIQKLLHTWHDYLEKLPDEVAKSAISSFAAVIKTIIIHQEEEMKLKEKCEETR  619

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            KE  ++++ FE+WYHKY QRR+ +D+ + +   + N    V ERQ  +E+LK+RL+EE E
Sbjct  620  KEFLRKSQAFEEWYHKYRQRRSGSDEMDAERGEDANAKDPVSERQFAVESLKKRLEEEVE  679

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            A+ + C+QVR KSL SL+  LPELF AMS++S ACS  Y+ L ++
Sbjct  680  AHEKHCIQVREKSLGSLKIRLPELFRAMSDYSHACSDAYEKLRTV  724



>gb|KFK35788.1| hypothetical protein AALP_AA4G036700 [Arabis alpina]
Length=807

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  527  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKSLGGWLKLNLIPIESTLKEKVSS  586

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLHAW D + K+PDE+A+TAI +F+AV++TI+Q Q +EMKL+DRC++T+
Sbjct  587  PPRVPNPAIQKLLHAWYDRLDKIPDEMARTAIINFAAVISTIMQQQEEEMKLRDRCEETK  646

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAY  271
            KEL ++ R+FE+WY+KYMQ+R P +DT  DG   D + V+ RQ  +E +K+RL+EEEE+Y
Sbjct  647  KELARKIRQFEEWYYKYMQKRGP-EDTNPDGTEVDKDEVVVRQFNVEQIKKRLEEEEESY  705

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             RQ  QVR KSL SLRT LPELF AMSE + +CS MY+ +  +T
Sbjct  706  HRQSHQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRAVAYVT  749



>ref|XP_006465528.1| PREDICTED: uncharacterized protein LOC102613887 [Citrus sinensis]
Length=736

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 179/228 (79%), Gaps = 1/228 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  VVQEW+SQF K+I HQK YI+ LN WLKLNL+PI+++L+EKVS
Sbjct  504  PKETSEHHHERTIQLWAVVQEWNSQFCKLIDHQKAYIKALNSWLKLNLIPIESSLREKVS  563

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AWQDL+ KLPDE+A++AI +F+A++NTI+ HQ +EMKLK+RC++T
Sbjct  564  SPPRIQTPPIQRLLLAWQDLLQKLPDEIARSAIGNFAALINTIMHHQEEEMKLKERCEET  623

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            +KEL ++TR+FEDWY+KY+ RRT  ++ + D     + V ER+  ++ LK+RL+EEEEAY
Sbjct  624  KKELSRKTRQFEDWYNKYITRRT-QEELDADDTTLKDAVTERKFVVDVLKKRLEEEEEAY  682

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             RQC  VR KSLTSLR  LPELF AMSE S ACS MY+ L++I    N
Sbjct  683  QRQCGAVREKSLTSLRNHLPELFKAMSEISFACSGMYRDLKNIAQHKN  730



>ref|XP_011019684.1| PREDICTED: uncharacterized protein LOC105122326 [Populus euphratica]
Length=763

 Score =   273 bits (699),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 176/227 (78%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETS+HH+ERT QL  VVQ WHSQFEK++ HQK+YI  L  WLKLNL+PI+++LKEK SS
Sbjct  529  KETSKHHHERTIQLWKVVQGWHSQFEKLVTHQKQYIHTLTSWLKLNLIPIESSLKEKTSS  588

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALLH+W D + KLPD+LAK+AI SF+AV  TIV HQ +EMKLK++C++TR
Sbjct  589  PPRAQNPPIQALLHSWHDNLEKLPDDLAKSAILSFAAVKETIVHHQEEEMKLKEKCEETR  648

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            KEL ++ + F++W+ KYMQRRTP D T+ D   ED N   V ERQL +E+L  RLKEE E
Sbjct  649  KELLRKNQAFKEWHQKYMQRRTP-DGTDADRG-EDTNPDPVSERQLAVESLNIRLKEEVE  706

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            A+ + C+QVR KS+ SL+  LPELF A+S+++RACS  Y+ L SITH
Sbjct  707  AHQKHCLQVREKSVGSLKLRLPELFRALSDYARACSDSYEKLRSITH  753



>ref|XP_006392932.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
 gb|ESQ30218.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
Length=790

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQK YI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  547  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKAYIKSLGGWLKLNLIPIESTLKEKVSS  606

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLH W D + K+PDE+A+TAI +F+AV++TI+Q Q +E+KL+DRC++TR
Sbjct  607  PPRVPNPAIQKLLHIWYDRLDKIPDEMARTAIINFAAVISTIMQQQEEEIKLRDRCEETR  666

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWY+KYMQ+R P +D   DG   DN+    V+ RQ  +E +K+RL+EEE
Sbjct  667  KELGRKIRQFEDWYYKYMQKRGP-EDMNPDGSEADNDHKDEVVVRQFNVEQIKKRLEEEE  725

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+ +  +T
Sbjct  726  EAYQRQSQQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRAVVYVT  772



>ref|XP_003603595.1| hypothetical protein MTR_3g109450 [Medicago truncatula]
 gb|AES73846.1| BZIP protein [Medicago truncatula]
Length=712

 Score =   271 bits (694),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HHY+RT QL  V+QEW SQFEK++  QK YI+ L  WLKLNL+PI++NLKEK+SS
Sbjct  483  KETTKHHYDRTVQLWNVIQEWESQFEKLVTQQKHYIQALFSWLKLNLIPIESNLKEKISS  542

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALL+AW D + KLPDELAK+AI SF+AV+ TI+  Q +EMKLK++C++TR
Sbjct  543  PPRAQNPPIQALLYAWHDYLDKLPDELAKSAITSFAAVIKTIILQQEEEMKLKEKCEETR  602

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            KE  ++ + FE+WY K++QRR P DD E+D  + +N V E+Q  +E+LK+RL+EE E++ 
Sbjct  603  KEFLRKNQAFEEWYQKHLQRRGP-DDPERDDVNTNNPVSEKQFVVESLKKRLEEETESHK  661

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            + C+QVR KSL SL+T LPELF A+S++++ACS  Y+ L+SI H
Sbjct  662  KLCVQVREKSLQSLKTRLPELFRALSDYTQACSDAYEKLKSIAH  705



>ref|XP_006427010.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
 gb|ESR40250.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
Length=736

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 178/228 (78%), Gaps = 1/228 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  VVQEW+SQF K+I HQK YI+ LN WLKLNL+PI+++L+EKVS
Sbjct  504  PKETSEHHHERTIQLWAVVQEWNSQFCKLIDHQKAYIKALNSWLKLNLIPIESSLREKVS  563

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AW DL+ KLPDE+A++AI +F+A++NTI+ HQ +EMKLK+RC++T
Sbjct  564  SPPRIQTPPIQRLLLAWHDLLQKLPDEIARSAIGNFAALINTIMHHQEEEMKLKERCEET  623

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            +KEL ++TR+FEDWY+KY+ RRT  ++ + D     + V ER+  ++ LK+RL+EEEEAY
Sbjct  624  KKELSRKTRQFEDWYNKYITRRT-QEELDADDTTLKDAVTERKFVVDVLKKRLEEEEEAY  682

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             RQC  VR KSLTSLR  LPELF AMSE S ACS MY+ L++I    N
Sbjct  683  QRQCGAVREKSLTSLRNHLPELFKAMSEISFACSGMYRDLKNIAQHKN  730



>emb|CDY52975.1| BnaA06g01600D [Brassica napus]
Length=747

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 171/223 (77%), Gaps = 5/223 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI +QK YI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  494  KETNDHHHERTIQLLAVVQEWHTQFCRMIDNQKMYIKSLGGWLKLNLIPIESTLKEKVSS  553

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLH W D + K+PDE+A+TAI +F+AVV+TI+Q Q +EMKL+DRC++TR
Sbjct  554  PPRVPNPAIQKLLHVWYDRLDKIPDEMARTAIINFAAVVSTIMQQQEEEMKLRDRCEETR  613

Query  447  KELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWYHKYMQ+R P     D +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  614  KELGRKIRQFEDWYHKYMQKRGPEDMNADGSEGDNEHKD-EVVVRQFNVEQIKKRLEEEE  672

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EAY RQ  QVR KS+ SLRT LPELF AMSE + +CS MY+ +
Sbjct  673  EAYQRQSQQVREKSIASLRTRLPELFQAMSEVAYSCSGMYRAV  715



>emb|CDY61085.1| BnaC06g41130D [Brassica napus]
Length=746

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 170/223 (76%), Gaps = 5/223 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI +QK YI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  493  KETNDHHHERTIQLLAVVQEWHTQFCRMIDNQKMYIKSLGGWLKLNLIPIESTLKEKVSS  552

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLH W D + K+PDE+A+TAI +F+AVV+TI+Q Q +EMKL+DRC +TR
Sbjct  553  PPRVPNPAIQKLLHIWYDRLDKIPDEMARTAIINFAAVVSTIMQQQEEEMKLRDRCGETR  612

Query  447  KELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWYHKYMQ+R P     D +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  613  KELGRKIRQFEDWYHKYMQKRGPEDMNADGSEADNEHKD-EVVVRQFNVEQIKKRLEEEE  671

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EAY RQ  QVR KS+ SLRT LPELF AMSE + +CS MY+ +
Sbjct  672  EAYQRQSQQVREKSIASLRTRLPELFQAMSEVAYSCSGMYRAV  714



>ref|XP_003523728.1| PREDICTED: formin-like protein 8-like [Glycine max]
Length=699

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 176/233 (76%), Gaps = 2/233 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHY+RT QL  V+QEWH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+S
Sbjct  467  PKETTKHHYDRTVQLEKVIQEWHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKIS  526

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP + QNPPI ALLHAW D + KLPDELAK+AI SF AV+ TI+  Q +EMKLK+RC++T
Sbjct  527  SPPKAQNPPIQALLHAWHDYVDKLPDELAKSAISSFVAVIKTIILQQEEEMKLKERCEET  586

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEE  277
            RKE  K+ + FE+WY K++ RR P++   + G   + +N V ERQ  +E+LK+RL+EE E
Sbjct  587  RKEYFKKKQAFEEWYQKHLMRRGPDEAEHERGEEVNANNPVSERQFVVESLKKRLEEEIE  646

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
            ++ + C+QVR KSL SL+T LPELF A+S+++ AC+  Y+ L+ IT     E+
Sbjct  647  SHQKHCVQVREKSLQSLKTRLPELFRALSDYAHACADAYEKLKLITQSRGGEA  699



>ref|XP_009147692.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103871216 
[Brassica rapa]
Length=800

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 171/223 (77%), Gaps = 5/223 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI +QK YI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  547  KETNDHHHERTIQLLAVVQEWHTQFCRMIDNQKMYIKSLGGWLKLNLIPIESTLKEKVSS  606

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLH W D + K+PDE+A+TAI +F+AVV+TI+Q Q +EMKL+DRC++TR
Sbjct  607  PPRVPNPAIQKLLHVWYDRLDKIPDEMARTAIINFAAVVSTIMQQQEEEMKLRDRCEETR  666

Query  447  KELEKRTRKFEDWYHKYMQRRTPND----DTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWYHKYMQ+R P D     +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  667  KELGRKIRQFEDWYHKYMQKRGPEDMNAEGSEGDNEHKD-EVVVRQFNVEQIKKRLEEEE  725

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EAY RQ  QVR KS+ SLRT LPELF AMSE + +CS MY+ +
Sbjct  726  EAYQRQSQQVREKSIASLRTRLPELFQAMSEVAYSCSGMYRAV  768



>ref|XP_009799127.1| PREDICTED: uncharacterized protein LOC104245243 [Nicotiana sylvestris]
Length=726

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 171/226 (76%), Gaps = 3/226 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETS+HH+ERT QLG VV+EWH  F+ ++ +QK YI+ L++WLKLNL+PI+++LKEK+S
Sbjct  491  PLETSKHHHERTIQLGNVVKEWHDHFDNLVKNQKLYIQTLHNWLKLNLIPIESSLKEKIS  550

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI ALLH+WQ+L+ KLPDELAK+AI SF AV+ TI+ HQ +EMKLK++C++T
Sbjct  551  SPPRAQNPPIQALLHSWQELLEKLPDELAKSAIASFEAVIRTIIIHQEEEMKLKEKCEET  610

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            RKE  ++ + FEDWY KYMQRRTP D  + D   E N    V E+Q  +EALK+RL EE 
Sbjct  611  RKEYIRKRQAFEDWYQKYMQRRTPPDVADPDRATESNPKDPVAEKQFLVEALKKRLDEET  670

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            EA+ + C+QVR KSL SL+  LPELF AMSE+S AC   Y  L  I
Sbjct  671  EAHQKHCIQVREKSLGSLKIRLPELFRAMSEYSYACLEAYGRLRVI  716



>gb|KHN18210.1| hypothetical protein glysoja_025100 [Glycine soja]
Length=625

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHY+RT QL  V+ EWH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+S
Sbjct  393  PKETTKHHYDRTVQLEKVILEWHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKIS  452

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP + QNPPI ALLHAW D + KLPDELAK+AI SF+AV+ TI+  Q +EMKLK+RC++T
Sbjct  453  SPPKAQNPPIQALLHAWHDYVDKLPDELAKSAISSFAAVIKTILLQQEEEMKLKERCEET  512

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEE  277
            RKE  K+ + FE+WY K++ RR P++   + G   + +N V ERQ  +E+L++RL+EE E
Sbjct  513  RKEYLKKKQAFEEWYQKHLMRRGPDEAEHERGEEVNTNNPVSERQFVVESLQKRLEEEIE  572

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            ++ + C+QVR KSL SL+T LPELF A+S+++ AC+  Y+ L+ IT
Sbjct  573  SHQKHCIQVREKSLQSLKTRLPELFRALSDYAHACAEAYEKLKLIT  618



>ref|XP_002891687.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67946.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
Length=800

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 174/227 (77%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  553  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSS  612

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLHAW D I K+PDE+A+TAI +F+AVV+TI+Q Q DE+ L+++C++T+
Sbjct  613  PPRVPNPAIQKLLHAWYDRIDKIPDEMARTAIINFAAVVSTIMQQQEDEINLRNKCEETK  672

Query  447  KELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FE+WY+KYMQ+R P     + +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  673  KELGRKIRQFEEWYYKYMQKRGPEGMNPEGSEADNDHKD-EVMVRQFNVEQIKKRLEEEE  731

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+ +  +T
Sbjct  732  EAYHRQSHQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRAVTYVT  778



>ref|XP_002516584.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45925.1| conserved hypothetical protein [Ricinus communis]
Length=728

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 174/227 (77%), Gaps = 3/227 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET+ HH+ RT QL  VVQEWH+QF+K++ HQK+YI+ L  WLKLNL+PI+++LKEK+SS
Sbjct  493  KETTNHHHARTKQLYNVVQEWHTQFDKLLTHQKQYIQILKSWLKLNLIPIESSLKEKISS  552

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P +  NPPI ALL++W D + KLPDE+AK+AI SF+AV+ TI  HQ +EMKLK++C++TR
Sbjct  553  PPKIPNPPIQALLYSWHDHLEKLPDEVAKSAISSFAAVIKTIELHQEEEMKLKEKCEETR  612

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            KE  ++ + F+DWY K+MQRR P D+TE D   + N+   V ERQ  +E+LK+RL+EE E
Sbjct  613  KEFLRKNQAFDDWYQKHMQRRNPTDETEADRGEDANSRDLVSERQFAVESLKKRLEEEVE  672

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
             Y R C+QVR KSL SL+  LPELF AMS+++ ACS  Y+ L ++TH
Sbjct  673  TYQRHCLQVREKSLGSLKIRLPELFRAMSDYAYACSDAYEKLRALTH  719



>ref|NP_849796.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51544.1|AC037424_9 bZIP protein, putative; 48652-45869 [Arabidopsis thaliana]
 gb|AEE32783.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=798

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 176/233 (76%), Gaps = 8/233 (3%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  557  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSS  616

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLHAW D + K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TR
Sbjct  617  PPRVPNPAIQKLLHAWYDRLDKIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETR  676

Query  447  KELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            KEL ++ R+FEDWYHKY+Q+R P   N D E D  H D  V  RQ  +E +K+RL+EEEE
Sbjct  677  KELGRKIRQFEDWYHKYIQKRGPEGMNPD-EADNDHND-EVAVRQFNVEQIKKRLEEEEE  734

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
            AY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+   +IT+   R+S
Sbjct  735  AYHRQSHQVREKSLASLRTRLPELFQAMSEVAYSCSDMYR---AITYASKRQS  784



>ref|XP_010462070.1| PREDICTED: uncharacterized protein LOC104742736 [Camelina sativa]
Length=808

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 172/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +M+ HQKEYI+ L  W+KLNL+PI++ LKEKVSS
Sbjct  565  KETNDHHHERTIQLLAVVQEWHTQFCRMVDHQKEYIKALAGWIKLNLIPIESTLKEKVSS  624

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLH W D + K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TR
Sbjct  625  PPRVPNPAIQKLLHVWYDRLDKIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETR  684

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWY+KYMQ+R P +    DG   DNN    V+ RQ  +E +K+RL+EEE
Sbjct  685  KELGRKIRQFEDWYYKYMQKRGP-EGMNPDGSEADNNHKDEVVVRQFNVEQIKKRLEEEE  743

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+ +  +T
Sbjct  744  EAYHRQSQQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRAVTYVT  790



>dbj|BAF00450.1| putative bZIP protein [Arabidopsis thaliana]
Length=798

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 176/233 (76%), Gaps = 8/233 (3%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  557  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSS  616

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LLHAW D + K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TR
Sbjct  617  PPRVPNPAIQKLLHAWYDRLDKIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETR  676

Query  447  KELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            KEL ++ R+FEDWYHKY+Q+R P   N D E D  H D  V  RQ  +E +K+RL+EEEE
Sbjct  677  KELGRKIRQFEDWYHKYIQKRGPEGMNPD-EADNDHND-EVAVRQFNVEQIKKRLEEEEE  734

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
            AY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+   +IT+   R+S
Sbjct  735  AYHRQSHQVREKSLASLRTRLPELFQAMSEVAYSCSDMYR---AITYASKRQS  784



>ref|XP_003597769.1| hypothetical protein MTR_2g102050 [Medicago truncatula]
 gb|AES68020.1| BZIP protein [Medicago truncatula]
Length=760

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 176/234 (75%), Gaps = 2/234 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK+TSEHH+ERTYQL VVVQ+WH QFE ++ +QK YI+ L++WLKLNL+PI+++LKEKVS
Sbjct  527  PKQTSEHHHERTYQLLVVVQQWHLQFEMLVNNQKGYIKSLSNWLKLNLIPIESSLKEKVS  586

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PP+  LLHAW D + K+PD+LA+TAI +F+AV++TI   Q DEM LK +C+++
Sbjct  587  SPPRVRSPPVQGLLHAWHDRLEKIPDDLARTAIGNFAAVIDTIFNQQEDEMVLKRKCEES  646

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            RKEL ++TR+FEDWYHKYMQR+ P   D   +D    D  V E+Q  +E +++RL+ EE 
Sbjct  647  RKELSRKTRQFEDWYHKYMQRKMPEEVDPEAEDANAPDEVVTEKQFLVEQVRKRLEHEEA  706

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNREST  115
             Y +QC+QVR K+L SL+  +PELF AM +FS  CS MY  L SI+  L + S+
Sbjct  707  EYEKQCIQVRQKTLGSLKNRMPELFRAMCDFSLECSKMYMELGSISQHLGQNSS  760



>ref|XP_007137162.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
 gb|ESW09156.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
Length=694

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 172/226 (76%), Gaps = 2/226 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHYERT QL  V+QEWH QFEK++  QK YI+ LN WLKLNL+PI+ NLKEK+S
Sbjct  462  PKETTKHHYERTVQLWNVIQEWHLQFEKLVSQQKHYIKALNSWLKLNLIPIERNLKEKIS  521

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP + QNPPI ALLHAW D + KLPDELAK+AI SF+AV+ TI+  Q +EMKLK+RC++T
Sbjct  522  SPPKAQNPPIQALLHAWHDYVDKLPDELAKSAISSFAAVIKTIILQQEEEMKLKERCEET  581

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEE  277
            RKE  K+ + FE+WY K++ R+ P D   + G   +  N V +RQ  +E+L+++L+EE E
Sbjct  582  RKEYLKKKQAFEEWYQKHLMRKGPEDAEHERGEEVNTHNPVSDRQFVVESLQKKLEEEIE  641

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            ++ +QC+QVR KSL S +T LPELF A+S++S AC   Y+ L+SIT
Sbjct  642  SHQKQCVQVREKSLQSFKTRLPELFRALSDYSHACFDAYEKLKSIT  687



>ref|XP_010479738.1| PREDICTED: kinesin-related protein 4-like [Camelina sativa]
Length=804

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 172/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +M+ HQKEYI+ L  W+KLNL+PI++ LKEKVSS
Sbjct  561  KETNDHHHERTIQLLAVVQEWHTQFCRMVDHQKEYIKALAGWIKLNLIPIESTLKEKVSS  620

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LL  W D + K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TR
Sbjct  621  PPRVPNPAIQKLLTVWYDRLDKIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETR  680

Query  447  KELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWYHKYMQ+R P     D +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  681  KELGRKIRQFEDWYHKYMQKRGPEGMNPDGSEADNDHKD-EVVVRQFNVEQIKKRLEEEE  739

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+ +  +T
Sbjct  740  EAYHRQSQQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRAVTYVT  786



>ref|XP_004305292.1| PREDICTED: uncharacterized protein LOC101294200 [Fragaria vesca 
subsp. vesca]
Length=733

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 175/225 (78%), Gaps = 4/225 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK T++HH+ERT QL  VVQEWHSQF K++  QKEY++ L +WLKLNL+PI++NLKEKVS
Sbjct  497  PKYTTDHHHERTVQLWYVVQEWHSQFVKLVSKQKEYVKALRNWLKLNLIPIESNLKEKVS  556

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI  LL  W D + KLPDE+A+TAI++F+ +++TI+  Q +EMK+K++C+D+
Sbjct  557  SPPRIQNPPIQGLLLEWNDHLDKLPDEVARTAIHNFAGIIHTIMLKQEEEMKMKEKCEDS  616

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHED---NNVIERQLQLEALKQRLKEEE  280
            RKEL+++ R+FEDWYHKYM +  P D+ + + P  +   + V E+Q  +E +++RL+EEE
Sbjct  617  RKELDRKKRQFEDWYHKYMNKNIP-DEVDPERPESNVRGDVVAEKQFNVEVVQKRLEEEE  675

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLES  145
            EAY R C+QVR KS+TSL+TGLPELF A+  F+ +CS MY+ L S
Sbjct  676  EAYARLCLQVREKSITSLKTGLPELFRALVAFAVSCSEMYKHLNS  720



>ref|XP_003527819.1| PREDICTED: uncharacterized protein LOC100807597 [Glycine max]
Length=711

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 174/226 (77%), Gaps = 2/226 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHY+RT QL  V+ EWH QFEK++  QK YI+ LN WLKLNL+PI++NLKEK+S
Sbjct  479  PKETTKHHYDRTVQLEKVILEWHLQFEKLVTQQKHYIKALNSWLKLNLIPIESNLKEKIS  538

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP + QNPPI ALLHAW D + KLPDELAK+AI SF+AV+ TI+  Q +EMKLK+RC++T
Sbjct  539  SPPKAQNPPIQALLHAWHDYVDKLPDELAKSAISSFAAVIKTILLQQEEEMKLKERCEET  598

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGP--HEDNNVIERQLQLEALKQRLKEEEE  277
            RKE  K+ + FE+WY K++ RR P++   + G   + +N V ERQ  +E+L++RL+EE E
Sbjct  599  RKEYLKKKQAFEEWYQKHLMRRGPDEAEHERGEEVNTNNPVSERQFVVESLQKRLEEEIE  658

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            ++ + C+QVR KSL SL+T LPELF A+S+++ AC+  Y+ L+ IT
Sbjct  659  SHQKHCIQVREKSLQSLKTRLPELFRALSDYAHACAEAYEKLKLIT  704



>gb|KJB65700.1| hypothetical protein B456_010G109200 [Gossypium raimondii]
Length=726

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H++ T QL  VVQEWHSQF K++ +QK+YI  LN+WLKLNL+PI+++LKEK+SS
Sbjct  493  KETTKQHHDWTIQLHNVVQEWHSQFNKLVTNQKQYILALNNWLKLNLIPIESSLKEKISS  552

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI ALLHAW D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  553  PPRAQNPPIQALLHAWHDCLEKLPDEVAKSAISSFAAVIKTIIIHQDEEMKLKEKCEETR  612

Query  447  KELEKRTRKFEDWYHKYMQRRTPND--DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            KE  ++++ FE+WYHKY QRR+  D  D  +D   +D  V ERQL +E+LK+RL+EE EA
Sbjct  613  KEFLRKSQAFEEWYHKYKQRRSALDEIDAGEDANAKD-PVSERQLVVESLKKRLEEEAEA  671

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            + + C+QVR KS+ SL+  LPE+F A+S++S ACS  Y+ L S+T
Sbjct  672  HKKHCIQVREKSIGSLKIRLPEIFRALSDYSHACSEAYEKLRSVT  716



>ref|XP_009616206.1| PREDICTED: uncharacterized protein LOC104108786 [Nicotiana tomentosiformis]
Length=728

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 169/226 (75%), Gaps = 3/226 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETS+HH+ERT QLG VV+EWH  F+ ++ +QK YI+ L+ WLKLNL+PI+++LKEK+S
Sbjct  493  PLETSKHHHERTIQLGNVVKEWHDHFDNLVKNQKLYIQTLHSWLKLNLIPIESSLKEKIS  552

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI ALLH+WQ+L+ K PDELAK+AI SF AV+ TI+ HQ +EMKLK++C++T
Sbjct  553  SPPRAQNPPIQALLHSWQELLEKFPDELAKSAIASFEAVIRTIIIHQEEEMKLKEKCEET  612

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            RKE  ++ + FEDWY KYMQRRTP D  + D   E N    V E+Q  ++ALK+RL EE 
Sbjct  613  RKEYIRKRQAFEDWYQKYMQRRTPPDVADPDRATESNPKDPVAEKQFLVDALKKRLDEET  672

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            EA+ + C+QVR KSL SL+  LPELF AMSE+S AC   Y  L  I
Sbjct  673  EAHQKHCIQVREKSLGSLKIRLPELFRAMSEYSYACLEAYGRLRLI  718



>ref|XP_010500831.1| PREDICTED: uncharacterized protein LOC104778154 [Camelina sativa]
Length=809

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 172/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  W+KLNL+PI++ LKEKVSS
Sbjct  566  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALAGWIKLNLIPIESTLKEKVSS  625

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LL  W D + K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TR
Sbjct  626  PPRVPNPAIQKLLTVWYDRLDKIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETR  685

Query  447  KELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FEDWY+KYMQ+R P     D +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  686  KELGRKIRQFEDWYYKYMQKRGPEGMNPDGSEADNDHKD-EVVVRQFNVEQIKKRLEEEE  744

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+ +  +T
Sbjct  745  EAYHRQSQQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRAVTYVT  791



>ref|XP_006356661.1| PREDICTED: uncharacterized protein LOC102596799 [Solanum tuberosum]
Length=719

 Score =   264 bits (675),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 171/227 (75%), Gaps = 3/227 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETS+HH+ERT QLG V++EWH  F+ ++ +QK YI+ L+ WLKLNL+PI+++LKEK+S
Sbjct  481  PLETSKHHHERTIQLGNVIKEWHDHFDNLVKNQKLYIQTLHSWLKLNLIPIESSLKEKIS  540

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI ALLH+WQ+L+ KLPDELA++AI SF AV+ TI+ HQ +EMKLKD+C++T
Sbjct  541  SPPRAQSPPIQALLHSWQELLEKLPDELARSAIASFEAVIRTIIIHQEEEMKLKDKCEET  600

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            +KE  ++ + FEDWY KYMQRRTP D T+ D   E N    V+E+QL ++ LK+RL EE 
Sbjct  601  KKEYIRKRQAFEDWYQKYMQRRTPPDMTDTDRATESNPKDPVVEKQLLVDTLKKRLDEET  660

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EA+ R C+QVR KSL SL+  LPELF  MSE+S AC   Y  L  I 
Sbjct  661  EAHQRLCIQVREKSLGSLKIRLPELFRVMSEYSYACLEAYGRLRLIV  707



>ref|XP_004292865.1| PREDICTED: uncharacterized protein LOC101308445 [Fragaria vesca 
subsp. vesca]
Length=722

 Score =   264 bits (675),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 174/229 (76%), Gaps = 4/229 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH+ERT QL  VVQ WHS+FEK+++HQK+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  486  PMETTKHHHERTEQLFNVVQHWHSEFEKLVLHQKQYIQALNSWLKLNLIPIESSLKEKIS  545

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AW D + KLPDELAK+A  SF+AV+ TI+ HQ +EMKLK++ ++T
Sbjct  546  SPPRVQRPPIQPLLLAWHDFLEKLPDELAKSATSSFAAVIKTILLHQEEEMKLKEQFENT  605

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKE  ++ + F+DWY KYMQR  P +   +  +D  H+D  + ERQ  +E+LK++++EE 
Sbjct  606  RKEFLRKNQAFDDWYQKYMQRHGPGEADQERSEDANHKD-PIAERQFAVESLKKKMEEEA  664

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHP  133
            EA+ R C+QVR KSL SL+T LPELF AMS+++ AC+  Y  L+S+T P
Sbjct  665  EAHQRHCIQVREKSLGSLKTRLPELFRAMSDYAHACADAYGKLKSVTMP  713



>ref|XP_010942485.1| PREDICTED: uncharacterized protein LOC105060463 [Elaeis guineensis]
Length=734

 Score =   264 bits (675),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 171/232 (74%), Gaps = 4/232 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HHY+RT QL  VV+ WHSQF+K++ HQK+YI+ L+ WLK N++PI+++LKEKVS
Sbjct  499  PKETSQHHYKRTMQLFDVVKGWHSQFDKLVSHQKDYIQALSSWLKSNVIPIESSLKEKVS  558

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP  PPI ALLHAW D + KLPDELAK+AI SFSAV+NTI+  Q +E+K K++C +T
Sbjct  559  SPPRPHQPPIQALLHAWHDHLEKLPDELAKSAILSFSAVINTIMTLQQEELKQKEKCNET  618

Query  450  RKELEKRTRKFEDWYHKYMQRRTP----NDDTEQDGPHEDNNVIERQLQLEALKQRLKEE  283
            RKE  K+TR FEDWY KY  RR            +G  + + V+ER++ +E +K RL EE
Sbjct  619  RKEYLKKTRAFEDWYSKYSHRRAALSEEAGQEGGEGADQKDPVVERKIAVETVKSRLDEE  678

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EE + + C QVR KS  SL+T LPELF AMS+F+ ACS MY+ L+SI+ P N
Sbjct  679  EENHEKLCKQVREKSFGSLKTHLPELFRAMSDFAHACSEMYKMLKSISQPQN  730



>ref|XP_004245249.1| PREDICTED: uncharacterized protein LOC101255018 [Solanum lycopersicum]
Length=725

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 171/227 (75%), Gaps = 3/227 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETS+HH+ERT QLG V++EWH  F+ ++ +QK YI+ L+ WLKLNL+PI+++LKEK+S
Sbjct  490  PLETSKHHHERTIQLGNVIKEWHDHFDNLVKNQKLYIQTLHSWLKLNLIPIESSLKEKIS  549

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI ALLH+WQ+L+ KLPDELA++AI SF AV+ TI+ HQ +EMKLKD+C++T
Sbjct  550  SPPRAQSPPIQALLHSWQELLEKLPDELARSAIASFEAVIRTIIIHQEEEMKLKDKCEET  609

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            +KE  ++ + FEDWY KYMQRRTP D T+ D   + N    V+E+QL ++ LK+RL EE 
Sbjct  610  KKEYIRKRQAFEDWYQKYMQRRTPPDMTDPDRAADSNPKDPVVEKQLLVDTLKKRLDEET  669

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EA+ R C+QVR KSL SL+  LPELF  MSE+S AC   Y  L  I 
Sbjct  670  EAHQRLCIQVREKSLGSLKIRLPELFRVMSEYSYACLEAYGRLRLIV  716



>ref|XP_010251918.1| PREDICTED: uncharacterized protein LOC104593650 [Nelumbo nucifera]
Length=740

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 172/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  VVQEWHSQF+K++ HQKEYIR LN+WLKLNL+PI+++LKEKVS
Sbjct  504  PKETSEHHHERTVQLCRVVQEWHSQFQKLVTHQKEYIRALNNWLKLNLIPIESSLKEKVS  563

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI +LLHAW D + KLP ELA TAI +F+AV+ TI+ HQ DEMKLK++ ++T
Sbjct  564  SPLRVHRPPIQSLLHAWHDNLEKLPYELAGTAISTFAAVIKTIIVHQEDEMKLKEKWEET  623

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTE----QDGPHEDNNVIERQLQLEALKQRLKEE  283
             KE  ++ + FE+W+ KYMQRRT +D+ +    +D  H+D  V E+Q  +E L++RL+EE
Sbjct  624  NKEYIRKKQAFEEWHQKYMQRRTQSDEMDPERAEDANHKD-PVTEKQFVVETLRKRLEEE  682

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             EA+ + C QVR KS  SL+  LPELF AMS+F+ ACS MY  L SI
Sbjct  683  IEAHQKLCRQVREKSAGSLKMHLPELFRAMSDFAFACSDMYNRLRSI  729



>ref|XP_011007598.1| PREDICTED: uncharacterized protein LOC105113217 [Populus euphratica]
Length=688

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 181/230 (79%), Gaps = 2/230 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH++RT+QL VVVQ W SQF K+I +QK Y++ LN WLKLNL+PI+++LKEKVS
Sbjct  457  PKETSEHHHDRTFQLLVVVQGWQSQFCKLIDNQKGYVKALNCWLKLNLIPIESSLKEKVS  516

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI +LL AW D + KLPDE+A++AI +F++V++ I+Q+Q +EMKLK++C++T
Sbjct  517  SPPRVQNPPIQSLLIAWHDFLDKLPDEVARSAINNFASVIHAILQNQEEEMKLKEKCEET  576

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNN-VIERQLQLEALKQRLKEEEE  277
            RKEL ++T+KF+ WY K+MQ++ P + D E      DN+ V +RQ  ++A+K+RL+EEEE
Sbjct  577  RKELSQKTKKFQSWYRKHMQQKMPAEFDPELTEDKSDNDAVADRQFAVDAVKKRLEEEEE  636

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            AY +Q +QVR KSL SL+T LP+LF AM + ++ACS MY+ L+ I+   N
Sbjct  637  AYKKQRIQVREKSLASLKTRLPDLFRAMFDIAQACSEMYRNLKFISQRRN  686



>ref|XP_006306796.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
 gb|EOA39694.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
Length=801

 Score =   263 bits (672),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 173/227 (76%), Gaps = 5/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSS
Sbjct  558  KETNDHHHERTIQLLAVVQEWHTQFCRMIDHQKEYIKALLGWLKLNLIPIESTLKEKVSS  617

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LL  W D + K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TR
Sbjct  618  PPRVPNPAIHKLLTIWYDRLDKIPDEMARTAIINFAAVISTIMQQQEDEISLRNKCEETR  677

Query  447  KELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            KEL ++ R+FE+WY+KYMQ+R P     D +E D  H+D  V+ RQ  +E +K+RL+EEE
Sbjct  678  KELGRKIRQFEEWYYKYMQKRGPEGMNPDGSEADNDHKD-EVVVRQFNVEQIKKRLEEEE  736

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY RQ  QVR KSL SLRT LPELF AMSE + +CS MY+++  +T
Sbjct  737  EAYHRQSQQVREKSLASLRTRLPELFQAMSEVAYSCSDMYRSVTYMT  783



>ref|XP_009383699.1| PREDICTED: uncharacterized protein LOC103971407 [Musa acuminata 
subsp. malaccensis]
Length=751

 Score =   262 bits (669),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 167/227 (74%), Gaps = 3/227 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETSEHH++ T+QL  + +EWH+QF K++ HQK+Y+  LN WLKL L+PI+++LKEKVS
Sbjct  518  PRETSEHHHKHTFQLLEIAKEWHTQFNKLVSHQKDYVESLNSWLKLTLIPIESSLKEKVS  577

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SPQRP + PI +LLHAW + +GKLPDELAK+AI SFSAV+NTIV  Q +E K K++C++ 
Sbjct  578  SPQRPAHAPIQSLLHAWHEYLGKLPDELAKSAILSFSAVINTIVTLQQEERKQKEKCEEA  637

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEE  280
             KE  K+ R F+DW+ KY QRR  +   E DG    N    V ER+  +E+LK +  EE 
Sbjct  638  HKEYSKKNRAFDDWFQKYSQRRMGSSVGEPDGGEGSNQKDPVEERRFMVESLKSKFDEEV  697

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EA+ R C QVR KSL+SL+T LPELF AMS+F+ ACS MY +L+ IT
Sbjct  698  EAHRRLCKQVREKSLSSLKTHLPELFRAMSDFANACSKMYASLKMIT  744



>gb|KJB13152.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
 gb|KJB13153.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
Length=742

 Score =   261 bits (668),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 178/229 (78%), Gaps = 2/229 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETSEHH+ERT QL  +VQ+WH QF K+I HQKEYI+ LN+WL+LNL+PI+++LKEKVSS
Sbjct  509  QETSEHHHERTIQLLAIVQDWHMQFCKLIDHQKEYIKALNNWLRLNLIPIESSLKEKVSS  568

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R ++PPI  L+ AWQD + KLPDE+A++AI +F+ V++ I+QHQLDEMKLK++C+ ++
Sbjct  569  PPRVESPPIQRLIFAWQDKLDKLPDEIARSAINNFAHVIDAIMQHQLDEMKLKEKCEGSQ  628

Query  447  KELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            KEL+K+ ++FEDWY+KYMQRRTP   D T  D    ++ V ERQL ++A+K+RL EEEEA
Sbjct  629  KELKKKQQQFEDWYNKYMQRRTPEELDPTRTDDNSNNDAVTERQLMVDAVKKRLGEEEEA  688

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            Y    +QVR KSL SL+T LPELF AMS  + ACS MY  L +I+   N
Sbjct  689  YRILRIQVREKSLVSLKTRLPELFRAMSTIAVACSKMYGELRAISRSRN  737



>ref|XP_007024146.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024147.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024148.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26768.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26769.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26770.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=736

 Score =   261 bits (667),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 185/230 (80%), Gaps = 2/230 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  +VQ+WH QF K++ HQK YI  LN+WL+LNLVPI+++LKEKVS
Sbjct  502  PKETSEHHHERTIQLLAIVQDWHMQFCKLVDHQKGYIIALNNWLRLNLVPIESSLKEKVS  561

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R + PPIL LL AWQ+ + KLPDE+A++AI +F+ V++TI+QHQLDEMKLK++C+++
Sbjct  562  SPPRVETPPILGLLTAWQNQLEKLPDEIARSAINNFAHVLDTIMQHQLDEMKLKEKCEES  621

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNN-VIERQLQLEALKQRLKEEEE  277
             KEL+++ R+F+DWYHKYMQRRTP + D E+   + +N  V ERQ+ +EA+K+R +EE+E
Sbjct  622  EKELQRKERQFKDWYHKYMQRRTPEELDPERTEANPNNEAVTERQVMVEAVKKRWEEEKE  681

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            AY R C+QVR KS+ SL+T LPELF+AM+  ++ACS +Y  L SI+H  N
Sbjct  682  AYQRLCIQVREKSMVSLKTRLPELFNAMTGIAKACSKLYGELRSISHSKN  731



>ref|XP_009151092.1| PREDICTED: uncharacterized protein LOC103874418 [Brassica rapa]
Length=735

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+++T Q   V++EWH QFE+++ HQK+YI  LN WLKLNL+PI+++LKE+VSS
Sbjct  508  KETTKQHHQQTRQFCTVLEEWHVQFERLVTHQKQYINSLNTWLKLNLIPIESSLKERVSS  567

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ+PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC+DTR
Sbjct  568  PPRPQHPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIRTILLHQEEEMKLKERCEDTR  627

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            KE  ++ + FE+WY K++++R P    E++G  ED++V ER++ +E+LK+RL++EEEA+ 
Sbjct  628  KEFIRKKQGFEEWYQKHLEKRGP---VEEEGG-EDDHVTERRIVVESLKKRLEDEEEAHQ  683

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  684  RHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRIIS  726



>emb|CDX88193.1| BnaA06g27840D [Brassica napus]
Length=737

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+++T Q   V++EWH QFEK++ HQK+YI  LN WLKLNL+PI+++LKE+VSS
Sbjct  510  KETTKQHHQQTRQFCTVLEEWHVQFEKLVTHQKQYINSLNTWLKLNLIPIESSLKERVSS  569

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ+PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC+DTR
Sbjct  570  PPRPQHPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIRTILLHQEEEMKLKERCEDTR  629

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            +E  ++ + FE+WY K++++R P    E++G  ED++V ER++ +E+LK+RL++EEEA+ 
Sbjct  630  REFIRKKQGFEEWYQKHLEKRGP---VEEEGG-EDDHVTERRIVVESLKKRLEDEEEAHQ  685

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  686  RHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRIIS  728



>ref|XP_010938806.1| PREDICTED: uncharacterized protein LOC105057803 [Elaeis guineensis]
Length=670

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 171/233 (73%), Gaps = 5/233 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHHY+RT QL  +V+EWHSQF+K++ HQK YI+ LN+WLKLN++PI+++LKE+VS
Sbjct  434  PKETSEHHYKRTLQLFEIVKEWHSQFDKLVSHQKVYIQALNNWLKLNVIPIESSLKERVS  493

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP  PPI ALL AW++ + KLPDELAK+AI SFSAV+NTIV  Q +E+K K++C +T
Sbjct  494  SPPRPHQPPIQALLLAWREHLEKLPDELAKSAILSFSAVINTIVTLQQEELKQKEKCDET  553

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQ-----DGPHEDNNVIERQLQLEALKQRLKE  286
            RKE  K+TR FEDWY KY QRR      E      +G  + + V ER+  +E++K RL +
Sbjct  554  RKEYLKKTRAFEDWYSKYSQRRATALSEEAMQEGTEGATQKDPVAERKFAVESVKLRLDD  613

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EE+ + + C QVR KS  SL+T LPELF AMS+F+ A S MY  L+S++   N
Sbjct  614  EEDNHRKLCKQVREKSFGSLKTHLPELFRAMSDFAYASSDMYMKLKSVSQGQN  666



>ref|XP_010049074.1| PREDICTED: uncharacterized protein LOC104437750 [Eucalyptus grandis]
Length=650

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 169/224 (75%), Gaps = 0/224 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHY+RT QL   V EW  QF+K+I HQK+YI+ L+ WLKLNL+PI+++LKEK+S
Sbjct  417  PKETTKHHYDRTDQLHKYVLEWQLQFDKLITHQKQYIQALHSWLKLNLIPIESSLKEKIS  476

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI AL+ +W D + KLPDELAK+AI++F+AV++ I+ HQ +EMKLKD+C++T
Sbjct  477  SPPRAQNPPIQALIVSWHDYLEKLPDELAKSAIFAFAAVIHNIIAHQEEEMKLKDKCEET  536

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+E  ++ + FEDWY KY  RR P++   +D  H D  VIERQ  +E+L ++L+++ EA+
Sbjct  537  RREYLRKKQAFEDWYQKYEHRRVPDETRTEDANHHDPVVIERQAVVESLYKKLEDDVEAH  596

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             R C+QVR KSL +L+  LPELF AM+ +S+ C+  Y  L  IT
Sbjct  597  RRLCIQVREKSLGNLKNRLPELFRAMAAYSQHCADAYGNLRFIT  640



>ref|XP_008362707.1| PREDICTED: uncharacterized protein LOC103426389 isoform X2 [Malus 
domestica]
Length=711

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 177/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK TSEHH+ERT QL  VVQ WH +FEK++  QKEYI+ LN+WLKLNL+PI++NLKEKVS
Sbjct  475  PKHTSEHHHERTIQLFGVVQGWHGEFEKLVSQQKEYIKALNNWLKLNLIPIESNLKEKVS  534

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AW D + KLPD++A+ AI++F+AV+NTI+ HQ +E+K+K++C+DT
Sbjct  535  SPPRIQRPPIQELLLAWHDHLEKLPDDVARMAIHNFAAVINTIMIHQEEEIKMKEKCEDT  594

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNNVI-ERQLQLEALKQRLKEEEE  277
            RKEL ++ R+FEDWY+K M +  P++ DT++   H  ++V+ E+Q  +E +K+RL+EEEE
Sbjct  595  RKELSRKARQFEDWYNKNMHKTIPDEGDTDRPEGHTRSDVVAEKQFAVETVKKRLEEEEE  654

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLES  145
            +Y R C+QVR KS+ SL+T LPELF  +S+F+ +CS MY++L S
Sbjct  655  SYERLCLQVREKSIASLKTRLPELFGVLSDFAYSCSEMYRSLRS  698



>gb|KDP34224.1| hypothetical protein JCGZ_07795 [Jatropha curcas]
Length=751

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 172/226 (76%), Gaps = 3/226 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET+  H++RT QL  VVQEWHS FEK++ +QK+YI+ LN WLKLNL+PI+++LKEK+SS
Sbjct  516  KETTRQHHDRTKQLHNVVQEWHSHFEKLVTYQKQYIQILNSWLKLNLIPIESSLKEKISS  575

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P +  NPPI  LLH W D + KLPDE+AK+AI SF+AV+ TI  HQ +EMKLK++C++TR
Sbjct  576  PPKVPNPPIQPLLHTWHDYLEKLPDEVAKSAISSFAAVIKTIELHQEEEMKLKEKCEETR  635

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEE  277
            KE  +R++ F++WY K+MQRRTP D+ + +   + N    V ERQ  +E+LK+RL+EE E
Sbjct  636  KEFLRRSQAFDEWYQKHMQRRTPTDEIDAERGEDANAKDPVYERQSAVESLKKRLEEEIE  695

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            A+ R C+QVR KSL SL+  LPELF AMS+++ ACS  Y+ L ++T
Sbjct  696  AHQRHCVQVREKSLGSLKIRLPELFRAMSDYAHACSDAYEKLRALT  741



>ref|XP_007225191.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
 gb|EMJ26390.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
Length=711

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 170/226 (75%), Gaps = 0/226 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH++RT QL  V+QEW SQF+K++ HQK+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  484  PMETTKHHHDRTVQLYNVLQEWLSQFDKLVTHQKQYIQALNSWLKLNLIPIESSLKEKIS  543

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI  LLH+W D + KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++T
Sbjct  544  SPPRVQHPPIQVLLHSWHDFLEKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEET  603

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++++ F+DWY KY QR    D    +  +  + V ER+  +E+LK++L+EE EA+
Sbjct  604  RKEYLRKSQAFDDWYQKYAQRHAEMDQERGEDANPKDPVAERKFIVESLKKKLEEEVEAH  663

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHP  133
             R C+QVR KSL SLRT LPE+F AMS+++  CS  Y  L S+T P
Sbjct  664  QRHCIQVREKSLGSLRTRLPEIFRAMSDYAHTCSESYGKLRSLTEP  709



>ref|XP_008362706.1| PREDICTED: uncharacterized protein LOC103426389 isoform X1 [Malus 
domestica]
Length=744

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 177/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK TSEHH+ERT QL  VVQ WH +FEK++  QKEYI+ LN+WLKLNL+PI++NLKEKVS
Sbjct  508  PKHTSEHHHERTIQLFGVVQGWHGEFEKLVSQQKEYIKALNNWLKLNLIPIESNLKEKVS  567

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AW D + KLPD++A+ AI++F+AV+NTI+ HQ +E+K+K++C+DT
Sbjct  568  SPPRIQRPPIQELLLAWHDHLEKLPDDVARMAIHNFAAVINTIMIHQEEEIKMKEKCEDT  627

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNNVI-ERQLQLEALKQRLKEEEE  277
            RKEL ++ R+FEDWY+K M +  P++ DT++   H  ++V+ E+Q  +E +K+RL+EEEE
Sbjct  628  RKELSRKARQFEDWYNKNMHKTIPDEGDTDRPEGHTRSDVVAEKQFAVETVKKRLEEEEE  687

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLES  145
            +Y R C+QVR KS+ SL+T LPELF  +S+F+ +CS MY++L S
Sbjct  688  SYERLCLQVREKSIASLKTRLPELFGVLSDFAYSCSEMYRSLRS  731



>gb|KCW81524.1| hypothetical protein EUGRSUZ_C02885 [Eucalyptus grandis]
Length=747

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 169/224 (75%), Gaps = 0/224 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++HHY+RT QL   V EW  QF+K+I HQK+YI+ L+ WLKLNL+PI+++LKEK+S
Sbjct  514  PKETTKHHYDRTDQLHKYVLEWQLQFDKLITHQKQYIQALHSWLKLNLIPIESSLKEKIS  573

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI AL+ +W D + KLPDELAK+AI++F+AV++ I+ HQ +EMKLKD+C++T
Sbjct  574  SPPRAQNPPIQALIVSWHDYLEKLPDELAKSAIFAFAAVIHNIIAHQEEEMKLKDKCEET  633

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R+E  ++ + FEDWY KY  RR P++   +D  H D  VIERQ  +E+L ++L+++ EA+
Sbjct  634  RREYLRKKQAFEDWYQKYEHRRVPDETRTEDANHHDPVVIERQAVVESLYKKLEDDVEAH  693

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             R C+QVR KSL +L+  LPELF AM+ +S+ C+  Y  L  IT
Sbjct  694  RRLCIQVREKSLGNLKNRLPELFRAMAAYSQHCADAYGNLRFIT  737



>ref|XP_008220000.1| PREDICTED: uncharacterized protein LOC103320143 [Prunus mume]
Length=713

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 170/226 (75%), Gaps = 0/226 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH++RT QL  V+QEW SQF+K++ HQK+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  486  PMETTKHHHDRTVQLYNVLQEWLSQFDKLVTHQKQYIQALNSWLKLNLIPIESSLKEKIS  545

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI  LLH+W D + KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++T
Sbjct  546  SPPRVQHPPIQVLLHSWHDFLEKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEET  605

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++++ F+DWY KY QR    D    +  +  + V ER+  +E+LK++L+EE EA+
Sbjct  606  RKEYLRKSQAFDDWYQKYTQRHAEMDQERGEDANPKDPVAERKFIVESLKKKLEEEVEAH  665

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHP  133
             R C+QVR KSL SL+T LPE+F AMS+++  CS  Y  L S+T P
Sbjct  666  QRHCIQVREKSLGSLKTRLPEIFRAMSDYAHTCSESYGKLRSLTEP  711



>ref|XP_004172478.1| PREDICTED: uncharacterized protein LOC101231290 [Cucumis sativus]
Length=696

 Score =   255 bits (651),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HH+ERT QL  VV+EWHSQFEK+   QK+YI+ LN WLKLNL+PI+++LKEKVS
Sbjct  469  PKETSLHHHERTVQLCNVVREWHSQFEKLAYRQKDYIKALNSWLKLNLIPIESSLKEKVS  528

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI  LL AW D + KLPDE  +TAI SFSAV++TI+  Q +EMKLK RC +T
Sbjct  529  SPPRAQNPPIQRLLTAWHDQLEKLPDEHLRTAISSFSAVISTIMLQQEEEMKLKLRCDET  588

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
             KEL ++ R+F+DW++KY QRR P+  D  + +   +D  V ER + +E+LK+RL+EE+E
Sbjct  589  EKELMRKQRQFDDWHYKYQQRRMPDELDPEKSEENSQDAAVTERLVVVESLKKRLEEEKE  648

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             + +QC+ VR KSL SL+  LPELF A+SEFS A S MY+ L  I
Sbjct  649  THAKQCLHVREKSLVSLKNQLPELFRALSEFSSAGSDMYKNLRLI  693



>ref|XP_008378117.1| PREDICTED: uncharacterized protein LOC103441188 [Malus domestica]
Length=710

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 167/223 (75%), Gaps = 0/223 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH+ RT QL  V+ EWHS FE ++ HQK+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  483  PMETTKHHHARTVQLWNVLXEWHSHFENLVTHQKQYIQALNSWLKLNLIPIESSLKEKIS  542

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI ALLH+W D + KLPDELAK+AI SFSAV+ TI+ HQ +EMKLK++ ++T
Sbjct  543  SPPRVQHPPIQALLHSWHDFLEKLPDELAKSAISSFSAVIKTIILHQEEEMKLKEKFEET  602

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++ + FEDWY KY QR    D+   +     + V E++  +++LK+RL+EE EA+
Sbjct  603  RKEYLRKNQAFEDWYQKYSQRHAEMDEERGEDAVPKDPVSEKKFIVDSLKKRLEEECEAH  662

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             R C+QVR KSL SL+T LPE+F AM++++RACS  Y  L SI
Sbjct  663  QRHCIQVREKSLGSLKTRLPEIFRAMTDYARACSEAYGKLRSI  705



>ref|XP_004150356.1| PREDICTED: uncharacterized protein LOC101203914 [Cucumis sativus]
 gb|KGN58063.1| hypothetical protein Csa_3G481230 [Cucumis sativus]
Length=722

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HH+ERT QL  VV+EWHSQFEK+   QK+YI+ LN WLKLNL+PI+++LKEKVS
Sbjct  495  PKETSLHHHERTVQLCNVVREWHSQFEKLAYRQKDYIKALNSWLKLNLIPIESSLKEKVS  554

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI  LL AW D + KLPDE  +TAI SFSAV++TI+  Q +EMKLK RC +T
Sbjct  555  SPPRAQNPPIQRLLTAWHDQLEKLPDEHLRTAISSFSAVISTIMLQQEEEMKLKLRCDET  614

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
             KEL ++ R+F+DW++KY QRR P+  D  + +   +D  V ER + +E+LK+RL+EE+E
Sbjct  615  EKELMRKQRQFDDWHYKYQQRRMPDELDPEKSEENSQDAAVTERLVVVESLKKRLEEEKE  674

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             + +QC+ VR KSL SL+  LPELF A+SEFS A S MY+ L  I
Sbjct  675  THAKQCLHVREKSLVSLKNQLPELFRALSEFSSAGSDMYKNLRLI  719



>ref|XP_008447501.1| PREDICTED: uncharacterized protein LOC103489933 [Cucumis melo]
Length=736

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 171/225 (76%), Gaps = 2/225 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HHYERT QL  VV+EWHSQFEK++  QK+YI+ LN WLKLNL+PI+++LKEKVS
Sbjct  509  PKETSTHHYERTVQLCGVVREWHSQFEKLVRCQKDYIKSLNSWLKLNLIPIESSLKEKVS  568

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI  LL AW D + +LPDE  +TAI++F AV+NTI+  Q +E KLK + ++T
Sbjct  569  SPPRVQNPPIQKLLLAWHDQLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWEET  628

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPH-EDNNVIERQLQLEALKQRLKEEEE  277
             KEL+++ R F+DW++KY QRR P+D D E+     +D  V E+ + +E+LK+RL+EE+E
Sbjct  629  EKELDRKQRHFDDWHYKYQQRRIPDDMDPERSEERTQDAAVTEKSIAVESLKKRLEEEKE  688

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             + +QC+ VR KSL SL+  LPELF A+SEFS A S MY++L SI
Sbjct  689  THAKQCLHVREKSLVSLKNQLPELFRALSEFSFASSEMYKSLSSI  733



>ref|XP_009368022.1| PREDICTED: uncharacterized protein LOC103957563 [Pyrus x bretschneideri]
Length=709

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 168/224 (75%), Gaps = 0/224 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH++RT QL  V+QEWHS FEK++ HQK+YI+ LN W+KLNL+PI+++LKEK+S
Sbjct  482  PMETTKHHHDRTVQLWNVLQEWHSHFEKLVTHQKQYIQALNSWVKLNLIPIESSLKEKIS  541

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI ALLH+W D + KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++T
Sbjct  542  SPPRVQRPPIQALLHSWHDSLEKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEET  601

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++ + FEDWY KY QR    D    +     + V E++  +E+LK+R+++E EA+
Sbjct  602  RKEFLRKNQAFEDWYQKYAQRHAEMDQERGEDAIPKDPVSEKKFIVESLKKRMEDECEAH  661

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             R C+QVR KSL SL+T LPE+F AM++++ ACS +Y  L S T
Sbjct  662  QRHCIQVREKSLGSLKTRLPEIFRAMTDYAHACSEVYGKLRSTT  705



>ref|XP_009338711.1| PREDICTED: uncharacterized protein LOC103931028 [Pyrus x bretschneideri]
Length=709

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 168/224 (75%), Gaps = 0/224 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH++RT QL  V+QEWHS FEK++ HQK+YI+ LN W+KLNL+PI+++LKEK+S
Sbjct  482  PMETTKHHHDRTVQLWNVLQEWHSHFEKLVTHQKQYIQALNSWVKLNLIPIESSLKEKIS  541

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI ALLH+W D + KLPDELAK+AI SF+AV+ TI+ HQ +EMKLK++ ++T
Sbjct  542  SPPRVQRPPIQALLHSWHDSLEKLPDELAKSAISSFAAVIKTIILHQEEEMKLKEKFEET  601

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++ + FEDWY KY QR    D    +     + V E++  +E+LK+R+++E EA+
Sbjct  602  RKEFLRKNQAFEDWYQKYAQRHAEMDQERGEDAIPKDPVSEKKFIVESLKKRMEDECEAH  661

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             R C+QVR KSL SL+T LPE+F AM++++ ACS +Y  L S T
Sbjct  662  QRHCIQVREKSLGSLKTRLPEIFRAMTDYAHACSEVYGKLRSTT  705



>ref|XP_010667633.1| PREDICTED: uncharacterized protein LOC104884645 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 166/227 (73%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETS+ HY  T QL  VVQ+W  +FE ++  QK Y+R LN WLKLNL+PI++NLKEK+S
Sbjct  473  PRETSKPHYHCTLQLSNVVQQWQDRFETLVHQQKHYVRSLNSWLKLNLIPIESNLKEKIS  532

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R  +PPI ALLHAW D + KLPDE+ +TAI SF A++ TI+ HQ +EM+LK++C++T
Sbjct  533  SPPRAHHPPIQALLHAWHDALEKLPDEVTRTAISSFGAMIKTIILHQDEEMRLKEKCEET  592

Query  450  RKELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE  280
            RKE  ++ + FEDWYHKYMQR+ P   + +  +DGP +D  V ERQ+ +E+LK RL++E 
Sbjct  593  RKEFLRKNQAFEDWYHKYMQRKGPEAMDSERGEDGPGKD-PVSERQVVVESLKNRLEDEL  651

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            E Y R C+QVR KSL +L+T LPELF A+SE++ A    Y  L +I 
Sbjct  652  EKYQRHCVQVREKSLGTLKTRLPELFRALSEYAHASYDSYNKLRAIV  698



>ref|XP_004501198.1| PREDICTED: uncharacterized protein LOC101510604 [Cicer arietinum]
Length=696

 Score =   253 bits (646),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 170/222 (77%), Gaps = 0/222 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HHY+RT QL  V+QEW SQFEK++  QK+YI+ LN WLKLNL+PI++NLKEK+SS
Sbjct  466  KETTKHHYDRTLQLWNVIQEWQSQFEKLVTQQKQYIQALNSWLKLNLIPIESNLKEKISS  525

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P + QNPPI ALLHAW D + KLPDELAK+AI SF+AV+ TI+    +EMKLK++C++TR
Sbjct  526  PPKAQNPPIQALLHAWHDYLDKLPDELAKSAISSFAAVIKTILLXXXEEMKLKEKCEETR  585

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            KE  ++ + FE+WY K++ RR P+D    +  + +N + E+Q  + +L+++L+EE E++ 
Sbjct  586  KEFLRKNQAFEEWYQKHLLRRGPDDAERGEEGNTNNPLSEKQYVVGSLQKKLEEETESHK  645

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            + C+QVR KSL SL+T LPELF A+S+++ AC   Y+ L+ I
Sbjct  646  KLCVQVREKSLQSLKTRLPELFRALSDYTHACYDAYEKLKLI  687



>ref|XP_007024149.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY26771.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=743

 Score =   254 bits (648),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 188/243 (77%), Gaps = 9/243 (4%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH+ERT QL  +VQ+WH QF K++ HQK YI  LN+WL+LNLVPI+++LKEKVS
Sbjct  502  PKETSEHHHERTIQLLAIVQDWHMQFCKLVDHQKGYIIALNNWLRLNLVPIESSLKEKVS  561

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R + PPIL LL AWQ+ + KLPDE+A++AI +F+ V++TI+QHQLDEMKLK++C+++
Sbjct  562  SPPRVETPPILGLLTAWQNQLEKLPDEIARSAINNFAHVLDTIMQHQLDEMKLKEKCEES  621

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNN-VIERQLQLEALKQRLKEEEE  277
             KEL+++ R+F+DWYHKYMQRRTP + D E+   + +N  V ERQ+ +EA+K+R +EE+E
Sbjct  622  EKELQRKERQFKDWYHKYMQRRTPEELDPERTEANPNNEAVTERQVMVEAVKKRWEEEKE  681

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE-SITHPLNREST*PGNV  100
            AY R C+QVR KS+ SL+T LPELF+AM+  ++ACS +Y  L   ++ P   +      +
Sbjct  682  AYQRLCIQVREKSMVSLKTRLPELFNAMTGIAKACSKLYGELRYCVSEPFLPQ------L  735

Query  99   WPH  91
            WPH
Sbjct  736  WPH  738



>emb|CDX80528.1| BnaC07g29160D [Brassica napus]
Length=733

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+++T Q   V++EWH QFE+++ HQK+YI  LN WLKLNL+ I+++LKE+VSS
Sbjct  506  KETTKQHHQQTRQFCAVLEEWHVQFERLVTHQKQYINSLNTWLKLNLISIESSLKERVSS  565

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ+PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC++TR
Sbjct  566  PPRPQHPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIRTILLHQEEEMKLKERCEETR  625

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            +E  ++ + FE+WY K++++R P    E++G  ED++V ER++ +E+LK+RL++EEEA+ 
Sbjct  626  REFIRKKQGFEEWYQKHLEKRGP---VEEEGG-EDDHVTERRIVVESLKKRLEDEEEAHQ  681

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  682  RHCVQVREKSLHSLKIRLPEIFRALSDYAHACADSYEKLRIIS  724



>emb|CDP18480.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/227 (54%), Positives = 169/227 (74%), Gaps = 3/227 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETS+HH+ERT QL   V++ HS  EK++ +Q +YI  LN WLK NL+PI+++LKEK+S
Sbjct  490  PGETSKHHHERTCQLLHHVEDLHSHLEKLMTNQNQYIHFLNSWLKQNLIPIESSLKEKIS  549

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI  LL  W D + KLPD+ AK+AI++FS VV  I+ HQ +EMKLK+ C++T
Sbjct  550  SPPRSQNPPIQPLLQMWHDHLEKLPDDAAKSAIHTFSEVVKRILVHQEEEMKLKETCEET  609

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            RKE  ++++ FEDWYHKYMQRRTP+DD + D P E N    + E++  +E+LK+RL+EE 
Sbjct  610  RKEYLRKSQAFEDWYHKYMQRRTPHDDADPDRPEETNPNDPLAEKRFVVESLKKRLEEEM  669

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EA+ + C+QVR KSLTSL+ GLP+LF AMS+++ AC   Y +L S+ 
Sbjct  670  EAHQKHCIQVREKSLTSLKIGLPDLFRAMSDYAEACLNAYGSLRSLA  716



>ref|XP_010112163.1| hypothetical protein L484_019902 [Morus notabilis]
 gb|EXC32788.1| hypothetical protein L484_019902 [Morus notabilis]
Length=821

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 177/227 (78%), Gaps = 6/227 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKET++ H++RT QL  ++QEWHSQFEK++ HQK+YI+ LN WLKLNLVPI+++LKE +S
Sbjct  516  PKETTKQHHDRTVQLYNIIQEWHSQFEKLVTHQKQYIQALNSWLKLNLVPIESSLKEIIS  575

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI ALLH+W DL+ KLPDELAK+A  SF+AV+ TI+ HQ +EMKLK++C++T
Sbjct  576  SPPRAQHPPIQALLHSWHDLLEKLPDELAKSAASSFAAVIKTIILHQEEEMKLKEKCEET  635

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEE  283
            RKE  +R + FEDWY K+MQRR P++   + G  ED N    V E+Q  +++LK+RL+EE
Sbjct  636  RKEYLRRNQAFEDWYQKHMQRRGPDEMDPERG--EDANTKDPVSEKQFVVDSLKKRLEEE  693

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             EA+ + C+QVR KSL SL+T LPE+F AMS++S+ACS  Y+ L  +
Sbjct  694  IEAHQKHCLQVREKSLGSLKTRLPEIFRAMSDYSQACSDGYEKLSCV  740



>emb|CBI36151.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 155/224 (69%), Gaps = 35/224 (16%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH++RT QL +VVQEWHSQF+K++ +QK YI  L  WL+LNL+PI++NLKEKVS
Sbjct  333  PKETSEHHHKRTIQLWIVVQEWHSQFDKLVTNQKNYITALKKWLRLNLIPIESNLKEKVS  392

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RPQNPPI ALL AW D + KLPDELAKT+I +F+A++ TI+QHQ DEM+LK +C++T
Sbjct  393  SPPRPQNPPIQALLQAWNDHLEKLPDELAKTSISNFAAIIETIMQHQQDEMRLKAKCEET  452

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             KELE++TR+F DW+ K                                   LK+EEE Y
Sbjct  453  AKELERKTRQFNDWHSK-----------------------------------LKDEEETY  477

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             ++C+ VR KSL SL+  LPELF A+SEFS ACS MY  L SI+
Sbjct  478  QKECVLVRDKSLASLKNHLPELFRALSEFSYACSDMYSRLRSIS  521



>ref|XP_008228519.1| PREDICTED: uncharacterized protein LOC103327921 [Prunus mume]
Length=537

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 174/223 (78%), Gaps = 4/223 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK+TS+HH+ERT QL  VVQ WHS+  K++ +QK YI+ LN+WLKLNL+PI+++LKEKVS
Sbjct  301  PKQTSQHHHERTIQLLGVVQGWHSEIGKLVTYQKVYIKALNNWLKLNLIPIESSLKEKVS  360

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AWQD + KLPD++A+TAI++F AV++TIV  Q DE+K+KD+C++T
Sbjct  361  SPPRIQRPPIQGLLLAWQDHLEKLPDDVARTAIHNFGAVISTIVTLQEDEIKMKDKCEET  420

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGP--HEDNNVI-ERQLQLEALKQRLKEEE  280
            RKEL ++ R FEDW +K M +  P D+ + D P  H  N+V+ E+Q  +E +K+RL+EEE
Sbjct  421  RKELARKKRHFEDWCNKNMHKTIP-DEIDPDRPEGHTRNDVVAEKQFAVEIVKKRLEEEE  479

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EAY R C+QVR KS+ S+++ LPELF A+S+F+ +CS MY++L
Sbjct  480  EAYERLCLQVREKSIASIKSRLPELFRALSDFASSCSEMYRSL  522



>ref|XP_008393906.1| PREDICTED: uncharacterized protein LOC103456054 [Malus domestica]
Length=711

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 167/224 (75%), Gaps = 0/224 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH++RT QL  V+QEWHS FEK++ HQK+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  484  PMETTKHHHDRTVQLWNVLQEWHSHFEKLVTHQKQYIQALNSWLKLNLIPIESSLKEKIS  543

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI ALLH+W D + KLPDELAK+AI SF+AV+ TI+ +Q +EMKLK++ ++T
Sbjct  544  SPPRVQRPPIQALLHSWHDSLEKLPDELAKSAISSFAAVIKTIILNQEEEMKLKEKFEET  603

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++++ FEDWY KY QR    D    +     + V E++  +E+LK+R++EE E +
Sbjct  604  RKEFLRKSQAFEDWYQKYAQRHAEMDQERGEDAIPKDPVSEKKFIVESLKKRMEEEYEXH  663

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             R C+QVR KSL SL+T LPE+F +M++++ ACS  Y  L S T
Sbjct  664  QRHCIQVREKSLGSLKTRLPEIFRSMTDYANACSEAYGKLRSTT  707



>ref|XP_009345256.1| PREDICTED: uncharacterized protein LOC103937065 [Pyrus x bretschneideri]
Length=713

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 166/223 (74%), Gaps = 0/223 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH+ RT QL  V+QEWHS F  ++ HQK+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  486  PMETTKHHHARTVQLWNVLQEWHSHFVNLVTHQKQYIQALNSWLKLNLIPIESSLKEKIS  545

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q+PPI ALLH+W D + KLPDELAK+AI S SAV+ TI+ HQ +EMKLK++ ++T
Sbjct  546  SPPRVQHPPIQALLHSWHDFLEKLPDELAKSAISSCSAVIKTIILHQEEEMKLKEKFEET  605

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            RKE  ++ + F+DWY KY QR    D+   +     + V E++  +++LK+RL+EE EA+
Sbjct  606  RKEYLRKNQAFDDWYQKYSQRHAQMDEERGEDAVPKDPVSEKKFIVDSLKKRLEEECEAH  665

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             R C+QVR KSL SL+T LPE+F AM++++RACS  Y  L SI
Sbjct  666  QRHCIQVREKSLGSLKTRLPEIFRAMTDYARACSEAYGKLRSI  708



>ref|XP_011089542.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105170443 
[Sesamum indicum]
Length=717

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 170/230 (74%), Gaps = 6/230 (3%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS+HH+ERT QL  VV++WH QFEK++ +Q+ YI  LN+WLKLNL+PI+++LKEKVSSP
Sbjct  484  ETSKHHHERTKQLSNVVEQWHLQFEKLVTNQRHYINSLNNWLKLNLIPIESSLKEKVSSP  543

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R  NPPI  LL +W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLKD+ ++TRK
Sbjct  544  PRTLNPPIQPLLRSWHDHLEKLPDEVAKSAIASFAAVIKTIIIHQEEEMKLKDKYEETRK  603

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEA  274
            E  ++ + FE+WY KYMQRR P D+T+ D   E N    V ERQ  +E+LK+RL++E E 
Sbjct  604  EYFRKKQAFEEWYQKYMQRRPPMDETDPDKAVETNAKDPVSERQFLVESLKKRLEDEMED  663

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT---HP  133
            + + C+QVR KSL SL+  LPELF A+S+++ AC   Y+ L  IT   HP
Sbjct  664  HQKHCVQVREKSLGSLKIRLPELFRALSDYAHACFDAYERLRLITQSQHP  713



>ref|XP_004150357.1| PREDICTED: uncharacterized protein LOC101204163 [Cucumis sativus]
Length=707

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 172/227 (76%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HHYERT QL  VV+EWHSQFEK++  QKEYI+ LN WLKLNL+PI+++LKEKVS
Sbjct  478  PKETSTHHYERTVQLCGVVREWHSQFEKLVRCQKEYIKSLNSWLKLNLIPIESSLKEKVS  537

Query  630  --SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCK  457
              SP R QNPPI  LL AW D + +LPDE  +TAI++F AV+NTI+  Q +E KLK + +
Sbjct  538  LSSPPRVQNPPIQKLLLAWHDQLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWE  597

Query  456  DTRKELEKRTRKFEDWYHKYMQRRTPND-DTEQ-DGPHEDNNVIERQLQLEALKQRLKEE  283
            +T KELE++ R F++W++KY QRR P+D D E+ +   +D  V E+ + +E+LK+RL+EE
Sbjct  598  ETEKELERKQRHFDEWHYKYQQRRMPDDVDPERSEAGMQDAAVTEKLIAVESLKKRLEEE  657

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E + +QC+ VR KSL SL+  LPELF A+SEFS A S MY++L SI
Sbjct  658  KETHGKQCLHVREKSLVSLKNQLPELFRALSEFSFASSEMYKSLSSI  704



>gb|KGN58062.1| hypothetical protein Csa_3G481220 [Cucumis sativus]
Length=736

 Score =   250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 172/227 (76%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HHYERT QL  VV+EWHSQFEK++  QKEYI+ LN WLKLNL+PI+++LKEKVS
Sbjct  507  PKETSTHHYERTVQLCGVVREWHSQFEKLVRCQKEYIKSLNSWLKLNLIPIESSLKEKVS  566

Query  630  --SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCK  457
              SP R QNPPI  LL AW D + +LPDE  +TAI++F AV+NTI+  Q +E KLK + +
Sbjct  567  LSSPPRVQNPPIQKLLLAWHDQLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWE  626

Query  456  DTRKELEKRTRKFEDWYHKYMQRRTPND-DTEQ-DGPHEDNNVIERQLQLEALKQRLKEE  283
            +T KELE++ R F++W++KY QRR P+D D E+ +   +D  V E+ + +E+LK+RL+EE
Sbjct  627  ETEKELERKQRHFDEWHYKYQQRRMPDDVDPERSEAGMQDAAVTEKLIAVESLKKRLEEE  686

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E + +QC+ VR KSL SL+  LPELF A+SEFS A S MY++L SI
Sbjct  687  KETHGKQCLHVREKSLVSLKNQLPELFRALSEFSFASSEMYKSLSSI  733



>ref|XP_004169923.1| PREDICTED: uncharacterized LOC101204163 [Cucumis sativus]
Length=715

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 172/227 (76%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HHYERT QL  VV+EWHSQFEK++  QKEYI+ LN WLKLNL+PI+++LKEKVS
Sbjct  486  PKETSTHHYERTVQLCGVVREWHSQFEKLVRCQKEYIKSLNSWLKLNLIPIESSLKEKVS  545

Query  630  --SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCK  457
              SP R QNPPI  LL AW D + +LPDE  +TAI++F AV+NTI+  Q +E KLK + +
Sbjct  546  LSSPPRVQNPPIQKLLLAWHDQLERLPDEHLRTAIFTFGAVINTIMLQQDEERKLKLKWE  605

Query  456  DTRKELEKRTRKFEDWYHKYMQRRTPND-DTEQ-DGPHEDNNVIERQLQLEALKQRLKEE  283
            +T KELE++ R F++W++KY QRR P+D D E+ +   +D  V E+ + +E+LK+RL+EE
Sbjct  606  ETEKELERKQRHFDEWHYKYQQRRMPDDVDPERSEAGMQDAAVTEKLIAVESLKKRLEEE  665

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E + +QC+ VR KSL SL+  LPELF A+SEFS A S MY++L SI
Sbjct  666  KETHGKQCLHVREKSLVSLKNQLPELFRALSEFSFASSEMYKSLSSI  712



>ref|XP_010691307.1| PREDICTED: uncharacterized protein LOC104904665 [Beta vulgaris 
subsp. vulgaris]
Length=777

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 174/228 (76%), Gaps = 4/228 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  +V+EW++ FEKM+ HQKEYIR LN WLKLNL+PI+++LKEKVSS
Sbjct  535  KETTDHHHERTIQLWAIVREWNTHFEKMVNHQKEYIRALNSWLKLNLIPIESSLKEKVSS  594

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI  LL AW D + KLPDE AK AIY+F+AV++T+VQ Q DE++ + + +++R
Sbjct  595  PPRAQNPPIQNLLFAWHDHLEKLPDEHAKGAIYNFAAVLDTLVQQQDDEIRQRAKVEESR  654

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTE----QDGPHEDNNVIERQLQLEALKQRLKEEE  280
            ++LEK+ R++  W ++YMQ+R P+DD +    +DG ++D  +++++  +E  K++L+++ 
Sbjct  655  RDLEKKQRQYNKWLNEYMQKRVPSDDMDPSSIEDGVNKDEIMVDKEFVVENAKKKLEDDT  714

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            E Y R C  VR KSLTSL+T LPELF ++SEF+ + S MY  L+++ H
Sbjct  715  EEYERLCTHVREKSLTSLKTRLPELFLSLSEFALSASEMYSNLKALCH  762



>ref|XP_004141776.1| PREDICTED: uncharacterized protein LOC101222402 [Cucumis sativus]
 ref|XP_004169318.1| PREDICTED: uncharacterized protein LOC101224589 [Cucumis sativus]
 gb|KGN45358.1| hypothetical protein Csa_7G446740 [Cucumis sativus]
Length=700

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HH+ERT QL  VVQEWHSQ EK++  QK+YI+ L++WL+LNL+P +++LKEKVS
Sbjct  461  PKETSDHHHERTVQLWAVVQEWHSQLEKLVNRQKDYIKALSNWLRLNLIPTESSLKEKVS  520

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PPI  LLHAWQD + KLPDE+ + AI++F+ V++TI+Q Q +EMKLK +C++T
Sbjct  521  SPPRVRSPPIQILLHAWQDHLEKLPDEVLRNAIFTFATVIHTIMQSQEEEMKLKLKCQET  580

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN-DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
             KEL +++++F+DW  KY+QRR  N D+ + + P + + + ERQ  +EA++++L+EE E 
Sbjct  581  EKELARKSKQFKDWQKKYVQRRGSNADEVDMEEPADKDAIAERQAAVEAVEKKLEEEREE  640

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPL  130
            + + C+ VR KSL SL+  LPELF A+ EFS ACS MY+ L+SI+ P+
Sbjct  641  HQKLCLHVREKSLGSLKNQLPELFRALFEFSLACSRMYRHLKSISQPM  688



>gb|KDO79698.1| hypothetical protein CISIN_1g004600mg [Citrus sinensis]
Length=743

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT +L  VVQ+WH++FEK + HQK++I+ L  WLKLNL+PI+++LKE+V+S
Sbjct  508  KETTQHHHERTEELFTVVQKWHTEFEKFVNHQKQFIQALTSWLKLNLIPIESSLKERVTS  567

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NPPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  568  PPRAPNPPIQALLHSWHDYLEKLPDEIAKSAISSFAAVIKTIMLHQEEEMKLKEKCEETR  627

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            KEL ++T  +E+W+ KY +  +   + E+ D  +  + V++RQ+ +E+L++RL+EE EA+
Sbjct  628  KELLRKTHAYEEWHRKYKKTHSEESEAERGDDANTRDPVLDRQIVIESLRKRLEEETEAF  687

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             R C+QVR KSL SL+  LP+LF A+S+F+ A    Y+ L SIT   N
Sbjct  688  RRHCLQVREKSLGSLKLRLPDLFRAVSDFAHASFDAYEKLRSITQSQN  735



>ref|XP_006450611.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
 gb|ESR63851.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
Length=745

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT +L  VVQ+WH++FEK + HQK++I+ L  WLKLNL+PI+++LKE+V+S
Sbjct  510  KETTQHHHERTEELFTVVQKWHTEFEKFVNHQKQFIQALTSWLKLNLIPIESSLKERVTS  569

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NPPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  570  PPRAPNPPIQALLHSWHDYLEKLPDEIAKSAISSFAAVIKTIMLHQEEEMKLKEKCEETR  629

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            KEL ++T  +E+W+ KY +  +   + E+ D  +  + V++RQ+ +E+L++RL+EE EA+
Sbjct  630  KELLRKTHAYEEWHRKYKKTHSEESEAERGDDANTRDPVLDRQIVIESLRKRLEEETEAF  689

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             R C+QVR KSL SL+  LP+LF A+S+F+ A    Y+ L SIT   N
Sbjct  690  RRHCLQVREKSLGSLKLRLPDLFRAVSDFAHASFDAYEKLRSITQSQN  737



>ref|XP_006476157.1| PREDICTED: myosin-9-like [Citrus sinensis]
Length=745

 Score =   248 bits (634),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/228 (51%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT +L  VVQ+WH++FEK + HQK++I+ L  WLKLNL+PI+++LKE+V+S
Sbjct  510  KETTQHHHERTEELFTVVQKWHTEFEKFVNHQKQFIQALTSWLKLNLIPIESSLKERVTS  569

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NPPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  570  PPRAPNPPIQALLHSWHDYLEKLPDEIAKSAISSFAAVIKTIMLHQEEEMKLKEKCEETR  629

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            KEL ++T  +E+W+ KY +  +   + E+ D  +  + V++RQ+ +E+L++RL+EE EA+
Sbjct  630  KELLRKTHAYEEWHRKYKKTHSEESEAERGDDANTRDPVLDRQIVIESLRKRLEEETEAF  689

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             R C+QVR KSL SL+  LP+LF A+S+F+ A    Y+ L SIT   N
Sbjct  690  RRHCLQVREKSLGSLKLRLPDLFRAVSDFAHASFDAYEKLRSITQSQN  737



>ref|XP_008462152.1| PREDICTED: uncharacterized protein LOC103500575 [Cucumis melo]
Length=705

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 177/228 (78%), Gaps = 1/228 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HH+ERT QL  VVQEWHSQ EK++  QK+YI+ L++WL+LNL+P +++LKEKVS
Sbjct  461  PKETSDHHHERTVQLWAVVQEWHSQLEKLVNRQKDYIKALSNWLRLNLIPTESSLKEKVS  520

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R ++PPI +LLHAWQD + KLPDE+ +  I++F+ V++TI+Q Q +EMKLK +C++T
Sbjct  521  SPPRVRSPPIQSLLHAWQDHLEKLPDEVLRNTIFTFATVIHTIMQSQEEEMKLKLKCQET  580

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN-DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
             KEL +++++F+DW  KY+QRR  N D+ + + P + + + ERQ  +EA+++RL+EE E 
Sbjct  581  EKELARKSKQFKDWQKKYVQRRGSNADEVDMEEPGDKDAIAERQAAVEAVEKRLEEEREE  640

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPL  130
            + + C+ VR KSL SL+  LPELF A+ EFS ACS MY+ L+SI+ P+
Sbjct  641  HQKLCLHVREKSLGSLKNQLPELFRALFEFSLACSRMYRHLKSISQPI  688



>ref|XP_008775372.1| PREDICTED: uncharacterized protein LOC103695745 [Phoenix dactylifera]
Length=557

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 173/231 (75%), Gaps = 3/231 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSE H+E T QL  VV+EWHSQ EK++ +QK+YI+ LN WLKLNL+PI+++LKEKVS
Sbjct  325  PKETSEEHHECTAQLWRVVREWHSQIEKLMKNQKDYIKSLNSWLKLNLIPIESSLKEKVS  384

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP  PPI ALLH+W D + KL DELA++AIYSFS VV TIV HQ DE+K+K++C+D 
Sbjct  385  SPPRPSRPPIQALLHSWNDQLEKLSDELARSAIYSFSEVVRTIVVHQEDELKMKEKCEDL  444

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN-DDTEQDGPHEDNN--VIERQLQLEALKQRLKEEE  280
            RKE  ++ R FEDWY KY +++  + +D   +G    N     ER+L++EAL+ +LK+EE
Sbjct  445  RKEFMRKKRAFEDWYRKYSEKKAASGEDANPEGGEGSNQDRGTERKLEVEALEIKLKDEE  504

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EAY R C QVR KSL +LRT LPELF  +S+F+ ACS MY+ L S++  L+
Sbjct  505  EAYARLCKQVREKSLGTLRTHLPELFRNVSDFALACSEMYKKLRSVSQSLD  555



>gb|EPS57690.1| hypothetical protein M569_17127, partial [Genlisea aurea]
Length=245

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 162/226 (72%), Gaps = 14/226 (6%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKE-KV  634
            PKET++HH+ERT QLG VVQEW++   +    QKEYI+ LN+WLKLNL+PIDTNLK+   
Sbjct  32   PKETTDHHHERTRQLGGVVQEWYTNLTEFTTQQKEYIKALNNWLKLNLIPIDTNLKDPSA  91

Query  633  SSPQRPQ-NPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCK  457
            SSP RP+ NPPI  LLHAW + + KLPDE A++AI +F+A V TI +HQ +E++ ++RC 
Sbjct  92   SSPARPESNPPIQLLLHAWNEYLQKLPDEAARSAINNFAAAVKTIWEHQKEELEFRNRCA  151

Query  456  DTRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            ++ K+L+++TR FE+WY K+        + E+D       V E+Q+ +E  K+RL+E+EE
Sbjct  152  ESSKDLKRKTRDFENWYRKHFT------EVEKDV------VSEKQIAVEIAKKRLEEDEE  199

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            AY RQC+QVR KS+ SL+T LPELF A+S F+ A + MY  L ++ 
Sbjct  200  AYRRQCVQVRDKSVMSLKTHLPELFRALSAFAGAGADMYSHLRNVA  245



>ref|XP_008776462.1| PREDICTED: uncharacterized protein LOC103696569 [Phoenix dactylifera]
Length=375

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 168/232 (72%), Gaps = 4/232 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETSEHH   T QL  +V+EWH QF+K++ HQK+YI+ L+ WLKLN++PI+++LKEKVS
Sbjct  140  PMETSEHHNRHTIQLFDIVKEWHLQFDKLVSHQKDYIQALSSWLKLNIIPIESSLKEKVS  199

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP+ PPI ALLHAW D + KLPDELAK+AI SFSAV+NTIV  Q +E+K +++C +T
Sbjct  200  SPPRPRQPPIQALLHAWHDHLDKLPDELAKSAILSFSAVINTIVTLQQEELKQREKCDET  259

Query  450  RKELEKRTRKFEDWYHKYMQRRTP-NDDTEQDGPHEDNN---VIERQLQLEALKQRLKEE  283
            RKE  K+ R FEDWY KY  RR   +++  Q+G    N    V ER++ +E+ K RL EE
Sbjct  260  RKEYLKKIRAFEDWYSKYSHRRAALSEEAGQEGSEGANQNDPVAERKVAVESAKSRLDEE  319

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EE + + C QVR KS  +L+T LPEL  AMS+FS ACS MY+ L+SI+   N
Sbjct  320  EENHEKLCKQVREKSFGTLKTHLPELIRAMSDFSHACSEMYKKLKSISQSQN  371



>ref|XP_010519919.1| PREDICTED: uncharacterized protein LOC104799211 [Tarenaya hassleriana]
Length=762

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 174/227 (77%), Gaps = 4/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT Q G +V+EWH QFE++++HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  523  KETTKHHHERTRQFGNIVEEWHVQFERLVMHQKQYINALNSWLKLNLIPIESSLKEKVSS  582

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK+RC++TR
Sbjct  583  PPRPQRPPIQALLHTWHDWLEKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKERCEETR  642

Query  447  KELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDN---NVIERQLQLEALKQRLKEEE  280
            KE  K+ + FE+WY K++Q+R P++ +  +DG    N    V ER+  +E L++RL++E 
Sbjct  643  KEFLKKNQAFEEWYQKHLQKRGPDEAEGGEDGASVTNPKDPVSERRFAVETLRKRLEDEV  702

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EAY R C+QVR KSL SL+  LPELF A+S+++ AC+  Y+ L  IT
Sbjct  703  EAYQRHCVQVREKSLNSLKIRLPELFRALSDYAHACADAYEKLRIIT  749



>ref|XP_008342705.1| PREDICTED: uncharacterized protein LOC103405477 [Malus domestica]
Length=736

 Score =   243 bits (621),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 170/225 (76%), Gaps = 4/225 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PK TSEHH+ERT QL  VVQ W S+F K++  QKEYI+ LN WLKLNL+PI++ LKEKVS
Sbjct  500  PKHTSEHHHERTIQLFGVVQGWQSEFVKLVSQQKEYIKALNSWLKLNLIPIESXLKEKVS  559

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R Q PPI  LL AW D + KLPD++A+TAIY+F+A +NTI+ HQ +E+K+K++C+DT
Sbjct  560  SPPRIQRPPIQGLLLAWHDHLEKLPDDVARTAIYNFAAAINTIMIHQEEEIKMKEKCEDT  619

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGP--HEDNNVI-ERQLQLEALKQRLKEEE  280
            RKEL ++ R+F++WY K   +  P D+ + DGP  H  ++V+ E+Q  +E +K+RL+EEE
Sbjct  620  RKELSRKMRQFQEWYDKNKHKTIP-DEGDTDGPEGHTRSDVLAEKQFAVEIVKKRLEEEE  678

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLES  145
            E Y R  +QVR KS+ SL+T LPELF A+S+F+ +CS MY+ L S
Sbjct  679  ETYERLGLQVREKSVVSLKTRLPELFRALSDFAYSCSEMYRGLRS  723



>emb|CDX87081.1| BnaC09g03960D [Brassica napus]
Length=534

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/226 (53%), Positives = 175/226 (77%), Gaps = 3/226 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+++T Q   V++EWH QFE+++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  300  KETTKQHHQQTRQFCTVLEEWHVQFERLVTHQKQYINSLNTWLKLNLIPIESSLKEKVSS  359

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  360  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVMKTILLHQEEEMKLKEKCEETR  419

Query  447  KELEKRTRKFEDWYHKYMQRRTPND---DTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FE+WY K++Q+R P +   D E+    +D++V ER++ +E LK+RL++EEE
Sbjct  420  REFIRKKQGFEEWYQKHLQKRGPTEEGVDGEEGSGRDDDHVTERRIVVETLKKRLEDEEE  479

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            AY R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  480  AYQRHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRVIS  525



>ref|XP_008799874.1| PREDICTED: uncharacterized protein LOC103714416 [Phoenix dactylifera]
Length=559

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 170/233 (73%), Gaps = 5/233 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHHY+RT QL  +V+EWHSQF+K++ HQK+YIR LN+WLKLN++PI+++LKE+VS
Sbjct  323  PKETSEHHYKRTLQLFEIVKEWHSQFDKLVSHQKDYIRALNNWLKLNIIPIESSLKERVS  382

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP+ PPI ALL AW D + K+PDELAK+AI SFSAV+NTIV  Q +E+K K++C +T
Sbjct  383  SPPRPRQPPIQALLLAWHDHLEKIPDELAKSAILSFSAVINTIVILQQEELKQKEKCDET  442

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTE-----QDGPHEDNNVIERQLQLEALKQRLKE  286
            RKE  K+ R FEDWY KY QRR      E      +   + + V ER+  +E++K RL E
Sbjct  443  RKEYLKKARAFEDWYSKYSQRRATALSEEAVQEDSEAASQKDPVAERKFAVESVKSRLDE  502

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EE+ + + C QVR KS  SL+T LPELF AMS+F+ A S MY  L+SI+   N
Sbjct  503  EEDNHRKLCKQVREKSFGSLKTHLPELFRAMSDFAYASSDMYMKLKSISQGQN  555



>ref|XP_010907260.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK14 [Elaeis guineensis]
Length=740

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 170/231 (74%), Gaps = 3/231 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSE H+ERT QL  +V++WH QFEK+   QKEYI+ LN WL+LNL+PI+++LKEKVS
Sbjct  508  PKETSEQHHERTVQLWQIVRQWHLQFEKLTKSQKEYIKALNSWLRLNLIPIESSLKEKVS  567

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP +P  PPI ALLH+W D + KLPDELA+ AIYSFS VV TIV HQ DE+K K++C+D 
Sbjct  568  SPPQPSQPPIQALLHSWNDQLEKLPDELARNAIYSFSEVVRTIVVHQQDELKTKEKCEDL  627

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN-DDTEQDGPHEDN--NVIERQLQLEALKQRLKEEE  280
            RK+  ++ R F+DW +KY++RR  + ++   +G    N   + ER+L +E L+ RLK EE
Sbjct  628  RKKFIRKKRAFDDWSYKYLERRAASGEEANPEGGRASNQDTLAERKLAIETLESRLKNEE  687

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EAY + C QVR KSL SL+T LPELF A+S+F+ ACS MY+ L S+T   N
Sbjct  688  EAYGKLCQQVREKSLGSLQTHLPELFRAVSDFALACSEMYKKLRSVTQSQN  738



>ref|XP_010931963.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
 ref|XP_010931964.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
Length=740

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 171/231 (74%), Gaps = 3/231 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSE H+E T QL  VV+EWHSQFEK++ +QKEYI+ LN WLKLNL+PI+++LKEKVS
Sbjct  508  PKETSEQHHECTVQLWRVVREWHSQFEKLMKNQKEYIKSLNSWLKLNLIPIESSLKEKVS  567

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP  PPI  LLH+W D + KLPDELA++AIYSFS V+ TIV HQ +E+K+K++C+D 
Sbjct  568  SPPRPSRPPIQPLLHSWNDQLEKLPDELARSAIYSFSEVIRTIVVHQQEELKMKEKCEDM  627

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEE  280
            RKE  ++ R F+DWY KY++++  + +       E +N   V ER+L+++ L  RLK E+
Sbjct  628  RKEFMRKKRAFDDWYQKYLEKKAASGEEANPEGGEGSNQDRVAERKLEVDGLDARLKAED  687

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            E + + C QVR KSL SLRT LPELF +MS+F+  CS MY+ L S+T  LN
Sbjct  688  ENHGKLCKQVRDKSLGSLRTHLPELFRSMSDFALECSEMYKRLISVTRSLN  738



>emb|CAN72109.1| hypothetical protein VITISV_044047 [Vitis vinifera]
Length=728

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSEHH++RT QL  VVQEWHSQF+K++ +QK YI  L  WL+LNL+PI++NLKEKVS
Sbjct  489  PKETSEHHHKRTIQLWXVVQEWHSQFDKLVTNQKNYITALKKWLRLNLIPIESNLKEKVS  548

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI ALL AW D + KLPDELAKT+I +F+A++ TI+QHQ DEM+LK +C++T
Sbjct  549  SPPRXQNPPIQALLQAWNDHLEKLPDELAKTSISNFAAIIETIMQHQQDEMRLKAKCEET  608

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEE  280
             KELE++TR+F DW+ KYMQ+R P+++  +   D PH D  VIER+L +E L  RLK+EE
Sbjct  609  AKELERKTRQFNDWHSKYMQKRIPDENDREHPGDDPH-DEVVIERKLVVETLSNRLKDEE  667

Query  279  EAYMRQCM  256
            E Y ++C+
Sbjct  668  ETYQKECV  675



>ref|XP_002516075.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46495.1| conserved hypothetical protein [Ricinus communis]
Length=714

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 172/225 (76%), Gaps = 2/225 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETSE+HY+RT QL  VV++WH+QF ++I +QK+YI+ LN+W+KLNL+PI++NLKEKVSS
Sbjct  485  KETSEYHYDRTCQLCGVVRDWHAQFCRLIDYQKDYIKALNNWIKLNLIPIESNLKEKVSS  544

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R QNPPI  LL AW D + +LPDE+A++AI +F+AVV TIV HQ +E+K++++C+ TR
Sbjct  545  PPRIQNPPIHVLLIAWHDHLDRLPDEIARSAISNFAAVVQTIVHHQEEEVKMREKCEATR  604

Query  447  KELEKRTRKFEDWYHKYMQRRTPND-DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            KEL +R R+ +DW +K+  R    D + E++ PH  N ++ERQ  ++ LK++L+EEEEA 
Sbjct  605  KELSRRIRQLDDWKNKHNVRDDELDPEAEEENPHR-NAMMERQGVVDLLKKQLEEEEEAC  663

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
             +  +QVR KSL SL+T LPELF AMS+ + AC+ MY  L SI H
Sbjct  664  QKLSLQVREKSLASLKTRLPELFRAMSDIALACADMYSNLRSIAH  708



>ref|XP_008447502.1| PREDICTED: uncharacterized protein LOC103489935 [Cucumis melo]
Length=722

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 168/225 (75%), Gaps = 2/225 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS HH+ERT QL  VV+EWHSQFEK+   QK+YI+ LN WLKLNL+PI+++LKEKVS
Sbjct  495  PKETSVHHHERTVQLCNVVREWHSQFEKLAYRQKDYIKALNSWLKLNLIPIESSLKEKVS  554

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI  LL AW D + KLPDE  +TAI SFSAV++TI+  Q +EMKLK RC +T
Sbjct  555  SPPRAQNPPIQRLLIAWHDQLEKLPDEHLRTAISSFSAVISTIMLQQEEEMKLKLRCDET  614

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
             KEL ++ R+F+DW++KY QRR P+  D  + +   +D  V ER + +E+LK++L+EE+E
Sbjct  615  EKELVRKQRQFDDWHYKYQQRRMPDELDPEKSEENSQDAAVTERFVVVESLKKKLEEEKE  674

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             + +QC+ VR KSL SL+  LPELF A+SEFS A S MY+ L  I
Sbjct  675  THAKQCLHVREKSLVSLKNQLPELFRALSEFSSAGSEMYKNLRLI  719



>gb|KDP37214.1| hypothetical protein JCGZ_06270 [Jatropha curcas]
Length=729

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 165/226 (73%), Gaps = 3/226 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETSE+HY+RT+QL  VV++W +QF K++ HQK YI+ LN WLKLNL+PI++NLKEK+S
Sbjct  496  PKETSEYHYDRTFQLCGVVRDWQNQFCKLVDHQKGYIKALNSWLKLNLIPIESNLKEKIS  555

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R QNPPI ALL AW D + KLPDE+A++AI +F+AV+ TIV HQ +E+K++++C+ T
Sbjct  556  SPPRVQNPPIHALLIAWNDDLEKLPDEIARSAIVNFAAVIQTIVHHQEEELKIREKCEAT  615

Query  450  RKELEKRTRKFEDWYHKYM--QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            R+EL ++T++F +W  K+M       + D  ++ PH +  + +RQ  ++AL ++L+EEEE
Sbjct  616  RRELARKTKQFNEWKQKHMVETHDETDPDRAEENPHRE-ALTDRQFVIDALTKQLEEEEE  674

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
               R   QVR KSL SL+  LPELF AMS+ + A S MY  L SI 
Sbjct  675  GCRRLSQQVREKSLASLKHRLPELFTAMSDIALAFSAMYSNLRSIA  720



>ref|XP_008808244.1| PREDICTED: uncharacterized protein LOC103720359 [Phoenix dactylifera]
Length=735

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 171/232 (74%), Gaps = 4/232 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETSEHH   T QL  +V+EWH QF+K++ HQK+YI+ L+ WLKLN++PI+++LKEKVS
Sbjct  500  PMETSEHHNRHTIQLFDIVKEWHLQFDKLVSHQKDYIQALSSWLKLNIIPIESSLKEKVS  559

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RP+ PPI ALLHAW D + KLPDELAK+AI SFSAV+NTIV  Q +E+K +++C +T
Sbjct  560  SPPRPRQPPIQALLHAWHDHLDKLPDELAKSAILSFSAVINTIVTLQQEELKQREKCDET  619

Query  450  RKELEKRTRKFEDWYHKYMQRRTP-NDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEE  283
            RKE  K+ R FEDWY KY  RR   +++  Q   +G ++++ V ER++ +E+ K RL EE
Sbjct  620  RKEYLKKIRAFEDWYSKYSHRRAALSEEAGQEGSEGANQNDPVAERKVAVESAKSRLDEE  679

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EE + + C QVR KS  +L+T LPEL  AMS+FS ACS MY+ L+SI+   N
Sbjct  680  EENHEKLCKQVREKSFGTLKTHLPELIRAMSDFSHACSEMYKKLKSISQSQN  731



>gb|EMT28812.1| hypothetical protein F775_16807 [Aegilops tauschii]
Length=445

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 155/226 (69%), Gaps = 4/226 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETSE H ERT QL  VVQEWH Q+ K +  QKEY+  L  W+KLN++PIDTNLK   S 
Sbjct  215  RETSEQHNERTVQLWQVVQEWHVQYSKFMASQKEYVGNLYSWIKLNVIPIDTNLKANSSQ  274

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P     PPI  LLHAW D++GKLPDE A+ AI++FS VV+ I+ HQ +E+KL+ R +DTR
Sbjct  275  PVET-TPPIKRLLHAWHDMLGKLPDEDARKAIHTFSEVVHIILVHQDEEIKLRQRIQDTR  333

Query  447  KELEKRTRKFEDWYHKYMQRRT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            KE E+++R+FEDW  KYM++R   P +    DG   D  + ER+  +E L+  LKE EEA
Sbjct  334  KEHERKSRQFEDWARKYMEKRAGIPPEAGNPDGTRAD-PLAERKAAMEKLENSLKELEEA  392

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            Y +QC  VR KSL+ LRT LPELF  +SEFS   + M++ L SI++
Sbjct  393  YTKQCKVVREKSLSLLRTNLPELFRIVSEFSLQSAAMFKDLWSISN  438



>gb|KFK27812.1| hypothetical protein AALP_AA8G433100 [Arabis alpina]
Length=755

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 174/227 (77%), Gaps = 4/227 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++L+EKVSS
Sbjct  520  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINSLNSWLKLNLIPIESSLREKVSS  579

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  580  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKEKCEETR  639

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTE--QDGPHED--NNVIERQLQLEALKQRLKEEE  280
            +E  ++ + FEDWY K++ ++ P ++ E  +DG      ++V ER++ +EALK+RL++EE
Sbjct  640  REFIRKKQGFEDWYQKHLHKKGPTEEAEGGEDGTTNTSRDHVSERRIVVEALKKRLEDEE  699

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            EA+ R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  700  EAHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRMIS  746



>gb|EMS56206.1| hypothetical protein TRIUR3_11325 [Triticum urartu]
Length=472

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 154/226 (68%), Gaps = 4/226 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETSE H ERT QL  VVQEWH+Q+ K +  QKEY+  L  W+KLN++PIDTNLK   S 
Sbjct  242  RETSEQHNERTVQLWQVVQEWHAQYSKFMASQKEYVGNLYSWIKLNVIPIDTNLKSNSSQ  301

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P     PPI  LLHAW D + KLPDE A+ AI++FS VV+ I+ HQ +E+KL+ R +DTR
Sbjct  302  PVET-TPPIKRLLHAWHDNLAKLPDEDARKAIHTFSEVVHIILVHQDEEIKLRQRIQDTR  360

Query  447  KELEKRTRKFEDWYHKYMQRRT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            KE E+++R+FEDW  KYM++R   P +    DG   D  + ER+  +E L+  LKE EEA
Sbjct  361  KEHERKSRQFEDWAQKYMEKRAGIPPEAGNPDGTRAD-PLAERKAAMEKLENSLKELEEA  419

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            Y +QC  VR KSL+ LRT LPELF  +SEFS   + M++ L SI++
Sbjct  420  YTKQCKVVREKSLSLLRTNLPELFRIVSEFSLQSAAMFKGLWSISN  465



>gb|EYU29268.1| hypothetical protein MIMGU_mgv1a002196mg [Erythranthe guttata]
Length=702

 Score =   226 bits (575),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 159/221 (72%), Gaps = 0/221 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ET++HH+ERT QL  VV +WHSQFEK++ +QK+YI  LN WLKLNL+PI+++LKEKVSSP
Sbjct  475  ETTKHHHERTNQLSAVVDQWHSQFEKLVNNQKQYINSLNSWLKLNLIPIESSLKEKVSSP  534

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
                 PPI  LL +W DL+ KLPDE+AKTAI SF+AV+ TI  HQ +EMK+K++ ++TR+
Sbjct  535  PHTPTPPIHPLLRSWHDLLEKLPDEVAKTAISSFAAVIKTIGIHQEEEMKMKEKYEETRR  594

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMR  265
            E  ++ + FE+WY KYMQRR   +D         + V ERQ  +++LK+RL EE E + +
Sbjct  595  EYYRKKQSFEEWYQKYMQRRAGQNDENDPDKGVKDPVSERQFVVDSLKKRLDEEMEEHQK  654

Query  264  QCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             C+QVR KSL SL+  LPELF A+S+++ +C   YQ L  I
Sbjct  655  MCVQVREKSLGSLKIRLPELFRALSDYAHSCFDAYQRLRLI  695



>ref|XP_006394813.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
 gb|ESQ32099.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
Length=770

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 173/225 (77%), Gaps = 3/225 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+++T Q   V++EWH+QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  538  KETTKQHHQQTRQFCTVLEEWHAQFDRLVTHQKQYINSLNSWLKLNLIPIESSLKEKVSS  597

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  598  PPRPQRPPIQALLHSWHDCLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  657

Query  447  KELEKRTRKFEDWYHKYMQRRTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            +E  ++ + FE+WY K++Q+R P    +  +D    D +V ER++ +E LK+RL++EEEA
Sbjct  658  REFIRKKQGFEEWYQKHLQKRGPMEEGEGGEDASSRD-HVTERRIVVETLKKRLEDEEEA  716

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            + R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  717  HQRHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRIIS  761



>gb|EMT20964.1| hypothetical protein F775_31339 [Aegilops tauschii]
Length=268

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 165/236 (70%), Gaps = 8/236 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T +L  +V+EWH QF+K++ HQK YIR LN WLKLNL+ I++NLKEKVS
Sbjct  31   PRETTDLHYKQTCELRDIVREWHMQFDKLMDHQKGYIRALNAWLKLNLISIESNLKEKVS  90

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW DL+ +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++T
Sbjct  91   SPPRQVEPPIKNLLYAWHDLLERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEET  150

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKE  286
            R++L+++  +FEDW+ +Y +R+      E+  P   N     +V ER++ +E ++ RLKE
Sbjct  151  RRDLDRKRAQFEDWHRRYTERKA--SQGEEANPEAANTPSLDHVNERRITIEEVEIRLKE  208

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL-ESITHPLNRE  121
            EE+ ++R   QVR K+L +LR  LPELF  M++FS  C  MY +L +S   P+ R+
Sbjct  209  EEKLHLRLARQVREKTLANLRMHLPELFRNMADFSFFCHDMYSSLRKSAVLPMLRD  264



>ref|XP_009393120.1| PREDICTED: uncharacterized protein LOC103978894 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 161/233 (69%), Gaps = 3/233 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETSEHH++RT QL   V+EW SQ  K++ HQK+Y+  L+ WLKLNL+PID +LKEKVSS
Sbjct  436  KETSEHHHKRTLQLLDTVREWQSQLHKLVTHQKQYVGALDSWLKLNLIPIDGSLKEKVSS  495

Query  627  PQRPQNPPILALLHAWQDLIGK-LPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            PQRP + PI  L+HAW + + K LP+ELA TA+ SFSAV+NTI   Q +E+K K+RC + 
Sbjct  496  PQRPAHAPIQTLVHAWHEYLEKQLPEELANTALLSFSAVLNTIEAVQQEELKQKERCGEI  555

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            +K   ++ R FEDW  K+ Q+R    +T  +   +++ V ER+  +E+LK +L E  EA+
Sbjct  556  QKAYLRKKRAFEDWCQKHSQKRMGEPETGGEAASQNDPVGERRRVVESLKSKLDEGVEAH  615

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT--HPLNRES  118
               C QVR KS  +L+T LPELF A+S+F+  CS MY +L+ +T  +PL + +
Sbjct  616  KGICKQVREKSSVTLKTHLPELFRAVSDFAELCSKMYTSLKLVTDQNPLTKAT  668



>ref|XP_006658396.1| PREDICTED: uncharacterized protein LOC102701368, partial [Oryza 
brachyantha]
Length=437

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 154/227 (68%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
             +ETS+ H++RT QL  VVQ+WH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S
Sbjct  206  ARETSDQHHDRTVQLYNVVQDWHAQFDKFMTYQKQYVGSLYSWIKLNVIPIDTNLKPNSS  265

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
             P     PPI  LLHAW D++GKLPDE AK AIY+F+ +V TI+ HQ DE+KL+ + +DT
Sbjct  266  QPHET-TPPIKRLLHAWHDILGKLPDEAAKKAIYTFAEIVKTILVHQEDELKLRLKIEDT  324

Query  450  RKELEKRTRKFEDWYHKYMQRRTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            R+E  ++ R+F+DW  KYM +      +D   DG   D  ++ER+  +E ++  +KE EE
Sbjct  325  RREHGRKRRQFDDWAQKYMHKTAGILPEDGNPDGLRAD-PMVERKAAMERMELSMKELEE  383

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
             Y++QC  VR KSL  LRT LPELF  +S+FS   + M++ L SI H
Sbjct  384  TYVKQCRVVREKSLNLLRTSLPELFTVVSDFSLQSAGMFKGLWSIAH  430



>ref|NP_197941.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM13874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91720.1| unknown protein [Arabidopsis thaliana]
 gb|AED93470.1| uncharacterized protein AT5G25590 [Arabidopsis thaliana]
Length=775

 Score =   223 bits (567),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 171/226 (76%), Gaps = 3/226 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF+ ++ HQK+YI  LN+WLKLNL+PI+++LKEKVSS
Sbjct  537  KETTKQHHHQTRQFCTVLEEWHVQFDTLVTHQKQYINSLNNWLKLNLIPIESSLKEKVSS  596

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR
Sbjct  597  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKEKCEETR  656

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  657  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIAVETLKKRLEEEEE  716

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            A+ R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I+
Sbjct  717  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRIIS  762



>ref|XP_002874269.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50528.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++L+EKVSS
Sbjct  526  RETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINALNSWLKLNLIPIESSLREKVSS  585

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI+SF+ V+ TI+ HQ DEMKLK++C++TR
Sbjct  586  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAIFSFAEVIKTILLHQEDEMKLKEKCEETR  645

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  646  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDTTTSARDHVTERRIVVETLKKRLEEEEE  705

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I  +H  N  +T
Sbjct  706  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRIISQSHKSNGGAT  761



>dbj|BAJ96225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   221 bits (564),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 154/224 (69%), Gaps = 4/224 (2%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            +TSE H ERT QL  VV+EWH+Q+ K + HQKEY+  L  W+KLN++PIDTNLK   S P
Sbjct  502  DTSERHNERTMQLWQVVREWHAQYSKFMEHQKEYVGNLYSWIKLNVIPIDTNLKSNSSQP  561

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
                 PPI  LLHAW D++GKLPDE AK +I++FS V+ TI+ HQ +EMKL  R +DTRK
Sbjct  562  VE-TTPPIKRLLHAWHDILGKLPDEAAKNSIHTFSEVIRTILVHQGEEMKLWQRIQDTRK  620

Query  444  ELEKRTRKFEDWYHKYMQRRT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            E E+++R+FEDW  KYM++R   P +    DG   D  + +R+  +E L+  LK+ EE Y
Sbjct  621  EHERKSRQFEDWARKYMEKRAGIPPEAGNPDGTRAD-PLADRKASMERLELSLKDLEEEY  679

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             +QC  VR KSL+ LRT LPELF  +S+FS   + M+++L SI+
Sbjct  680  TKQCKVVREKSLSLLRTSLPELFRVVSDFSLQSAAMFKSLWSIS  723



>gb|EMS63249.1| hypothetical protein TRIUR3_24469 [Triticum urartu]
Length=268

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 157/225 (70%), Gaps = 7/225 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T +L  +V+EWH QF+K++ HQK YIR LN WLKLNL+ I++NLKEKVS
Sbjct  31   PRETTDLHYKQTCELRDIVREWHMQFDKLMEHQKGYIRALNAWLKLNLISIESNLKEKVS  90

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC +T
Sbjct  91   SPPRQVEPPIKNLLYAWHDQLERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCDET  150

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKE  286
            R++L+++  +FEDW+ +Y +R+      E+  P   N     +V ER++ +E ++ RLKE
Sbjct  151  RRDLDRKRAQFEDWHRRYTERKA--SQGEEPNPEAANTPSLDHVNERRIAIEEVEIRLKE  208

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EE+ ++R   QVR K+L +LR  LPELF  M++FS  C  MY +L
Sbjct  209  EEKLHLRLARQVREKTLANLRMHLPELFRNMADFSFFCHDMYSSL  253



>ref|XP_006655291.1| PREDICTED: uncharacterized protein LOC102706661 [Oryza brachyantha]
Length=553

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 153/219 (70%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS+HH+  T QL  +V++W + F  ++ +QKEY+  L  WLKLNL+PI+++LKEKV+SP
Sbjct  321  ETSDHHHSHTRQLRDIVEKWTANFSDLMSYQKEYVNALYSWLKLNLIPIESSLKEKVASP  380

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRK
Sbjct  381  PRAQQPPVKALLQAWNEHLTKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRK  440

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDWYHK+ QRR  + D E  +G  + + V E++  +E+LK +L +E EA+ 
Sbjct  441  EYTRKARAFEDWYHKHAQRRAFDVDPESGEGTTQKDTVAEKRFAVESLKNKLDDEVEAHN  500

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   MY  L
Sbjct  501  KLSKQVREKSLSILKAHLPELFRALTDFSHASFDMYSKL  539



>ref|XP_010421421.1| PREDICTED: DNA ligase 1-like isoform X2 [Camelina sativa]
Length=792

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  554  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSS  613

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  614  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  673

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  674  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEE  733

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  734  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  789



>ref|XP_006287097.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
 gb|EOA19995.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
Length=791

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 174/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  553  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINYLNSWLKLNLIPIESSLKEKVSS  612

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALL AW D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  613  PPRPQRPPIQALLFAWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  672

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  673  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEE  732

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ AC+  Y+ L  I  +H  N  +T
Sbjct  733  AHQRHCIQVREKSLNSLKIRLPEIFRALSDYAHACADSYEKLRIISQSHKANSGAT  788



>ref|XP_010421420.1| PREDICTED: DNA ligase 1-like isoform X1 [Camelina sativa]
Length=796

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  558  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSS  617

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  618  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  677

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  678  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEE  737

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  738  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  793



>ref|XP_010421422.1| PREDICTED: DNA ligase 1-like isoform X3 [Camelina sativa]
Length=790

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  552  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSS  611

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI ALLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  612  PPRPQRPPIQALLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  671

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  672  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEE  731

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  732  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  787



>emb|CDM83169.1| unnamed protein product [Triticum aestivum]
Length=437

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 164/236 (69%), Gaps = 8/236 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T +L  +V+EWH QF+K++ HQK YIR LN WLKLNL+ I++NLKEKVS
Sbjct  200  PRETTDLHYKQTCELRDIVREWHMQFDKLMDHQKGYIRALNAWLKLNLISIESNLKEKVS  259

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++T
Sbjct  260  SPPRQVEPPIKNLLYAWHDQLERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEET  319

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKE  286
            R++L+++  +FEDW+ +Y +R+      E+  P   N     +V ER++ +E ++ RLKE
Sbjct  320  RRDLDRKKAQFEDWHRRYTERKASQG--EEANPEAANTPSLDHVNERRIAIEEVEIRLKE  377

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL-ESITHPLNRE  121
            EE+ ++R   QVR K+L +LR  LPELF  M++FS  C  MY +L +S   P+ R+
Sbjct  378  EEKLHLRLVRQVREKTLANLRMHLPELFRNMADFSFFCHDMYSSLRKSAVLPMLRD  433



>ref|XP_010454904.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Camelina sativa]
 ref|XP_010454905.1| PREDICTED: ABC transporter F family member 4-like isoform X2 
[Camelina sativa]
Length=798

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  560  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSS  619

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI +LLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  620  PPRPQRPPIQSLLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  679

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  680  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEE  739

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  740  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  795



>ref|XP_010493822.1| PREDICTED: DNA ligase 1-like [Camelina sativa]
Length=800

 Score =   217 bits (552),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++ H+ +T Q   V++EWH QF++++ HQK+YI  LN WLKLNL+PI+++LKEKVSS
Sbjct  562  KETTKQHHHQTRQFCTVLEEWHVQFDRLVTHQKQYINCLNSWLKLNLIPIESSLKEKVSS  621

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P RPQ PPI +LLH+W D + KLPDE+AK+AI SF+AV+ TI+ HQ +E+KLK++C++TR
Sbjct  622  PPRPQRPPIQSLLHSWHDRLEKLPDEVAKSAISSFAAVIKTILLHQEEEIKLKEKCEETR  681

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDG---PHEDNNVIERQLQLEALKQRLKEEEE  277
            +E  ++ + FEDWY K++Q+R P ++ E          ++V ER++ +E LK+RL+EEEE
Sbjct  682  REFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIVVETLKKRLEEEEE  741

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI--THPLNREST  115
            A+ R C+QVR KSL SL+  LPE+F A+S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  742  AHQRHCVQVREKSLNSLKIRLPEIFRALSDYAHSCADSYEKLRIISQSHKSNGGAT  797



>ref|XP_010228227.1| PREDICTED: formin-like protein 5 [Brachypodium distachyon]
Length=741

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 155/224 (69%), Gaps = 4/224 (2%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETS+ H +RT QL  +VQEWH+Q++K + +QK+Y+  L  W+KLN++PIDTNLK   S 
Sbjct  511  RETSDQHNDRTVQLWHIVQEWHTQYDKFMTYQKQYVGSLYSWIKLNVIPIDTNLKPNSSQ  570

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P     PPI  LLHAW D++GKLPD+ AK AI++F+ VV+TI+ HQ DEMKL  + ++TR
Sbjct  571  PVE-TTPPIKRLLHAWHDILGKLPDDAAKKAIHTFAEVVHTILLHQDDEMKLSIKIQETR  629

Query  447  KELEKRTRKFEDWYHKYMQRRT--PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            K+ E++ R+FEDW  +YM++R   P++    DG   D  + ER++ +E L+  LK+ EE 
Sbjct  630  KDYERKKRQFEDWAQRYMEKRAGIPHEAGNPDGTRAD-PLAERKVAVERLELVLKDLEEQ  688

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            Y +QC  VR KSL+ LRT LPELF  +SEFS   + M + L SI
Sbjct  689  YKKQCRVVREKSLSLLRTNLPELFRVVSEFSLQSAAMLKGLWSI  732



>gb|EEE63626.1| hypothetical protein OsJ_18443 [Oryza sativa Japonica Group]
Length=663

 Score =   213 bits (542),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 153/219 (70%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS+HH+  T QL  +V++W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  433  ETSDHHHSHTRQLRDIVEKWTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASP  492

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRK
Sbjct  493  PRVQQPPVKALLQAWNEHLTKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRK  552

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDWYHK+ QRR  + D E  +G  + + V E++  +E+LK +L +E EA+ 
Sbjct  553  EYMRKARAFEDWYHKHAQRRAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHN  612

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   MY  +
Sbjct  613  KLSKQVREKSLSILKAHLPELFRALTDFSLASFEMYSKM  651



>gb|EEE66795.1| hypothetical protein OsJ_23540 [Oryza sativa Japonica Group]
Length=561

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 153/227 (67%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETSE H++RT QL  VV EWH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S
Sbjct  330  PRETSEQHHDRTVQLWNVVHEWHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSS  389

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
             P     PPI  +LHAW +++GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DT
Sbjct  390  QPHE-TTPPIKRVLHAWHEILGKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDT  448

Query  450  RKELEKRTRKFEDWYHKYMQRRTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            R++  K+ R+F+DW  KY+ +      +D   DG   D  + ER+  +E L+  +KE EE
Sbjct  449  RRDYGKKRRQFDDWAQKYIHQTAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEE  507

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
             Y++QC  VR KSL+ LRT LPELF  +S+FS   + M++ + SI H
Sbjct  508  MYVKQCRVVREKSLSLLRTNLPELFRVVSDFSLQSAGMFKGVWSIAH  554



>ref|XP_002457866.1| hypothetical protein SORBIDRAFT_03g017350 [Sorghum bicolor]
 gb|EES02986.1| hypothetical protein SORBIDRAFT_03g017350 [Sorghum bicolor]
Length=264

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY +T +L  +V+EWH+QFEK++ +QK YIR LN WLKLNL+PI++N+KEKVS
Sbjct  31   PRETTDSHYIQTCELRDIVKEWHTQFEKLMDNQKAYIRALNAWLKLNLIPIESNIKEKVS  90

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R  +PPI  LLHAW D + +LP ELAKTAI +F+ V++ IV  Q +E+ L+ RC +T
Sbjct  91   SPPRLVDPPIKHLLHAWHDELERLPIELAKTAIKTFAEVMSNIVHLQEEEVNLRRRCDET  150

Query  450  RKELEKRTRKFEDWYHKYMQRRTP-NDDTEQDGPHEDN--NVIERQLQLEALKQRLKEEE  280
            R++L ++   FEDW+ KY++RR    +DT  D     N   V +R+  +E L+ RL+EEE
Sbjct  151  RRDLTRKRAHFEDWHQKYLERRAAFGEDTNPDAAETQNIDPVEDRKRNIEELEVRLREEE  210

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
              ++R   QVR KSL +LRT LPELF  M++F+  C  MY  L
Sbjct  211  GHHLRHARQVREKSLANLRTHLPELFRNMADFAYFCHDMYNNL  253



>gb|EAZ03209.1| hypothetical protein OsI_25359 [Oryza sativa Indica Group]
Length=599

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 153/227 (67%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETSE H++RT QL  VV EWH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S
Sbjct  368  PRETSEQHHDRTVQLWNVVHEWHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSS  427

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
             P     PPI  +LHAW +++GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DT
Sbjct  428  QPHE-TTPPIKRVLHAWHEILGKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDT  486

Query  450  RKELEKRTRKFEDWYHKYMQRRTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            R++  K+ R+F+DW  KY+ +      +D   DG   D  + ER+  +E L+  +KE EE
Sbjct  487  RRDYGKKRRQFDDWAQKYIHQTAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEE  545

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
             Y++QC  VR KSL+ LRT LPELF  +S+FS   + M++ + SI H
Sbjct  546  MYVKQCRVVREKSLSLLRTNLPELFRVVSDFSLQSAGMFKGVWSIAH  592



>ref|XP_010033880.1| PREDICTED: uncharacterized protein LOC104423116 [Eucalyptus grandis]
 gb|KCW53731.1| hypothetical protein EUGRSUZ_J02988 [Eucalyptus grandis]
Length=726

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 159/231 (69%), Gaps = 9/231 (4%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETSEHH++RT QL  VV +W+ QF  ++ +QK+YI+ L +WLK+N++PI+++L+EKVSS
Sbjct  498  KETSEHHHDRTLQLLKVVGDWNEQFRNVMDNQKKYIKALKNWLKVNVIPIESSLREKVSS  557

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R +NP I  L+HAW + + KLPDELA+T ++SF  V+ TI+  Q DE+  K RC++ R
Sbjct  558  PPRDENPLIQKLVHAWDETLQKLPDELARTEMHSFHEVLATILSIQEDEIGFKHRCEEFR  617

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHED---NNVIERQLQLEALKQRLKEEEE  277
            +EL ++ R  ++    Y+ RRTP DD   D  H+    N + E+++ +E LK+ L EEE+
Sbjct  618  RELNRKERSLKE----YIARRTPPDDM--DPAHDGRYINVITEKEVAVETLKKMLAEEED  671

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
            A+ R C+QVR K+L S +  LPE+F A+S F+RA S MY  L S + P  R
Sbjct  672  AHQRMCLQVREKTLVSFKNRLPEVFRALSTFARASSQMYGNLRSSSQPQKR  722



>gb|AAT93897.1| unknown protein [Oryza sativa Japonica Group]
Length=847

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 153/219 (70%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS+HH+  T QL  +V++W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  568  ETSDHHHSHTRQLRDIVEKWTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASP  627

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRK
Sbjct  628  PRVQQPPVKALLQAWNEHLTKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRK  687

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDWYHK+ QRR  + D E  +G  + + V E++  +E+LK +L +E EA+ 
Sbjct  688  EYMRKARAFEDWYHKHAQRRAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHN  747

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   MY  +
Sbjct  748  KLSKQVREKSLSILKAHLPELFRALTDFSLASFEMYSKM  786



>gb|EEC79170.1| hypothetical protein OsI_19854 [Oryza sativa Indica Group]
Length=665

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 153/219 (70%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS+HH+  T QL  +V++W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  435  ETSDHHHSHTRQLRDIVEKWTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASP  494

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRK
Sbjct  495  PRVQQPPVKALLQAWNEHLTKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRK  554

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDWYHK+ QRR  + D E  +G  + + V E++  +E+LK +L +E EA+ 
Sbjct  555  EYMRKARAFEDWYHKHAQRRAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHN  614

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   +Y  +
Sbjct  615  KLSKQVREKSLSILKAHLPELFRALTDFSLASFEIYSKM  653



>dbj|BAC16409.1| putative bZIP protein [Oryza sativa Japonica Group]
 dbj|BAD31698.1| putative bZIP protein [Oryza sativa Japonica Group]
Length=737

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 153/227 (67%), Gaps = 4/227 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETSE H++RT QL  VV EWH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S
Sbjct  506  PRETSEQHHDRTVQLWNVVHEWHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSS  565

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
             P     PPI  +LHAW +++GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DT
Sbjct  566  QPHE-TTPPIKRVLHAWHEILGKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDT  624

Query  450  RKELEKRTRKFEDWYHKYMQRRTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            R++  K+ R+F+DW  KY+ +      +D   DG   D  + ER+  +E L+  +KE EE
Sbjct  625  RRDYGKKRRQFDDWAQKYIHQTAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEE  683

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
             Y++QC  VR KSL+ LRT LPELF  +S+FS   + M++ + SI H
Sbjct  684  MYVKQCRVVREKSLSLLRTNLPELFRVVSDFSLQSAGMFKGVWSIAH  730



>dbj|BAJ94711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=804

 Score =   211 bits (538),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 157/225 (70%), Gaps = 7/225 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T +L  +V+EWH QFEK++ HQK YIR LN WLKLNL+ I++NLKEKVS
Sbjct  567  PRETTDLHYKQTCELRDIVREWHMQFEKLMDHQKGYIRALNAWLKLNLISIESNLKEKVS  626

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++T
Sbjct  627  SPPRQVEPPIKNLLYAWHDQLERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEET  686

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKE  286
            R++L+++  +FEDW+ +Y +R+      E+  P   N     +V ER++ +E ++ RLKE
Sbjct  687  RRDLDRKRAQFEDWHRRYTERKA--SQGEEANPEAANTSSLDHVNERRIAIEEVEIRLKE  744

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EE  ++R   QVR K+L +LR  LPELF  M++FS  C  MY +L
Sbjct  745  EERLHLRLARQVREKTLANLRMHLPELFRNMTDFSFFCHDMYSSL  789



>emb|CDM82883.1| unnamed protein product [Triticum aestivum]
Length=797

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 164/236 (69%), Gaps = 8/236 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T +L  +V+EWH QF+K++ HQK YIR LN WLKLNL+ I++NLKEKVS
Sbjct  560  PRETTDLHYKQTCELRDIVREWHMQFDKLMDHQKGYIRALNAWLKLNLISIESNLKEKVS  619

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++T
Sbjct  620  SPPRQVEPPIKNLLYAWHDQLERLPVELAKTAIKSFTEVISNIVLLQEEEVSLRRRCEET  679

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN-----NVIERQLQLEALKQRLKE  286
            R++L+++  +FEDW+ +Y +R+      E+  P   N     +V ER++ +E ++ RLKE
Sbjct  680  RRDLDRKKAQFEDWHRRYTERKA--SQGEEANPEAANTPSLDHVNERRIAIEEVEIRLKE  737

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL-ESITHPLNRE  121
            EE+ ++R   QVR K+L +LR  LPELF  M++FS  C  MY +L +S   P+ R+
Sbjct  738  EEKLHLRLVRQVREKTLANLRMHLPELFRNMADFSFFCHDMYSSLRKSAVLPMLRD  793



>dbj|BAJ96409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=791

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 148/218 (68%), Gaps = 0/218 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS HH+  T QL  +V +W++ F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  560  ETSAHHHSHTRQLHDIVDKWNTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASP  619

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LA+ AI SF AV+ TI+  Q +E+K K+ C+   K
Sbjct  620  PRVQQPPVKALLQAWNEQLAKLPDDLARHAIVSFRAVLETILGVQDEELKKKEVCEQIHK  679

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMR  265
            E  ++ R FE+WYHK+ QRRT +D    DG  + + + ER+  +E+LK +L  E EA+ +
Sbjct  680  EYVRKARAFEEWYHKHGQRRTFDDPESGDGTSQKDAISERRFAVESLKSKLDNEVEAHNK  739

Query  264  QCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
               QVR KSL+ LR  LPELF A+++FS A + M+  L
Sbjct  740  LSKQVREKSLSILRAHLPELFRALTDFSHATADMHSKL  777



>gb|EMT10854.1| hypothetical protein F775_26145 [Aegilops tauschii]
Length=628

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 148/218 (68%), Gaps = 0/218 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS HH+  T QL  +V +W++ F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  397  ETSAHHHSHTRQLHDIVDKWNTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASP  456

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LA+ AI SF AV+ TI+  Q +E+K K+ C+   K
Sbjct  457  PRVQQPPVKALLQAWNEQLAKLPDDLARHAIVSFRAVLETILGVQDEELKKKEACEQIHK  516

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMR  265
            E  ++ R FE+WYHK+ QRRT +D    +G  + + + E++  +E+LK +L  E EA+ +
Sbjct  517  EYVRKARAFEEWYHKHGQRRTFDDPESGEGTSQKDAISEKRFAVESLKSKLDNEVEAHNK  576

Query  264  QCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
               QVR KSL+ LR  LPELF A+++FS A + M+  L
Sbjct  577  LSKQVREKSLSILRAHLPELFRALTDFSHATADMHSKL  614



>ref|XP_006826988.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
 gb|ERM94225.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
Length=693

 Score =   207 bits (527),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 152/228 (67%), Gaps = 5/228 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+ H+++T QL    ++W S F+ ++  QK+YI  LN WL+LNL+PI+++LKEKVS
Sbjct  457  PKETSKEHHKQTGQLCQAAKDWDSHFKNLVTLQKKYIEALNSWLRLNLIPIESSLKEKVS  516

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R  NPPI  LLH W   +GKL DE+   AI  F+AV+  I + Q +E+K+K+RC + 
Sbjct  517  SPPRVVNPPIHTLLHEWHARLGKLSDEVTINAISGFAAVIEAIHKQQAEEIKIKERCAEL  576

Query  450  RKELEKRTRKFEDWYHKYMQRRTPND-DTE---QDGPHEDNNVIERQLQLEALKQRLKEE  283
             ++  ++ R F DW  KY+ +R P + D E   + G H+D  ++E++  +E LK+R  EE
Sbjct  577  EEDYNRKNRSFVDWKQKYLDKRGPEEVDGERGGEGGTHKD-PLVEKEFVVETLKKRFDEE  635

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             E + + C QVR KSL SL+TGLP LF A+S+++  CS +Y+ L  +T
Sbjct  636  VELHRKICKQVREKSLGSLKTGLPPLFRAISDYAHTCSEVYKELHVVT  683



>ref|XP_003568507.1| PREDICTED: ras and Rab interactor 3 [Brachypodium distachyon]
Length=779

 Score =   207 bits (528),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 155/225 (69%), Gaps = 2/225 (1%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS HH+  T QL  +V++W++ F  ++ +QKEY+  L  WLKLNL+PI+++L+EKV+SP
Sbjct  551  ETSRHHHSHTRQLRDIVEKWNTNFSDLMSYQKEYVNALYSWLKLNLIPIESSLREKVASP  610

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PPI ALL AW + + KLPD+LA+ AI SF AV++TI+  Q +E+K K+ C+   K
Sbjct  611  PRMQQPPIKALLQAWNEHLAKLPDDLARHAIVSFRAVLDTILSVQDEELKQKENCEQIHK  670

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDWYHK+ QR++ + D E  +G  + + + ER+  +E+LK RL +E E + 
Sbjct  671  EYARKVRAFEDWYHKHAQRKSFDVDPESGEGTGQKDVISERRFAVESLKSRLDDEIEVHN  730

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE-SITH  136
            +   QVR KSL+ L+  LPELF A+++FS AC  M+  L+  +TH
Sbjct  731  KLSKQVREKSLSILKAHLPELFRALTDFSHACFEMHSKLKIDVTH  775



>gb|EMS61963.1| hypothetical protein TRIUR3_31953 [Triticum urartu]
Length=695

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 148/218 (68%), Gaps = 0/218 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS HH+  T QL  +V +W++ F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  413  ETSAHHHSHTRQLHDIVDKWNTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASP  472

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PP+ ALL AW + + KLPD+LA+ AI SF AV+ TI+  Q +E+K K+ C+   K
Sbjct  473  PRVQQPPVKALLQAWNEQLAKLPDDLARHAIVSFRAVLETILGVQDEELKKKEACEQIHK  532

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMR  265
            E  ++ R FE+WYHK+ QRRT +D    +G  + + + E++  +E+LK +L  E EA+ +
Sbjct  533  EYVRKARAFEEWYHKHGQRRTFDDPESGEGTSQKDAISEKRFAVESLKSKLDSEVEAHNK  592

Query  264  QCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
               QVR KSL+ LR  LPELF A+++FS A + M+  L
Sbjct  593  LSKQVREKSLSILRAHLPELFRALTDFSHATAEMHSKL  630



>ref|NP_001172370.1| Os01g0500550 [Oryza sativa Japonica Group]
 dbj|BAD73247.1| bZIP protein-like [Oryza sativa Japonica Group]
 gb|EEE54643.1| hypothetical protein OsJ_01915 [Oryza sativa Japonica Group]
 dbj|BAH91100.1| Os01g0500550 [Oryza sativa Japonica Group]
Length=752

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 153/224 (68%), Gaps = 4/224 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T  L  +V+EWH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVS
Sbjct  516  PRETTDQHYKQTCDLRDIVREWHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVS  575

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++T
Sbjct  576  SPPRLVEPPIKDLLYAWHDQLERLPIELAKTAIKSFAEVISNIVLLQEEEVNLRRRCEET  635

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEE  283
            R++L ++  +FE+W+ +YM+R+       +++E       + V +R+  +E ++ RL+EE
Sbjct  636  RRDLNRKKAQFEEWHQRYMERKASQGEDANNSEVAEAVNSDPVADRKTAIEEVEIRLREE  695

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
               + R   QVR KSL +LR  LPELF  M++F+  C  MY  L
Sbjct  696  MGHHNRIARQVREKSLANLRMHLPELFRNMTDFAGFCYEMYSNL  739



>gb|EEC70709.1| hypothetical protein OsI_02082 [Oryza sativa Indica Group]
Length=797

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 153/224 (68%), Gaps = 4/224 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY++T  L  +V+EWH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVS
Sbjct  561  PRETTDQHYKQTCDLRDIVREWHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVS  620

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++T
Sbjct  621  SPPRLVEPPIKDLLYAWHDQLERLPIELAKTAIKSFAEVISNIVLLQEEEVNLRRRCEET  680

Query  450  RKELEKRTRKFEDWYHKYMQRRTPN----DDTEQDGPHEDNNVIERQLQLEALKQRLKEE  283
            R++L ++  +FE+W+ +YM+R+       +++E       + V +R+  +E ++ RL+EE
Sbjct  681  RRDLNRKKAQFEEWHQRYMERKASQGEDANNSEVAEAVNSDPVADRKTAIEEVEIRLREE  740

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
               + R   QVR KSL +LR  LPELF  M++F+  C  MY  L
Sbjct  741  MGHHNRIARQVREKSLANLRMHLPELFRNMTDFAGFCYEMYSNL  784



>ref|XP_010254134.1| PREDICTED: uncharacterized protein LOC104595215 [Nelumbo nucifera]
Length=710

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS  H E   QL  VVQEW++Q +K++ +QK+YIR LN+WLKLNL+PI+++LKEKVS
Sbjct  478  PKETSIQHSECIKQLWNVVQEWNTQLQKLMANQKDYIRALNNWLKLNLIPIESSLKEKVS  537

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP +   PPI  LL AW + + K+ D +A++AI +F+A + TI+  Q +E+KLKD+C++ 
Sbjct  538  SPLKVSRPPIHHLLQAWNEHLEKVTDGVARSAITAFAAGIETIILQQDEEIKLKDKCEEI  597

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE-RQLQLEALKQRLKEEEEA  274
             KEL +R R  +    KY+++RTP D  E D  + D N +E +QL +  L++RL++E E 
Sbjct  598  SKELARRERILDASRRKYLEKRTPPD--EMDPDNVDKNPLEDKQLMVATLRKRLEDELEQ  655

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLES  145
            Y + C QVR KS  +L+  LPEL  AMS FS AC+ MY+ L S
Sbjct  656  YQKHCRQVREKSFVNLKMHLPELCRAMSVFSLACTNMYKDLRS  698



>gb|EPS58005.1| hypothetical protein M569_16812 [Genlisea aurea]
Length=282

 Score =   195 bits (496),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/234 (43%), Positives = 153/234 (65%), Gaps = 8/234 (3%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS  H+ERT QL + V++W+SQFEKM+ +Q++Y+  LN WLKLNL+PI++ L+EK S+ 
Sbjct  40   ETSREHHERTKQLCIAVEQWNSQFEKMVTNQRQYVNSLNGWLKLNLIPIESTLREKASAA  99

Query  624  QRPQNPP------ILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDR  463
                 P       I  LL +W D + KLPD++AK++I+SF  V+ +I  HQ +EMKL+++
Sbjct  100  AASSPPRNPTPPPIQPLLLSWHDHLEKLPDDVAKSSIFSFKEVIKSIALHQEEEMKLREK  159

Query  462  CKDTRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN--VIERQLQLEALKQRLK  289
               TR+E  ++ + FE+WY +++QRRTP      DG    +    +ER++ +E LK+RL 
Sbjct  160  RDGTRREYLRKKQGFEEWYQRHVQRRTPPPRGADDGAETASKDPAVERRIAVEMLKKRLD  219

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
            EE + + + C+ VR KSL SL+  LPELF A+S++S AC   Y++L  +    N
Sbjct  220  EETDEHRKHCVHVREKSLASLKIRLPELFRALSDYSHACFDAYESLRMVIQSQN  273



>ref|XP_002439756.1| hypothetical protein SORBIDRAFT_09g019490 [Sorghum bicolor]
 gb|EES18186.1| hypothetical protein SORBIDRAFT_09g019490 [Sorghum bicolor]
Length=812

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 150/219 (68%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS++H+  T QL  +V +W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  582  ETSDYHHSHTRQLRYIVDKWITNFTDLMNYQKEYINTLYSWLKLNLIPIESSLKEKVTSP  641

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PPI A L AW + + KLPD+LAKTAI +F AV++TI+  Q +E+K K+ C+ TR+
Sbjct  642  PRMQQPPIKAFLQAWNEHLTKLPDDLAKTAIVTFRAVLDTILGVQDEELKQKETCEQTRR  701

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDWYHK+ QR+  + D E  +G    + V E++  +E+LK RL +E E++ 
Sbjct  702  EYMRKARAFEDWYHKHSQRKASDVDPESGEGIGHKDAVTEKKFAVESLKSRLDDEIESHN  761

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   MY  L
Sbjct  762  KLSKQVREKSLSILKAHLPELFRALTDFSSASFDMYSKL  800



>ref|XP_010249763.1| PREDICTED: uncharacterized protein LOC104592230 isoform X2 [Nelumbo 
nucifera]
Length=670

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 160/223 (72%), Gaps = 1/223 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETS  HYERT QL  VVQEW +Q +K+I HQKEYI+ L+ WLKLNL+PI+++LKEKVS 
Sbjct  444  KETSRQHYERTRQLFHVVQEWQAQLQKVITHQKEYIQALSSWLKLNLIPIESSLKEKVSC  503

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P +    PI  LL AW + +GKLPD +A++A+ +F+A +  I+  Q+DEMKLK++ ++T 
Sbjct  504  PPKVPCTPIQPLLQAWGEQLGKLPDGVARSAVGTFAASIEAIMVQQMDEMKLKEKWEETS  563

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            KELE+R +   +   KYM+RRTP D+ + D    D    ++Q  +++L++RL+EE+E + 
Sbjct  564  KELERREKHLMEARQKYMERRTPPDEMDPDNADRD-PFEDKQFIVDSLRKRLEEEKEEHQ  622

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            +   QVR KSL +L+  LPEL  AMS+FSR CS++Y+ L+SI+
Sbjct  623  KNYRQVREKSLVNLKIHLPELCRAMSDFSRDCSMLYKELKSIS  665



>ref|NP_001169630.1| hypothetical protein [Zea mays]
 gb|ACN34343.1| unknown [Zea mays]
 tpg|DAA54627.1| TPA: hypothetical protein ZEAMMB73_367183 [Zea mays]
Length=783

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 158/220 (72%), Gaps = 7/220 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ HY +T +L  +V+EWH+QFEK++ +QK YIR LN WLKLNL+PI++N+KEKVS
Sbjct  560  PRETTDSHYIQTCELRDIVREWHTQFEKLMDNQKAYIRALNAWLKLNLIPIESNIKEKVS  619

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R  +PPI  LLHAW D + +LP ELAKTAI +F+ V++TIV  Q +E+ L+ RC +T
Sbjct  620  SPPRLVDPPIKHLLHAWHDELERLPIELAKTAIKTFAEVISTIVHLQEEEVNLRRRCDET  679

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
            R++L ++  +FEDW+ KY++R+T   +T+   P ED     R+  +E L+ RL+EEE  +
Sbjct  680  RRDLNRKKAQFEDWHQKYLERQTA--ETQNIDPVED-----RKRTIEELEIRLREEEGHH  732

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +R   QVR KSL +LRT LPELF  MS+F+  C  MY  L
Sbjct  733  LRHARQVREKSLANLRTHLPELFRNMSDFAYFCKDMYNNL  772



>ref|XP_010249762.1| PREDICTED: uncharacterized protein LOC104592230 isoform X1 [Nelumbo 
nucifera]
Length=703

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 160/223 (72%), Gaps = 1/223 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KETS  HYERT QL  VVQEW +Q +K+I HQKEYI+ L+ WLKLNL+PI+++LKEKVS 
Sbjct  477  KETSRQHYERTRQLFHVVQEWQAQLQKVITHQKEYIQALSSWLKLNLIPIESSLKEKVSC  536

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P +    PI  LL AW + +GKLPD +A++A+ +F+A +  I+  Q+DEMKLK++ ++T 
Sbjct  537  PPKVPCTPIQPLLQAWGEQLGKLPDGVARSAVGTFAASIEAIMVQQMDEMKLKEKWEETS  596

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            KELE+R +   +   KYM+RRTP D+ + D    D    ++Q  +++L++RL+EE+E + 
Sbjct  597  KELERREKHLMEARQKYMERRTPPDEMDPDNADRD-PFEDKQFIVDSLRKRLEEEKEEHQ  655

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            +   QVR KSL +L+  LPEL  AMS+FSR CS++Y+ L+SI+
Sbjct  656  KNYRQVREKSLVNLKIHLPELCRAMSDFSRDCSMLYKELKSIS  698



>emb|CBI20923.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            PKETS+HH+ERT QL   +Q WHSQFEK++ H+K+YI+ LN WLKLNL+PI+++LKEK+S
Sbjct  258  PKETSKHHHERTIQLWNEIQGWHSQFEKLVTHEKQYIQALNSWLKLNLIPIESSLKEKIS  317

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP RPQ+PPI ALLH+W D + KLP ELAK+AI SF+AV+ TI+ HQ +EMKLK++C++T
Sbjct  318  SPPRPQHPPIQALLHSWHDSLEKLPHELAKSAISSFAAVIKTIILHQEEEMKLKEKCEET  377

Query  450  RKELEKRTRKFEDWYHKYMQ  391
            +KE  ++ + F+DWY KYMQ
Sbjct  378  QKEYSRKHQAFQDWYQKYMQ  397



>ref|XP_010667640.1| PREDICTED: uncharacterized protein LOC104884645 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=650

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 4/167 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETS+ HY  T QL  VVQ+W  +FE ++  QK Y+R LN WLKLNL+PI++NLKEK+S
Sbjct  473  PRETSKPHYHCTLQLSNVVQQWQDRFETLVHQQKHYVRSLNSWLKLNLIPIESNLKEKIS  532

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R  +PPI ALLHAW D + KLPDE+ +TAI SF A++ TI+ HQ +EM+LK++C++T
Sbjct  533  SPPRAHHPPIQALLHAWHDALEKLPDEVTRTAISSFGAMIKTIILHQDEEMRLKEKCEET  592

Query  450  RKELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQL  319
            RKE  ++ + FEDWYHKYMQR+ P   + +  +DGP +D  V ERQ+
Sbjct  593  RKEFLRKNQAFEDWYHKYMQRKGPEAMDSERGEDGPGKD-PVSERQV  638



>ref|XP_003567735.1| PREDICTED: uncharacterized protein LOC100824905 [Brachypodium 
distachyon]
Length=796

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 158/225 (70%), Gaps = 7/225 (3%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ H+++T +L  +V+EWH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVS
Sbjct  564  PRETTDVHHKQTCELRDIVREWHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVS  623

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LLHAW D + KLP ELAKTAI SF+ V++ IV  Q +E+ L+ RC DT
Sbjct  624  SPPRQVEPPIKNLLHAWHDQLEKLPIELAKTAIKSFAEVISNIVVLQEEEINLRRRCDDT  683

Query  450  RKELEKRTRKFEDWYHKYMQRRT-----PNDDTEQDGPHEDNNVIERQLQLEALKQRLKE  286
            R++L ++  +F++W+ KYM+R+      PN +T +  P  D  V ER++ +E ++ RLKE
Sbjct  684  RRDLVRKKAQFQEWHLKYMERKASLGEEPNPETAET-PTVD-PVNERKIAIEEVEIRLKE  741

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EE  + R   QVR K+L +LR  LPELF  M++FS  C  MY +L
Sbjct  742  EEGHHHRLARQVREKTLANLRMHLPELFRNMADFSFFCHDMYSSL  786



>ref|XP_008652191.1| PREDICTED: uncharacterized protein LOC103632124 [Zea mays]
 tpg|DAA60030.1| TPA: hypothetical protein ZEAMMB73_463294 [Zea mays]
Length=742

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 143/223 (64%), Gaps = 3/223 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETSE H+ERT QL  VVQEWH QF++ + +QKEYI  L +W+KLN++PIDTN+K   S 
Sbjct  515  RETSEQHHERTLQLWNVVQEWHVQFDRFMTYQKEYIGSLYNWIKLNVIPIDTNIKPNSSQ  574

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P     PPI  LLHAW D++ KLPD   K AI++F+ VVNTI+ HQ DE+KL+ +  D R
Sbjct  575  PHE-ATPPIKRLLHAWHDILEKLPDNETKKAIHTFAEVVNTILVHQDDELKLRLKIDDIR  633

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            ++LEK+ ++F+ W  K   R     D   D P   +   ER+  ++ ++  LK+ E+ Y 
Sbjct  634  RDLEKKRKQFDSWAQKNWDRGASIPDG--DNPGRVDPAAERKAVVDRVENALKDLEDNYR  691

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             QC  VR KSL  LR+ LPELF A+SEFS   +  ++ L SI 
Sbjct  692  TQCKVVRDKSLNLLRSNLPELFRAVSEFSLQSAGYFKGLWSIA  734



>ref|XP_004506851.1| PREDICTED: uncharacterized protein LOC101489547 [Cicer arietinum]
Length=568

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 151/233 (65%), Gaps = 10/233 (4%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI-DTNLKEKV  634
            P ETSEHH++RTYQL +V+QEW SQF+K I +QK +I+ L  WLKLNL  + D+++KE +
Sbjct  333  PLETSEHHHDRTYQLLLVMQEWESQFQKSINNQKGFIKALYTWLKLNLTLLNDSDIKENI  392

Query  633  SSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKD  454
            SSP+   + PI  LLHAW D + KLPDE A+ AI +F A V+++ Q Q +E+ LK +C +
Sbjct  393  SSPK---SCPIQILLHAWNDRLEKLPDEFARIAIANFVAAVDSLYQRQQEELVLKRKCDE  449

Query  453  TRKELEKRTRKFEDWYHKYMQRR-----TPNDDTEQDGPHEDNNVIERQLQLEALKQRLK  289
             RKE  +++ +F+ W  KY +R+      PN  TE D    D  + E++  L  L++RL 
Sbjct  450  IRKEYTRKSTQFDQWESKYSKRKRLDEFDPN-RTEGDCNEADEVLKEKKRLLIELEKRLD  508

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPL  130
            EE++A+ R C+ VR KSL  L+  L ELF  M++FS  CS MY  L  + H L
Sbjct  509  EEKDAFERHCLHVRQKSLRCLKNDLLELFRTMTDFSLECSKMYSELSYVVHKL  561



>ref|XP_004968820.1| PREDICTED: uncharacterized protein LOC101757982 [Setaria italica]
Length=791

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 154/231 (67%), Gaps = 3/231 (1%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            E ++ HY +T +L  +V+EWH QFEK++ +QK YIR LN WLKLNL+PI++N+KEKVSSP
Sbjct  560  ERTDLHYNQTCELRDIVREWHMQFEKLMNNQKAYIRALNAWLKLNLIPIESNIKEKVSSP  619

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R  +PPI  LLHAW D + +LP ELAKTAI +F+ V++ IV  Q +E+ L+ RC +TR+
Sbjct  620  PRLVDPPIKNLLHAWHDELERLPIELAKTAIKTFAEVISNIVHLQEEEVNLRRRCDETRR  679

Query  444  ELEKRTRKFEDWYHKYMQRRTP---NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
            +L ++  +FEDW+ KY +RR     N + E       + V +R+  +E L+ RL+EEE  
Sbjct  680  DLTRKRAQFEDWHQKYTERRAALGENGNPEAAEVQNIDPVEDRKRVIEELEIRLREEEGH  739

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRE  121
            ++RQ  QVR KSL +LRT LPELF  M++FS  C  MY  L     P   E
Sbjct  740  HLRQARQVREKSLANLRTHLPELFRNMADFSYFCHDMYNNLRKAAAPAKDE  790



>ref|XP_006644200.1| PREDICTED: uncharacterized protein LOC102708565 [Oryza brachyantha]
Length=760

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 151/223 (68%), Gaps = 3/223 (1%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ET++ H+++T  L  +V+EWH QFEK++ +QK YIR LN WLKLNL+PI++NLKEKVS
Sbjct  525  PRETTDQHHKQTSDLRDIVREWHMQFEKLMDYQKGYIRALNAWLKLNLIPIESNLKEKVS  584

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP R   PPI  LL+AW D + +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC+DT
Sbjct  585  SPPRQVEPPIKDLLYAWHDQLERLPIELAKTAIKSFAEVISNIVLLQEEEINLRRRCEDT  644

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEE  280
            R++L ++  +FE+W+ +YM+R+    +       E  N   V ER+  +E ++ RL+EE 
Sbjct  645  RRDLNRKKAQFEEWHQRYMERKASQGEDANSEVAEAVNSDPVAERKTSIEEIEIRLREEM  704

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
              + R   QVR KSL +LR  LPELF  M++FS  C  MY  L
Sbjct  705  GHHSRIASQVREKSLANLRMHLPELFRNMTDFSGFCHEMYSNL  747



>ref|XP_004955806.1| PREDICTED: uncharacterized protein LOC101763037 [Setaria italica]
Length=735

 Score =   194 bits (492),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 145/223 (65%), Gaps = 3/223 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETSE H+ERT QL  +VQEWH+QF+K + +QKEY+  L  W+KLN++PID +LK   S 
Sbjct  508  RETSEQHHERTVQLWSIVQEWHAQFDKFMTYQKEYVGSLYSWIKLNVIPIDADLKPNSSQ  567

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P     PPI  LLHAW D++ KLPD  AK AI++F+ VV+TI+  Q DE+KL+ + ++TR
Sbjct  568  PHE-TTPPIKRLLHAWHDILEKLPDNDAKKAIHTFAEVVHTILVQQEDELKLRIKIEETR  626

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            ++LEK+ R+F+DW  K   R     D   + P   +   ER+  ++ ++  LK+ E+ Y 
Sbjct  627  RDLEKKRRQFDDWAQKNWDRGASIPDG--NNPGRADPAGERKAVVDRVENALKDLEDQYK  684

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             QC  VR KSL  LR+ LPELF A+S+FS   +  ++ L SI 
Sbjct  685  TQCKVVRDKSLNLLRSNLPELFRAVSDFSLQSAGYFKGLWSIA  727



>ref|XP_002461680.1| hypothetical protein SORBIDRAFT_02g006420 [Sorghum bicolor]
 gb|EER98201.1| hypothetical protein SORBIDRAFT_02g006420 [Sorghum bicolor]
Length=761

 Score =   194 bits (492),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 143/223 (64%), Gaps = 2/223 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            +ETSE H ERT QL  +VQEWH QF++ + +QKEY+  L  W+KLN++PIDTNLK   S 
Sbjct  533  RETSEQHNERTVQLWNIVQEWHVQFDRFMAYQKEYVGSLYSWIKLNVIPIDTNLKPNSSQ  592

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P     PPI  LLHAW D++ KLP +  K AI++F+ VV+TI+ HQ +E+KL+ + ++TR
Sbjct  593  PHE-TTPPIKRLLHAWHDILEKLPVDATKRAIHTFAEVVHTILVHQDEELKLRMKIEETR  651

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            ++ EK+ R+F+DW  K   R     D +   P  D    ER+  ++ L+  LK+ E++Y 
Sbjct  652  RDFEKKRRQFDDWAQKNWDRGASIPDGDNPAPRAD-PAAERKAVVDKLENALKDLEDSYK  710

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
             QC  VR KSL  LR+ LPELF  +SEFS   +  ++ L SI 
Sbjct  711  TQCKVVRDKSLNLLRSNLPELFRVVSEFSLQSAGYFKGLWSIA  753



>ref|NP_001168451.1| uncharacterized protein LOC100382224 [Zea mays]
 gb|ACN28274.1| unknown [Zea mays]
Length=677

 Score =   193 bits (490),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 147/219 (67%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS++H+  T QL  +V +W + F   +  QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  447  ETSDYHHSHTRQLRDIVDKWITNFTDFMNCQKEYINALYGWLKLNLIPIESSLKEKVASP  506

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PPI A L+AW + + KLPD+LAKTAI +F AV++TI+  Q +E+K K+ C+ TR+
Sbjct  507  PRMQQPPIKAFLYAWHEHLAKLPDDLAKTAIVTFRAVLDTILGVQDEELKQKEICEQTRR  566

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDW HK+ Q R  + D +  +G    + V E++  +E+LK +L +E E++ 
Sbjct  567  EYIRKARAFEDWCHKHPQPRAIDVDPDSGEGTGHKDVVTEKRFAVESLKSKLDDEIESHN  626

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   MY  L
Sbjct  627  KLSKQVREKSLSILKAHLPELFRALTDFSDASFEMYSKL  665



>gb|AFW82165.1| hypothetical protein ZEAMMB73_214762 [Zea mays]
Length=775

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 147/219 (67%), Gaps = 1/219 (0%)
 Frame = -1

Query  804  ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP  625
            ETS++H+  T QL  +V +W + F   +  QKEYI  L  WLKLNL+PI+++LKEKV+SP
Sbjct  545  ETSDYHHSHTRQLRDIVDKWITNFTDFMNCQKEYINALYGWLKLNLIPIESSLKEKVASP  604

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             R Q PPI A L+AW + + KLPD+LAKTAI +F AV++TI+  Q +E+K K+ C+ TR+
Sbjct  605  PRMQQPPIKAFLYAWHEHLAKLPDDLAKTAIVTFRAVLDTILGVQDEELKQKEICEQTRR  664

Query  444  ELEKRTRKFEDWYHKYMQRRTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            E  ++ R FEDW HK+ Q R  + D +  +G    + V E++  +E+LK +L +E E++ 
Sbjct  665  EYIRKARAFEDWCHKHPQPRAIDVDPDSGEGTGHKDVVTEKRFAVESLKSKLDDEIESHN  724

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +   QVR KSL+ L+  LPELF A+++FS A   MY  L
Sbjct  725  KLSKQVREKSLSILKAHLPELFRALTDFSDASFEMYSKL  763



>ref|XP_009398982.1| PREDICTED: uncharacterized protein LOC103983491 [Musa acuminata 
subsp. malaccensis]
Length=729

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 147/228 (64%), Gaps = 5/228 (2%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P+ETS+ H+ RT QL  +V EW SQF+K++ +QK+YI+ LN WL LN+VPI+ + ++  S
Sbjct  493  PRETSKQHHNRTVQLWKMVGEWDSQFDKLMSNQKDYIKALNRWLNLNVVPIERSSRKDAS  552

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP    +P I  LLHAW D +  LP + AK+++ +FS  V  I+  Q++E+ LK +  D 
Sbjct  553  SPPEQADPLIKILLHAWHDQLENLPVDRAKSSLSTFSGAVQAIMLCQVEELNLKLKWDDA  612

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQD-----GPHEDNNVIERQLQLEALKQRLKE  286
             ++ E++  +F+ W+HKY +R T     E +     G  + + V E++  ++  + +L+ 
Sbjct  613  HRDCERKKHEFDVWHHKYTERITATSSDEVNPETVEGATQQDLVSEKKAVVDNAESKLRV  672

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             EE+Y +QC  VR KSLTSL+T LPELF AM +F+ +C+ MY+ L SI
Sbjct  673  SEESYRKQCKMVRDKSLTSLKTHLPELFRAMLDFASSCAEMYKRLSSI  720



>ref|XP_009786427.1| PREDICTED: uncharacterized protein LOC104234548 isoform X2 [Nicotiana 
sylvestris]
Length=631

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -1

Query  507  TIVQHQLDEMKLKDRCKDTRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE  328
            T+  +  +EMKLKDRC+DTR+EL K+TR++EDWYHKYMQRRTP D+ + D  HED+ V++
Sbjct  500  TMRGYHKEEMKLKDRCEDTRRELNKKTRQYEDWYHKYMQRRTPPDEMDPDQAHEDSLVVD  559

Query  327  RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  148
            RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMS+FS AC+ MY+ L 
Sbjct  560  RQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFEAMSDFSLACADMYRDLR  619

Query  147  SITHPLNR  124
            SI    NR
Sbjct  620  SIAKHRNR  627



>gb|ABR18011.1| unknown [Picea sitchensis]
Length=724

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/239 (41%), Positives = 139/239 (58%), Gaps = 15/239 (6%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++ H++RTYQL  V  EWH+Q EK+ IHQK+YI  LN+WL+LNL+PI++NLKEKVS
Sbjct  476  PDETTKQHHDRTYQLYNVANEWHAQSEKLFIHQKQYIGALNNWLRLNLIPIESNLKEKVS  535

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP +   PPI  LL  W   + +LP  +A   + SF+A++N I   Q +E+K K   +D 
Sbjct  536  SPPKAFVPPIHELLQVWHSTLDQLPYAVALQGLKSFAAIINRIFTQQQEELKKKKNYEDA  595

Query  450  RKELEKRTRKFEDWY----------HKYMQRRTPNDDTEQDGP--HEDNN---VIERQLQ  316
            + ELE++ + F +W            +    +T N  +E++     E NN    +ER+  
Sbjct  596  QAELERKRKAFNEWALRNPPENKGSEESAGGQTENRSSEENAGVQTEINNKDPSMERRHA  655

Query  315  LEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  139
            L  L++R+ EE   +   C   R  SL SL TGLP LF A+   SR C   Y+ L +IT
Sbjct  656  LILLEKRVHEEGVKHKNSCKLTRDLSLKSLETGLPALFQALVGLSRNCFETYKELHTIT  714



>ref|XP_003604444.1| hypothetical protein MTR_4g012430 [Medicago truncatula]
Length=523

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/200 (44%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETSEHH++RTYQL  V+QE  SQFEK+I +QK +I+ L  WLKLNL  I+++  +K+S
Sbjct  330  PTETSEHHHDRTYQLLNVMQELESQFEKLIKNQKGFIKALYSWLKLNLTLIESDTTKKIS  389

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP      P+  LLHAW D + KLPDE A+ A+  F+AVV+++ QHQ  E+ LK +C++ 
Sbjct  390  SP------PLQILLHAWNDHLEKLPDEHARIALSHFAAVVDSLYQHQEQELVLKRKCEEI  443

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEE  283
            RKE  +++R+F+ W  KY +++  ++  +  G  + N+     +E+++ +E L++RL EE
Sbjct  444  RKEYTRKSRRFDQWECKYKKKKGLDEFDQNRGEDDINDPPEVAMEKRVLVE-LEKRLDEE  502

Query  282  EEAYMRQCMQVRVKSLTSLR  223
            ++A+ +QC+ VR KSL+ L+
Sbjct  503  KDAFEKQCLHVRQKSLSCLK  522



>ref|XP_009628246.1| PREDICTED: uncharacterized protein LOC104118644 isoform X2 [Nicotiana 
tomentosiformis]
Length=614

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -1

Query  507  TIVQHQLDEMKLKDRCKDTRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE  328
            T+  +  +EMKLKDRC+DTR+EL K+TR++EDWY ++MQRRTP D+ + D  H D+ V++
Sbjct  483  TMRGYHKEEMKLKDRCEDTRRELNKKTRQYEDWYQRHMQRRTPPDEMDPDQAHVDSLVVD  542

Query  327  RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  148
            RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMSEFS AC+ MY+ L 
Sbjct  543  RQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFGAMSEFSLACADMYRDLR  602

Query  147  SITHPLNR  124
            SI+   NR
Sbjct  603  SISKHRNR  610



>ref|XP_010479739.1| PREDICTED: uncharacterized protein LOC104758551, partial [Camelina 
sativa]
Length=687

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            KET++HH+ERT QL  VVQEWH+QF +M+ HQKEYI+ L  W+KLNL+PI++ LKEKVSS
Sbjct  561  KETNDHHHERTIQLLAVVQEWHTQFCRMVDHQKEYIKALAGWIKLNLIPIESTLKEKVSS  620

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P R  NP I  LL  W D + K+PDE+A+TAI +F+AV++TI+Q Q DE+ L+++C++TR
Sbjct  621  PPRVPNPAIQKLLTVWYDRLDKIPDEMARTAIINFAAVISTIMQQQEDEINLRNKCEETR  680

Query  447  KELEKR  430
            KEL ++
Sbjct  681  KELGRK  686



>gb|AES86641.2| BZIP protein [Medicago truncatula]
Length=512

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 130/189 (69%), Gaps = 11/189 (6%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ETSEHH++RTYQL  V+QE  SQFEK+I +QK +I+ L  WLKLNL  I+++  +K+S
Sbjct  330  PTETSEHHHDRTYQLLNVMQELESQFEKLIKNQKGFIKALYSWLKLNLTLIESDTTKKIS  389

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            SP      P+  LLHAW D + KLPDE A+ A+  F+AVV+++ QHQ  E+ LK +C++ 
Sbjct  390  SP------PLQILLHAWNDHLEKLPDEHARIALSHFAAVVDSLYQHQEQELVLKRKCEEI  443

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN----VIERQLQLEALKQRLKEE  283
            RKE  +++R+F+ W  KY +++  ++  +  G  + N+     +E+++ +E L++RL EE
Sbjct  444  RKEYTRKSRRFDQWECKYKKKKGLDEFDQNRGEDDINDPPEVAMEKRVLVE-LEKRLDEE  502

Query  282  EEAYMRQCM  256
            ++A+ +QC+
Sbjct  503  KDAFEKQCL  511



>ref|XP_008352156.1| PREDICTED: uncharacterized protein LOC103415623 [Malus domestica]
Length=414

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS  631
            P ET++HH++RT QL  V+QEWH  FEK+  HQK+YI+ LN WLKLNL+PI+++LK+K+S
Sbjct  248  PMETTKHHHDRTVQLWNVLQEWHXHFEKLXXHQKQYIQALNSWLKLNLIPIESSLKZKIS  307

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIV  499
            SP R Q PPI ALLH+W D + KL DELAK AI SF+AV+ TI+
Sbjct  308  SPPRVQRPPIQALLHSWHDSLEKLSDELAKCAISSFAAVIKTII  351


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -1

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSI  166
            +A+ R C+QVR KSL SL+T LPE+F  M++++ ACSI
Sbjct  361  KAHQRHCIQVRDKSLGSLKTRLPEIFRTMTDYANACSI  398



>gb|ABK95129.1| unknown [Populus trichocarpa]
Length=126

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (74%), Gaps = 2/117 (2%)
 Frame = -1

Query  480  MKLKDRCKDTRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN--VIERQLQLEA  307
            MKLK++C++TR+E  ++ + FE+WY KYMQRRTP D+T+ D   + N   V ERQ  +E+
Sbjct  1    MKLKEKCEETRREFMRKNQAFEEWYQKYMQRRTPTDETDADRGEDANPNPVSERQFVVES  60

Query  306  LKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            LK+RL+EE EA+ + C+QVR KS+ SL+  LPELF AMS+++ ACS  Y+ L SIT 
Sbjct  61   LKKRLEEEIEAHGKHCLQVREKSVGSLKIRLPELFRAMSDYAHACSDAYEKLRSITQ  117



>ref|XP_009391172.1| PREDICTED: ras and EF-hand domain-containing protein homolog 
[Musa acuminata subsp. malaccensis]
Length=861

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 120/227 (53%), Gaps = 10/227 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS  H +   QL + V+ W+S F  ++  Q+EY+  L  WL+L+L     +     S  Q
Sbjct  428  TSNIHRQAALQLELEVENWYSAFCSLVNSQREYVHALTGWLRLSLFQCHHD-----SLAQ  482

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              QNP I +L   WQ  + ++PD++A   I SF +V++ +V  Q +E K K R +   +E
Sbjct  483  SRQNPEIYSLCEEWQLALDRIPDKVASEGIKSFLSVIHAVVMQQAEEQKQKKRSEVAFRE  542

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMR  265
            LEKR  +      K+     P   TE  G     + V+E++ ++EALK + +EE+  Y +
Sbjct  543  LEKRAEELRSLESKF----GPYSTTEGHGGMAQRSPVLEKRAKVEALKAKAEEEKSKYEK  598

Query  264  QCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNR  124
                 R  +L +L+TG P +F AM+ F+  C  +++++ +    L+R
Sbjct  599  SVGVTRAMTLNNLQTGFPNVFQAMTGFAGVCMQVFESVYNHQRSLDR  645



>ref|XP_011093240.1| PREDICTED: uncharacterized protein LOC105173250 [Sesamum indicum]
Length=844

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 125/229 (55%), Gaps = 15/229 (7%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            + TS+ H + T  L   V  WHS F +MI  Q+++IR L+ W KL L+PI++   E  +S
Sbjct  616  QSTSDLHRQATRDLESAVSAWHSSFCRMIKFQRDFIRSLHGWFKLTLLPINS---EPTNS  672

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
             + P    + A    W+  + ++PD +A  AI SF+ VV++I   Q +E+K+K R +   
Sbjct  673  DREPSK--VFAFFDEWKLAVDRIPDTVASEAIKSFNNVVHSISLKQTEELKIKKRTESAS  730

Query  447  KELEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLK  289
            KELEK++    +    +YH Y        D   D  H     + + E++ +L   ++R++
Sbjct  731  KELEKKSSSLRNIEKKYYHSYSMVGIGLPDNGPDNGHVLDARDPLAEKKAELAICQRRVE  790

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E   +++     R  +L +++TGLP +F AM+ FS   +++ + LE++
Sbjct  791  DEMVKHLKAVEVTRAMTLNNIQTGLPGVFQAMTSFS---ALITEALETV  836



>ref|XP_007134473.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
 gb|ESW06467.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
Length=810

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 128/230 (56%), Gaps = 17/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSP  625
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ WLKLNL+P++  N+K   ++ 
Sbjct  580  TSESHKQATRDLESAVSAWHSSFCRLIKFQRDFILSLHGWLKLNLIPVNKDNIKSTSNNN  639

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
                +  + +    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   K
Sbjct  640  SESSH--VFSFCDEWKLALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKKRTESASK  697

Query  444  ELEKRT-------RKFEDWYHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRL  292
            ELEK++       RKF + Y   M   TP +    +G   D  + + E++L+LE+ ++R+
Sbjct  698  ELEKKSSSLRSIERKFYNSYS--MVGITPPESGPGNGQGLDARDPLAEKKLELESYQRRV  755

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            ++E   + +     R  +L +L+TGLP +F AMS FS   S+  + LES+
Sbjct  756  EDEIVRHSKAVEVTRAMTLNNLQTGLPGVFQAMSSFS---SLFTEALESV  802



>ref|XP_010941314.1| PREDICTED: uncharacterized protein LOC105059637 [Elaeis guineensis]
Length=640

 Score =   117 bits (292),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 114/220 (52%), Gaps = 10/220 (5%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            T++ H + + QL V V  W+S F  ++  Q+EYI  L  WL+L+L   D N+  K     
Sbjct  413  TTDTHRQASLQLEVEVNHWYSSFCSLVNSQREYIYALTGWLRLSLFQCDHNMLGK----S  468

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +  +  I +L   WQ  + ++PD++A   I SF  V++ +V  Q +E K K + +   KE
Sbjct  469  QQSSDMIYSLCEEWQLALDRIPDKVASEGIKSFITVIHAVVVQQAEEQKQKRKSELAFKE  528

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEKR  +      KY          E  G +    V+E++ ++EALK + +EE+  Y + 
Sbjct  529  LEKRAEELRSLESKYGPYSVAEGYGEMAGRYP---VLEKRAKVEALKTKAEEEKSRYEKS  585

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+TGLP +F AM+ F+  C    Q  ES+
Sbjct  586  IAVTRAMTLNNLQTGLPNVFQAMTGFASVC---MQAFESV  622



>ref|XP_004166130.1| PREDICTED: uncharacterized LOC101224117, partial [Cucumis sativus]
Length=260

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 124/234 (53%), Gaps = 25/234 (11%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L  +V  WHS F ++I   +++IR L+ WLKL+ +P++ +         
Sbjct  35   TSELHRQATRDLESMVTAWHSSFCRLIKFHRDFIRSLHGWLKLSYIPVNND-------SL  87

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
                 P    L  W+  + ++PD +A  AI SF  VVN I   Q +E+K+K R +   KE
Sbjct  88   TDNKEPAEIFLDQWKLALDRVPDTVASVAIKSFINVVNVISAKQTEEIKIKKRTESASKE  147

Query  441  LEKRTRKF----EDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQR  295
             EK++       + +Y+ Y        DT   GP ++ +++       E++++L A ++R
Sbjct  148  FEKKSASIMHLEKKFYNSYSMVGIGLPDT---GPADNGHILDARDPLAEKKIELVACQRR  204

Query  294  LKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI-TH  136
            ++EE+  + +     R  +L +L+TGLP +F A++ FS   ++  + LES+ TH
Sbjct  205  VEEEKIKHSKAVEVTRAMTLNNLQTGLPGVFQALTSFS---ALFTEALESVCTH  255



>gb|KHN00204.1| hypothetical protein glysoja_034735 [Glycine soja]
Length=422

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 126/229 (55%), Gaps = 20/229 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ WLKLNL+P++ +     +S  
Sbjct  197  TSESHKQATRDLESAVSAWHSSFCRLIKFQRDFILSLHGWLKLNLIPVNND----NNSSS  252

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
             P    + +    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +++ KE
Sbjct  253  EPSG--VFSFCDEWKLALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKRRTENSSKE  310

Query  441  LEKRT-------RKFEDWYHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLK  289
            LEK++       RKF   Y   M   TP +    +G   D  + + E++++L A ++R++
Sbjct  311  LEKKSSSLRSIERKFYSSYS--MVGITPPESGPGNGQGLDARDPLAEKKMELAAHQRRVE  368

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E   + +     R  +L +L+TGLP +F A++ FS   ++  + LES+
Sbjct  369  DEMVRHSKAVEVTRAMTLNNLQTGLPGVFQALTSFS---TLFTEALESV  414



>ref|XP_006576720.1| PREDICTED: uncharacterized protein LOC100792843 [Glycine max]
Length=799

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 125/229 (55%), Gaps = 20/229 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ WLKLNL+P++ N     S P 
Sbjct  574  TSESHKQATRDLESAVSAWHSSFCRLIKFQRDFILSLHGWLKLNLIPVN-NDNNSSSEPS  632

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
                  +L+    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +++ KE
Sbjct  633  G-----VLSFCDEWKLALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKRRTENSSKE  687

Query  441  LEKRT-------RKFEDWYHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLK  289
             EK++       RKF   Y   M   TP +    +G   D  + + E++++L A ++R++
Sbjct  688  FEKKSSSLRSIERKFYSSYS--MVGITPPESGPGNGQGLDARDPLAEKKMELAAHQRRVE  745

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E   + +     R  +L +L+TGLP +F A++ FS   ++  + LES+
Sbjct  746  DEMVRHSKAVEVTRAMTLNNLQTGLPGVFQALTSFS---TLFTEALESV  791



>ref|XP_010113322.1| hypothetical protein L484_026653 [Morus notabilis]
 gb|EXC35329.1| hypothetical protein L484_026653 [Morus notabilis]
Length=658

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/228 (31%), Positives = 117/228 (51%), Gaps = 9/228 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  M+  Q++YI+ L  WL+L+L   + N   + S   
Sbjct  433  TSEIHRQTTLQLELEVQQWHLSFCNMVKAQQDYIQSLTGWLRLSLFQFNRNPLARTS---  489

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q   I +L   W   + ++PD++A   I SF  V++ IV  Q +E K K + +   K+
Sbjct  490  --QESKIYSLCEEWHLAVDRIPDKVASEGIKSFLTVIHAIVVQQAEEQKQKKKSESVFKD  547

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+  +      KY     P   +E  G    N V E++ ++E LK + +EE+  + + 
Sbjct  548  LEKKMLELRSLESKY----GPYSMSESSGITGRNPVAEKRAKVEMLKAKAEEEKTKHEKS  603

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRES  118
                R  +L +L+ GLP +F  M  FS  C   ++++ + T   ++E+
Sbjct  604  VSVTRAMTLNNLQMGLPHVFEGMVGFSSVCMHAFESVYNHTKSADQEA  651



>ref|XP_007204230.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica]
 gb|EMJ05429.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica]
Length=647

 Score =   114 bits (284),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 113/227 (50%), Gaps = 9/227 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  ++  Q +YI+ L  WL+L+L     +   K S   
Sbjct  422  TSEIHRQATLQLELQVQQWHQSFCNLVKAQLDYIQSLTGWLRLSLFQFRRHPISKTSQES  481

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I  L   W   + ++PD++A   I SF  VV+ IV  Q +E K K + + T KE
Sbjct  482  R-----IYMLCEEWHHAVDRIPDKVASEGIKSFLTVVHAIVVQQAEEYKQKKKSESTFKE  536

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+         KY     P+  +        N V+E++ ++E L+ + +EE+  + + 
Sbjct  537  LEKKATVLRSLESKYGPYSMPDSASTST----KNPVVEKRAKVEVLRAKAEEEKSKHEKS  592

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRE  121
                RV +L +L+ G P +F AM  FS  C   +++L +     N+E
Sbjct  593  VSVTRVMTLNNLQMGFPHVFEAMVGFSSVCMQAFESLYNQAKSANQE  639



>ref|XP_008459782.1| PREDICTED: uncharacterized protein LOC103498813 [Cucumis melo]
Length=813

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/232 (31%), Positives = 124/232 (53%), Gaps = 26/232 (11%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L  +V  WHS F ++I   +++IR L+ WLKL+ +P++ +         
Sbjct  588  TSELHRQATRDLESMVTAWHSSFCRLIKFHRDFIRSLHGWLKLSYIPVNND--------G  639

Query  621  RPQNP-PILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
             P N  P    L  W+  + ++PD +A  AI SF  VVN I   Q +E+K+K R +   K
Sbjct  640  LPDNKEPAEIFLDQWKLALDRVPDTVASVAIKSFINVVNVISAKQTEEIKIKKRTESASK  699

Query  444  ELEKRTRKF----EDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQ  298
            E EK++       + +Y+ Y        DT   GP ++ +++       E++++L A ++
Sbjct  700  EFEKKSASIMNLEKKFYNSYSMVGIGLPDT---GPADNGHILDARDPLAEKKIELVACQR  756

Query  297  RLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            R++EE+  + +     R  +L +L+TGLP +F A++ FS   ++  + LES+
Sbjct  757  RVEEEKIKHSKAVEVTRAMTLNNLQTGLPGVFQALTSFS---ALFTEALESV  805



>ref|XP_010935104.1| PREDICTED: uncharacterized protein LOC105055091 [Elaeis guineensis]
Length=565

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/221 (33%), Positives = 114/221 (52%), Gaps = 13/221 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            T+  H + + QL + V  W+S F  ++  Q+EYI  L  WL+L+L   D NL       +
Sbjct  339  TTNIHRQASLQLELEVDHWYSAFCNLVKSQREYIHALTGWLRLSLFQCDHNLL-----GE  393

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q+  I +L   WQ  + ++PD++A   I SF  V++ +V  Q +E K K + +   KE
Sbjct  394  TQQSSDIYSLCEEWQLALDRIPDKVASEGIKSFLTVIHAVVLQQAEEQKQKRKSEMVFKE  453

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPH-EDNNVIERQLQLEALKQRLKEEEEAYMR  265
            LEKR  +      KY     P   TE  G     + V+E++ ++EALK + +EE+  Y +
Sbjct  454  LEKRAEELRALESKY----GPYCVTEGYGVMVRASPVMEKRAKVEALKMKAEEEKSKYEK  509

Query  264  QCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                 R  +L +L+TG P +F AM+ F+  C    Q  ES+
Sbjct  510  SVAVTRAMTLNNLQTGFPNVFQAMTGFAGVC---MQAFESV  547



>gb|EYU30808.1| hypothetical protein MIMGU_mgv1a0195871mg, partial [Erythranthe 
guttata]
Length=266

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 116/223 (52%), Gaps = 11/223 (5%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNL---VPIDTNLKEKVS  631
            TSE H + T QL +  Q+WH  F  +I  Q++YI+ L  WL+L+L     ++TN    V+
Sbjct  34   TSEIHRQATLQLELEAQQWHLSFCTLIKSQRDYIQSLTGWLRLSLFQVASVNTN-HNPVN  92

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
              +  Q+  I +    WQ  I   PD++A   I SF  V++ IV  Q +E K K R    
Sbjct  93   IRKTKQDSAIYSFCEEWQLAINNSPDKVASEGIKSFLTVIHAIVMQQAEEQKQKRRADSV  152

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             K+L+K+  +     +K+     P    E  G  + + V +++ ++EAL+ + ++E+  Y
Sbjct  153  FKDLDKKAGELRSLENKHGPYFVP----EGSGETKKDPVRDKRAKVEALRAKAEDEKAKY  208

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             +     R  ++ +L+ GLP +F AM+ F+  C+   Q  ES+
Sbjct  209  EKAVSVTRAMTMNNLQMGLPHVFQAMTGFANVCA---QAFESV  248



>ref|XP_006856770.1| hypothetical protein AMTR_s00055p00070380 [Amborella trichopoda]
 gb|ERN18237.1| hypothetical protein AMTR_s00055p00070380 [Amborella trichopoda]
Length=665

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 116/230 (50%), Gaps = 28/230 (12%)
 Frame = -1

Query  810  PKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT--NLKEK  637
            P+ TS  H + T QL V VQ+WHS F  ++   ++YI  L+ W+ L L   D    L +K
Sbjct  434  PQPTSPSHRQATLQLEVQVQKWHSSFCTLVQTHRDYIHSLSSWVGLTLSSSDPRHTLHQK  493

Query  636  VSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCK  457
            +      Q+PPI +L   WQ  + +LPD +A   I SF AVV  I   Q +E + K R +
Sbjct  494  LH-----QDPPIRSLCEEWQLALDRLPDRVASEGIKSFLAVVQAISLQQGEEHRQKKRLE  548

Query  456  DTRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNN-----VIERQLQLEALKQRL  292
               K LEK+         KY             GP++ +      V E++ + EAL+ R+
Sbjct  549  SASKALEKKVCALRALECKY-------------GPYDAHGLGLERVAEKRAKAEALRCRM  595

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +EE++ Y +     R  ++ +L+TG P +F A++ FS  C    Q LE++
Sbjct  596  EEEKDKYDKCVRVTRAMTVNNLQTGFPNVFQAVTGFSGVC---MQALEAV  642



>ref|XP_011099873.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105178172 
[Sesamum indicum]
Length=623

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 111/217 (51%), Gaps = 9/217 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL +  Q+WH  F  ++  Q++YI+ L  WL+L+L  +  N   K     
Sbjct  398  TSEIHRQSTLQLELEAQQWHLSFCNLMKAQRDYIQSLTGWLRLSLFQVGNNPISKTK---  454

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q+  I +    WQ  I   PD++A   I SF ++++ IV  Q +E K K R +   KE
Sbjct  455  --QDSAIYSFCEEWQLTINNAPDKVASEGIKSFLSMIHAIVVQQAEEQKQKRRSESVFKE  512

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+  +      K+     P    E  G    + V E++ ++EAL+ R ++E+  Y + 
Sbjct  513  LEKKAGELRSLESKHGPYSMP----EASGETNKDPVREKRAKVEALRARAEDEKAKYEKS  568

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
                R  ++ +L+ GLP +F AM+ F+  C+  + ++
Sbjct  569  ISVTRAMTMNNLQMGLPHVFQAMTGFANVCTQAFDSV  605



>emb|CDP09433.1| unnamed protein product [Coffea canephora]
Length=813

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/233 (31%), Positives = 121/233 (52%), Gaps = 22/233 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H + T  L   V  WHS F +++  Q+E+IR L++W KL  +P        VSS Q
Sbjct  587  TSDLHKQATRDLESAVSAWHSSFCRLMKFQREFIRSLHEWFKLTFLP--------VSSEQ  638

Query  621  RPQN---PPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
               N     + A    W+  + ++PD +A  A+ SF  VVN+I   Q +E+K+K R +  
Sbjct  639  TNGNREHSEVFAFCDEWKLALDRIPDTVASEAVKSFINVVNSISLKQREELKIKGRAESV  698

Query  450  RKELEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRL  292
             +ELEK+     +    +Y+ Y        DT  D  H     + + E++L+L A ++R+
Sbjct  699  SRELEKKASSLRNIEKKYYNSYSMVGIGLPDTGPDNGHALDARDPLAEKKLELAACQRRV  758

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI-TH  136
             +E   + +     R  +L +++TGLP +F AM+ FS   +++   LE++ TH
Sbjct  759  ADEMLKHSKAVEVTRSHTLNNIQTGLPGVFQAMTSFS---AMIAGALEAVCTH  808



>gb|KGN46505.1| hypothetical protein Csa_6G104620 [Cucumis sativus]
Length=815

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 125/235 (53%), Gaps = 32/235 (14%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPID----TNLKEKV  634
            TSE H + T  L  +V  WHS F ++I   +++IR L+ WLKL+ +P++    T+ KE  
Sbjct  590  TSELHRQATRDLESMVTAWHSSFCRLIKFHRDFIRSLHGWLKLSYIPVNNDSLTDNKE--  647

Query  633  SSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKD  454
                     P    L  W+  + ++PD +A  AI SF  VVN I   Q +E+K+K R + 
Sbjct  648  ---------PAEIFLDQWKLALDRVPDTVASVAIKSFINVVNVISAKQTEEIKIKKRTES  698

Query  453  TRKELEKRTRKF----EDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEA  307
              KE EK++       + +Y+ Y        DT   GP ++ +++       E++++L A
Sbjct  699  ASKEFEKKSASIMHLEKKFYNSYSMVGIGLPDT---GPADNGHILDARDPLAEKKIELVA  755

Query  306  LKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             ++R++EE+  + +     R  +L +L+TGLP +F A++ FS   ++  + LES+
Sbjct  756  CQRRVEEEKIKHSKAVEVTRAMTLNNLQTGLPGVFQALTSFS---ALFTEALESV  807



>gb|KJB22870.1| hypothetical protein B456_004G070400 [Gossypium raimondii]
Length=820

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 118/227 (52%), Gaps = 15/227 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ W KL+L+P+  +  +  + P 
Sbjct  594  TSELHRQATRDLESAVTAWHSSFCRLIKFQRDFICSLHGWFKLSLLPLSNDNVDGNADPS  653

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
                  + A    W+  + ++PD +A   I SF  VV  I   Q +E+K+K R ++  KE
Sbjct  654  -----GVYAFCDEWKLALERVPDTVASEGIKSFINVVRVISAKQTEELKIKKRTENASKE  708

Query  441  LEKRTRKFED----WYHKY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y M    P D     GP  D  + + E++ +L A ++R+++E
Sbjct  709  LEKKASSLRNIERKFYHSYSMVGIGPPDSGSDHGPVLDARDPLSEKKSELAACQRRVEDE  768

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
               + +     R  +L +L+TGLP +F A++ FS    +  + L+S+
Sbjct  769  MMRHAKAVEVTRAMTLNNLQTGLPGVFRALTSFS---GVFTEALDSV  812



>ref|XP_006445430.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
 gb|ESR58670.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
Length=785

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 117/227 (52%), Gaps = 15/227 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H + T  L   +  WHS F ++I  Q++++R L+ W KL L+P+     + +S  +
Sbjct  559  TSDMHRQATRNLESAITAWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVSN---DNMSGKR  615

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
             P    +      W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  616  EPSE--VYGFFDEWKLALERVPDTVASEAIKSFINVVHVISVKQTEELKIKKRTETASKE  673

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        D   D  H     + + E++L+L A ++R+++E
Sbjct  674  LEKKASSLRNIERKFYHSYSMVGIGLPDPGPDNGHVLDARDPLAEKKLELAACQRRVEDE  733

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
               + R     R  +L +L+TGLP +F A++ FS   ++  + LE +
Sbjct  734  LLRHSRAVEVTRANTLNNLQTGLPGVFQALTSFS---TLFTEALEMV  777



>ref|XP_007139641.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
 gb|ESW11635.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
Length=818

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 119/226 (53%), Gaps = 14/226 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+E+I  L+ W KL+L+PI+    + +++ +
Sbjct  593  TSELHRQATRDLEAAVSAWHSSFCRLIKFQREFIFSLHGWFKLSLLPIN---NDNINNSR  649

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
               N         W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R + T KE
Sbjct  650  --DNSDTYHFFDEWKLALDRVPDTVASEAIKSFINVVHVISAKQTEELKIKKRTETTSKE  707

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEE  280
            LEK+     +    +Y  Y        DT  DG   D  + + E++L L   ++R+++E 
Sbjct  708  LEKKASSLRNLERKYYSSYSMVGISLPDTAPDGQGLDARDPLAEKKLDLATCQRRVEDEM  767

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
              + +     R  +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  768  LRHSKAVELTRAMTLNNLQTGLPGVFQALTSFS---SLFTEALESV  810



>ref|XP_006464424.1| PREDICTED: uncharacterized protein LOC102627291 [Citrus sinensis]
Length=769

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 111/214 (52%), Gaps = 12/214 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H + T  L   +  WHS F ++I  Q++++R L+ W KL L+P+     + +S  +
Sbjct  543  TSDMHRQATRNLESAITAWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVSN---DNMSGKR  599

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
             P    +      W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  600  EPSE--VYGFFDEWKLALERVPDTVASEAIKSFINVVHVISVKQTEELKIKKRTETASKE  657

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        D   D  H     + + E++L+L A ++R+++E
Sbjct  658  LEKKASSLRNIERKFYHSYSMVGIGLPDPGPDNGHVLDARDPLAEKKLELAACQRRVEDE  717

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
               + R     R  +L +L+TGLP +F A++ FS
Sbjct  718  LLRHSRAVEVTRANTLNNLQTGLPGVFQALTSFS  751



>gb|KDO85511.1| hypothetical protein CISIN_1g040600mg [Citrus sinensis]
Length=754

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 111/214 (52%), Gaps = 12/214 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H + T  L   +  WHS F ++I  Q++++R L+ W KL L+P+     + +S  +
Sbjct  528  TSDMHRQATRNLESAITAWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVSN---DNMSGKR  584

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
             P    +      W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  585  EPSE--VYGFFDEWKLALERVPDTVASEAIKSFINVVHVISVKQTEELKIKKRTETASKE  642

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        D   D  H     + + E++L+L A ++R+++E
Sbjct  643  LEKKASSLRNIERKFYHSYSMVGIGLPDPGPDNGHVLDARDPLAEKKLELAACQRRVEDE  702

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
               + R     R  +L +L+TGLP +F A++ FS
Sbjct  703  LLRHSRAVEVTRANTLNNLQTGLPGVFQALTSFS  736



>ref|XP_010679893.1| PREDICTED: uncharacterized protein LOC104895159 [Beta vulgaris 
subsp. vulgaris]
Length=673

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 119/229 (52%), Gaps = 12/229 (5%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSP-  625
            TSE H + T QL V +Q+WH  F  ++  Q++YIR L  WL+L+L   + N       P 
Sbjct  446  TSEIHRQSTLQLEVELQQWHQSFCNLVKAQRDYIRSLTGWLRLSLFQFNKN-------PL  498

Query  624  -QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
             +  Q+  I +L   WQ  I  +PD++A   I S   V++ IV  Q +E+K K R +   
Sbjct  499  MRSMQDSTIYSLCEQWQLEIDNVPDKVASEGIKSLWTVIHAIVVQQAEELKQKKRSEVAN  558

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            K+LEKR  +      KY     P   + + G    + V E++ +++ LK + +EE+  + 
Sbjct  559  KQLEKRAVELRSLEVKYGPYSKPEISSSRKG---GDPVGEKRAKVDMLKVKAEEEKAKHE  615

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRE  121
            +     R  +L +++ GLP +F AM+ FS  C   ++ + + T  +++E
Sbjct  616  KSVSATRAMTLNNMQMGLPHVFQAMTGFSSVCKQAFEKVYNETKNMDQE  664



>ref|XP_010919721.1| PREDICTED: uncharacterized protein LOC105043738 [Elaeis guineensis]
Length=759

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/232 (30%), Positives = 120/232 (52%), Gaps = 21/232 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H   T  L   V  WHS F ++I +Q++YIR L  WL+L L  + ++      +PQ
Sbjct  529  TSDLHRLATRDLEAAVSAWHSSFNRLIKYQRDYIRALYSWLRLTLYQVSSD------NPQ  582

Query  621  RPQNPPI----LALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKD  454
            +  + PI     A    W+  + +LPD +A  AI SF  V++ I   Q +E+K+K R + 
Sbjct  583  KDHSSPISLELTAFCDEWKQALDRLPDTVASEAIKSFMNVIHVIYTKQAEELKIKKRTEA  642

Query  453  TRKELEKRTRKFEDWYHKYMQRRT------PNDDTEQDGPHEDNN--VIERQLQLEALKQ  298
              KELEK++        KY Q  +      P    +  G   D+   + E++ ++ A ++
Sbjct  643  LSKELEKKSASLRSIEKKYYQSYSMVGIGLPGGGRDNGGQVFDSRDPLAEKKSEIAACRR  702

Query  297  RLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            R+++E   + +     R  +L +++TGLP +F AM+ FS   ++  + LE++
Sbjct  703  RVEDEMMRHAKAVEVTRSMTLNNIQTGLPGVFQAMTGFS---NLFVEALEAV  751



>gb|ABP88223.1| transcription factor bZIP54 [Glycine max]
Length=118

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -1

Query  549  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRKFEDWYHKYMQRRTP---  379
            LA+TAI    AV+ TI     +E+ LK +C+DTRKEL ++TR+FEDWY+KYMQ++ P   
Sbjct  1    LARTAIGXXVAVIETIYHQXXEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQKKIPDEY  60

Query  378  NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKS  238
            N D  +D    D  V+ RQ  +E +K+RL++EEEAY RQC+QVR K+
Sbjct  61   NPDRAEDANAPD-EVVTRQSAVEQVKKRLEDEEEAYARQCLQVRQKN  106



>ref|NP_171713.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD95352.1| bZIP-like protein [Arabidopsis thaliana]
 gb|AEE27385.1| uncharacterized protein AT1G02110 [Arabidopsis thaliana]
Length=703

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 120/230 (52%), Gaps = 16/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+E+I  L+ W KL+LVP+     +K     
Sbjct  485  TSEVHRQVTRDLESAVSLWHSSFCRIIKFQREFICSLHAWFKLSLVPLSNGDPKK-----  539

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q P   AL   W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  540  --QRPDSFALCEEWKQSLERVPDTVASEAIKSFVNVVHVISIKQAEEVKMKKRTESAGKE  597

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEE  277
            LEK+         KY Q  +    T   GP  +     + + E++ +L A ++++++E  
Sbjct  598  LEKKASSLRSIERKYYQAYS----TVGIGPGPEVLDSRDPLSEKKCELAACQRQVEDEVM  653

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             +++     R  +L +L+TGLP +F A++ FS   +   QT+ S ++ +N
Sbjct  654  RHVKAVEVTRAMTLNNLQTGLPNVFQALTSFSSLFTESLQTVCSRSYSIN  703



>ref|XP_011089387.1| PREDICTED: uncharacterized protein LOC105170351 [Sesamum indicum]
Length=828

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 122/232 (53%), Gaps = 21/232 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPID---TNLKEKVS  631
            TS+ H + T  L   V  WHS F ++I  Q++++R L+ W KL L+P++   TN   ++S
Sbjct  603  TSDLHRQATRDLESAVSAWHSSFCRLIKFQRDFVRSLHGWFKLTLIPVNSEPTNGNRELS  662

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
                     +      W+  + ++PD +A  AI SF  VV++I   Q++E+K+K R +  
Sbjct  663  E--------VFTFCDEWKLALDRIPDTVASEAIKSFINVVHSISLKQIEELKIKKRTETA  714

Query  450  RKELEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRL  292
             KELEK+     +    +YH Y        DT  D  H     + + +++ +L   ++R+
Sbjct  715  SKELEKKASSLRNIEKKYYHSYSMVGIGLPDTGPDNGHALDARDPLADKKAELATCQRRV  774

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            ++E   + +     R  +L +++TGLP +F AM+ FS   +++ + LE++ +
Sbjct  775  EDEMLKHAKAVEVTRAMTLNNIQTGLPGVFQAMTSFS---ALITEALETVCY  823



>ref|XP_010089322.1| hypothetical protein L484_021854 [Morus notabilis]
 gb|EXB37647.1| hypothetical protein L484_021854 [Morus notabilis]
Length=851

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 118/227 (52%), Gaps = 13/227 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q++++R L+ W KL L+P+D +     S+ +
Sbjct  623  TSELHRQATRDLESAVSAWHSSFCRLIKFQRDFVRSLHGWFKLTLLPVDNDNVNMNSNRE  682

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     + A    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  683  RSD---VYAFCDEWKLALERVPDTVASEAIKSFINVVHVISFKQSEELKVKKRTESASKE  739

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRLKEE  283
            LEK+         K+ Q  +       D   ++  V+       E++ +L A ++R+++E
Sbjct  740  LEKKASSIRTLERKFYQSYSMVGIGLPDAGPDNGQVLDARDPLAEKKTELAACQRRVEDE  799

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
               + +     R  +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  800  MMRHAKAVEVTRAMTLNNLQTGLPGVFQALTSFS---SLFTEALESV  843



>ref|XP_004492935.1| PREDICTED: uncharacterized protein LOC101510124 [Cicer arietinum]
Length=859

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/231 (32%), Positives = 118/231 (51%), Gaps = 17/231 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSP  625
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ W KL+L+P+D  N+      P
Sbjct  632  TSELHRQATRDLESAVSAWHSSFCRLIKFQRDFILSLHGWFKLSLIPVDNDNINNHSREP  691

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
                          W+  + ++PD +A  AI SF  VV+ I   Q DE+K+K R ++  K
Sbjct  692  S-----DAYVFFDDWKLALDRVPDTVASEAIKSFINVVHVISCKQADELKIKKRTENASK  746

Query  444  ELEKRTRKFED----WYHKYMQRRTPNDDTEQD---GPHEDNNVIERQLQLEALKQRLKE  286
            ELEK+     +    +Y  Y        DT  D   G    + + E++L+L   ++R+++
Sbjct  747  ELEKKASSVRNIERKFYSSYSLVGIGLPDTAPDNGQGLDARDPLAEKKLELATCQRRVED  806

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI-TH  136
            E   + +     R  +L +L+TGLP +F A++ FS   S+  + LES+ TH
Sbjct  807  EMLRHSKAVEATRAMTLNNLQTGLPGVFQALTSFS---SLFAEALESVCTH  854



>ref|XP_008813601.1| PREDICTED: uncharacterized protein LOC103724193 [Phoenix dactylifera]
Length=760

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 118/232 (51%), Gaps = 21/232 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H   T  L   V  WHS F +++ +Q++Y+R L  WL+L L  + ++      +PQ
Sbjct  530  TSDLHRLATRDLEAAVSAWHSSFNRLVKYQRDYVRALYSWLRLTLYQVSSD------NPQ  583

Query  621  RPQNPPI----LALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKD  454
            +  + PI     A    W+  + +LPD +A  AI SF  V++ I   Q +E+K+K R + 
Sbjct  584  KDHSSPISLELTAFCDEWKQALDRLPDTVASEAIKSFMNVIHVIYTKQAEELKIKKRAEA  643

Query  453  TRKELEKRTRKFEDWYHKYMQRRT------PNDDTEQDGPHEDNN--VIERQLQLEALKQ  298
              KELEK++        KY Q  +      P    + DG   D    + E++ ++ A ++
Sbjct  644  FSKELEKKSASLRSIEKKYYQSYSMVGMALPGSGHDNDGQVFDTRDPLAEKKSEIAACRR  703

Query  297  RLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            ++++E   + +     R  +L +++TGLP +F AM+ FS    +  Q LE +
Sbjct  704  KVEDEMMRHAKAVEVTRSMTLNNIQTGLPGVFQAMTGFS---DLFVQNLEVV  752



>gb|EYU42344.1| hypothetical protein MIMGU_mgv1a020945mg [Erythranthe guttata]
Length=792

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 119/225 (53%), Gaps = 10/225 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H + T  L   V  WHS F + I   +++IR L+ WLKL +VP+++    +    Q
Sbjct  566  TSDFHRQATRDLESAVSTWHSSFCRTIKFHRDFIRSLHGWLKLTVVPVNSTESTRTERSQ  625

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              ++  + A L  W+ ++ ++PD +A  AI SF  VV +I   Q +E+K+K R +   ++
Sbjct  626  VAES--VFAFLDEWKLVLDRVPDTVASEAIKSFENVVRSISSKQTEEIKIKKRAESAARD  683

Query  441  LEKRTRKFEDWYHKYMQRRT-----PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            LEKR     +   KY Q  +     P  D         + + E++ ++   ++R++EE  
Sbjct  684  LEKRASSLRNIERKYYQSYSMVGVGPPPDVGPAVLDGRDPLAEKKAEMVTWRRRVEEEMV  743

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             + +     R  +L +++TGLP +F A++ FS   +++ + L+S+
Sbjct  744  KHTKAVEVTRAMTLNNIQTGLPGVFQAVTGFS---ALITEALDSV  785



>ref|XP_002511585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50254.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 119/230 (52%), Gaps = 17/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI-DTNLKEKVSSP  625
            TSE H + T  L   V  WHS F ++I  Q+++IR ++ W KL L+P+ D N+   V   
Sbjct  583  TSELHKQATRDLESAVSAWHSSFCRLIKFQRDFIRSVHGWFKLTLLPVSDGNVNSNV---  639

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
               ++  + A    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   K
Sbjct  640  ---EHSDVYAFCDEWKLTLDRVPDTVASEAIKSFINVVHVISLKQNEELKIKKRTETASK  696

Query  444  ELEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKE  286
            ELEK+     +    +YH Y        DT  D        + + E++ +L A ++R+++
Sbjct  697  ELEKKASSLRNIERKFYHSYSMVGIGMPDTGADNGQVLDARDPLAEKKSELAACQRRVED  756

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            E   + +     R  +L +L+TGLP +F A++ FS   S+  + LE + +
Sbjct  757  EMLRHAKAVEVTRAMTLNNLQTGLPGVFQALTSFS---SLFTEALELVCN  803



>ref|XP_006306896.1| hypothetical protein CARUB_v10008455mg, partial [Capsella rubella]
 gb|EOA39794.1| hypothetical protein CARUB_v10008455mg, partial [Capsella rubella]
Length=711

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 119/230 (52%), Gaps = 16/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+E+I  L+ W KL+LV +     +K     
Sbjct  492  TSEVHRQVTRDLESAVSLWHSSFCRIIKFQREFICSLHAWFKLSLVSLSNEDPKK-----  546

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q P   AL   W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  547  --QRPDSFALCEEWKQSLERVPDTVASEAIKSFVNVVHVISIKQAEEVKMKKRTESAGKE  604

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEE  277
            LEK+         KY Q  +    T   GP  +     + + E++ +L A +++++EE  
Sbjct  605  LEKKASSLRSIERKYYQAYS----TVGIGPGPEVLDARDPLSEKKCELAACQRQVEEEVM  660

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             +++     R  +L +L+TGLP +F A++ FS   +   QT+ S ++ +N
Sbjct  661  RHVKAVEVTRAMTLNNLQTGLPNVFQALTSFSSLFTECLQTVCSSSYSIN  710



>gb|EPS68751.1| hypothetical protein M569_06016 [Genlisea aurea]
Length=816

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 122/232 (53%), Gaps = 13/232 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H   T  L   V EWHS F ++I  Q+++IR L+ W KL ++P+++     ++S  
Sbjct  583  TSDLHRRATSYLESAVSEWHSSFCRLIKFQRDFIRSLHGWFKLTVLPVNSEQMMTMNSNG  642

Query  621  RP-QNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
            R  Q   +   +  W+  + ++PD +A  AI SF  VV++I   Q +E+K++ R +   K
Sbjct  643  REVQLGEVFGFIDEWKLALDRVPDTVASEAIKSFINVVHSISAKQAEELKIRKRTESVSK  702

Query  444  ELEKRTRKFEDWYHKYMQRRT------PNDDTEQDGPH---EDNNVIERQLQLEALKQRL  292
            ELE++         KY    +      P+   + DG H     + + E++ +L   ++R+
Sbjct  703  ELERKASSLRSIEKKYYLSYSTVGIGLPDPGPDHDGGHALDARDPLAEKKAELATCQRRV  762

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH  136
            +EE   + +     R  +L +L+TGLP +F AM+ FS    ++ + L+++ +
Sbjct  763  EEEMVRHSKAVEVTRAMTLNNLQTGLPGVFQAMTGFS---GLITEALQAVCN  811



>gb|KDP28858.1| hypothetical protein JCGZ_14629 [Jatropha curcas]
Length=810

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 115/225 (51%), Gaps = 14/225 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F  +I  Q+++IR ++ W KL L+P+  N    VS   
Sbjct  583  TSELHRQATRDLESAVSAWHSSFCHLIKFQRDFIRSVHGWFKLTLLPVSNNDNVNVS---  639

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              ++  + A    W+  + ++PD +A  AI SF  +V+ I   Q +E+K+K R +   KE
Sbjct  640  -VEHSDVYAFCDEWKLALDRVPDTVASEAIKSFINIVHAISGKQTEELKIKKRTESASKE  698

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        DT  D  H     + + E++ +L + ++++++E
Sbjct  699  LEKKASSLRNIERKFYHSYSMVGIGLPDTGPDNGHALDARDPLAEKKSELASCQRKVEDE  758

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  148
               + +     R  +L  L+TGLP +F A++ FS   S+  + LE
Sbjct  759  MLRHAKAVEVTRAMTLNHLQTGLPGVFQALTSFS---SLFMEALE  800



>ref|XP_009383946.1| PREDICTED: uncharacterized protein LOC103971612 [Musa acuminata 
subsp. malaccensis]
Length=772

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 121/232 (52%), Gaps = 21/232 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H   T  L   V  WHS F ++I +Q++Y+  L  WLKL L+ + ++      +PQ
Sbjct  543  TSDLHRLATRDLEAAVSAWHSSFNRLIKYQRDYVHALYGWLKLTLLQVSSD------NPQ  596

Query  621  RPQNPPILALLHA----WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKD  454
            +  + P+   L A    W+  + +LPD +A  A+ SF  V++ I   Q++E+K+K R + 
Sbjct  597  KDHSSPVAVELTAFCDEWKQALDRLPDTVASEAVKSFMNVIHVIYTKQVEELKIKKRAET  656

Query  453  TRKELEKRTRKFEDWYHKYMQRRT------PNDDTEQDGPHEDNN--VIERQLQLEALKQ  298
              KELEK++    +   KY Q  +      P    + DG   D    + E++ ++ A ++
Sbjct  657  YSKELEKKSTALRNTEKKYYQSYSMVGLALPGGGHDNDGQVFDTRDPLAEKKSEIAACRR  716

Query  297  RLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            ++++E   + +     R  +L +++TGLP +F A++ FS    +  + LE +
Sbjct  717  KVEDEMMRHAKAVEVTRSMTLNNIQTGLPGVFQALTGFS---GMFVEALEGV  765



>gb|KHN40553.1| hypothetical protein glysoja_001051 [Glycine soja]
Length=259

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/230 (30%), Positives = 118/230 (51%), Gaps = 22/230 (10%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI---DTNLKEKVS  631
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ W KL+LVP+   + N +E   
Sbjct  34   TSELHRQATRDLESAVSAWHSSFCRLIKFQRDFILSLHGWFKLSLVPVHNDNINSRETSD  93

Query  630  SPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDT  451
            + Q             W+  + ++PD +A  AI SF  VV+ I   Q++E+K+K R +  
Sbjct  94   TYQ---------FFDEWKLALDRVPDTVASEAIKSFINVVHVISSKQVEELKIKKRTETA  144

Query  450  RKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRL  292
             KELEK+     +   K+    +    +  D   ++  V+       E++L+L   ++R+
Sbjct  145  SKELEKKASSLRNLERKFYSSYSMVGISLPDSAPDNGQVLDARDPLAEKKLELATCQRRV  204

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            ++E   + +     R  +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  205  EDEMLRHSKAVEVTRAMTLNNLQTGLPGVFQALTSFS---SLFTEALESV  251



>ref|NP_190697.2| protein ALTERED PHOSPHATE STARVATION RESPONSE 1 [Arabidopsis 
thaliana]
 gb|AEE78774.1| uncharacterized protein AT3G51290 [Arabidopsis thaliana]
Length=634

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 107/220 (49%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  411  TSELHRQSTLQLELEVQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYES  470

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q DE K K R +   K+
Sbjct  471  K-----IYSFCEEWHLAIDRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTESMLKD  525

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK++        KY     P          + N VIE+++++E LK + +EE+  + + 
Sbjct  526  FEKKSASLRALESKYSPYSVPES-------RKKNPVIEKRVKVEMLKGKAEEEKSKHEKS  578

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  579  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  615



>ref|XP_011008835.1| PREDICTED: uncharacterized protein LOC105114109 [Populus euphratica]
Length=637

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 111/220 (50%), Gaps = 14/220 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + V +WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  411  TSEIHRQSTLQLELEVHQWHQSFCNVVKAQRDYIQSLTGWLRLSLFQFSKNPISRTSQES  470

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I +L   W   + ++PD++A   I SF AV++ IV  Q +E K K + +   KE
Sbjct  471  R-----IYSLCEEWHHAVDRIPDKVASEGIKSFLAVIHAIVVQQAEEHKQKKKSESAFKE  525

Query  441  LEKRT---RKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             EK+    R  E  Y  Y    TP+   ++D       V+E++ ++E  + + +EE+  +
Sbjct  526  FEKKAAELRSLESKYGPYSMPETPSTTRKKD------PVMEKRAKVEISRAKAEEEKSKH  579

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
             +     R  ++ +L+ G P +F AM  FS  C   +++L
Sbjct  580  EKSISVTRSMTMNNLQMGFPHVFQAMVGFSSVCMNAFESL  619



>ref|XP_010275436.1| PREDICTED: uncharacterized protein LOC104610494 [Nelumbo nucifera]
Length=756

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 114/215 (53%), Gaps = 8/215 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLN--LVPIDTNLKEKVSS  628
            TSE H + T  L   V  WHS F +++ +Q++YIR L+ WLKL+  LV  D     K +S
Sbjct  524  TSELHRQATRHLESTVSAWHSNFCRLVKYQRDYIRSLHGWLKLSYILVGDDNISGSKDAS  583

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
                 N  +      W+  + +LPD +A  AI SF  VV+ IV  Q +E+K+K R +   
Sbjct  584  LAVQANSDLFTFCDEWKLALDRLPDTVASEAIKSFVNVVHAIVVKQTEEIKIKKRTETAS  643

Query  447  KELEKRTRKFED----WYHKYMQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKE  286
            K+LEK++    +    +Y  Y        +   DG   D  + + E++L+L + ++R+++
Sbjct  644  KDLEKKSLALRNIEKKFYLSYSMVGIAPPEGGSDGHVLDARDPLAEKKLELASCRRRVED  703

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
            E   + +     R  +L +++TGLP +F AM+ FS
Sbjct  704  EMMKHAKAIEVTRAMTLNNIQTGLPGVFQAMTGFS  738



>ref|XP_002990611.1| hypothetical protein SELMODRAFT_10621, partial [Selaginella moellendorffii]
 gb|EFJ08243.1| hypothetical protein SELMODRAFT_10621, partial [Selaginella moellendorffii]
Length=680

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 109/218 (50%), Gaps = 11/218 (5%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS  H + T QL V + EW      ++  QKEY+R LN WL+L++   D          +
Sbjct  474  TSNSHKQATVQLEVALNEWQRGLASLVTKQKEYLRNLNSWLRLSIYTPDR---------K  524

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              + PP+ AL  AW D + +L ++    AI SF+  ++ IV+ Q DE + + R +   KE
Sbjct  525  SDRRPPVQALCQAWTDALERLQEQELVEAIKSFAEKIHNIVRQQEDETRAQKRAESMAKE  584

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            L K++    +   K       N   E+    + + + E++  LEA +QR+ EE + + R 
Sbjct  585  LSKKSLALNNLEKKLAAE--TNTTPEETLKEKRDALQEKRDALEAFRQRVDEERDGFTRA  642

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  148
                R  ++  L   LP +F  ++EFS ACS  Y+ LE
Sbjct  643  MQITRKMTVGILEMDLPVVFSRLAEFSSACSHCYRELE  680



>ref|XP_010258777.1| PREDICTED: uncharacterized protein LOC104598423 [Nelumbo nucifera]
Length=771

 Score =   109 bits (273),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/243 (31%), Positives = 122/243 (50%), Gaps = 26/243 (11%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI--DTNLKEKVSS  628
            TSE H + T  L   V  WHS F ++I +Q++YIR L+ WLKL+L+ +  D+    K +S
Sbjct  524  TSELHRQATRHLESAVSAWHSNFCRLIKYQRDYIRSLHGWLKLSLIHVGNDSTTGSKGAS  583

Query  627  PQR--------------PQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQ  490
                               +  +L L   W+  + +LPD +A  AI SF  VV+ I   Q
Sbjct  584  TAAQTYTTGSKDASVAVQTSSDLLPLCDEWKLALDRLPDTVASEAIKSFVNVVHVIAVKQ  643

Query  489  LDEMKLKDRCKDTRKELEKRTRKFED----WYHKY-MQRRTPNDDTEQDGPHED--NNVI  331
             +E+K K   +   KELEK+     +    +YH Y M    P D    DG   D  + + 
Sbjct  644  TEEIKSKKWAETASKELEKKASALRNIEKKFYHSYSMVGIGPPDGGAADGQVLDARDPLA  703

Query  330  ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            E++L+L + ++R+++E   + +     R  +L +++TGLP +F AM+ FS    +  + L
Sbjct  704  EKKLELASCQRRVEDEMMKHAKAVEVTRAMTLNNIQTGLPGVFQAMTAFS---GLFTEAL  760

Query  150  ESI  142
            E +
Sbjct  761  EGV  763



>ref|XP_002968724.1| hypothetical protein SELMODRAFT_145899 [Selaginella moellendorffii]
 gb|EFJ29840.1| hypothetical protein SELMODRAFT_145899 [Selaginella moellendorffii]
Length=692

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 110/220 (50%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS  H + T QL V + EW      ++  QKEY+R LN WL+L++            +P 
Sbjct  474  TSNSHKQATVQLEVALNEWQRGLASLVTKQKEYLRNLNSWLRLSIY-----------TPD  522

Query  621  RPQN--PPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            R  +  PP+ AL  AW D + +L ++    AI SF+  ++ IV+ Q DE + + R +   
Sbjct  523  RKSDRRPPVQALCQAWTDALERLQEQELVEAIKSFAEKIHNIVRQQEDETRAQKRAESMA  582

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM  268
            KEL K++    +   K       N   E+    + + + E++  LEA +QR+ EE + + 
Sbjct  583  KELSKKSLALNNLEKKLAAE--TNTTPEETLKEKRDALQEKRDALEAFRQRVDEERDGFT  640

Query  267  RQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  148
            R     R  ++  L   LP +F  ++EFS ACS  Y+ LE
Sbjct  641  RAMQITRKMTVGILEMDLPVVFSRLAEFSSACSHCYRELE  680



>ref|XP_008352431.1| PREDICTED: uncharacterized protein LOC103415926 [Malus domestica]
Length=642

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/227 (31%), Positives = 110/227 (48%), Gaps = 9/227 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  ++  Q +YI+ L  WL+L+L     +   K S   
Sbjct  417  TSEIHRQATLQLELQVQQWHLSFCSLVKAQCDYIQSLTGWLRLSLFQFRRHPIAKTSQES  476

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I  L   W   I ++PD++A   I SF  VV+ IV  Q DE K K + + T KE
Sbjct  477  R-----IYTLCEEWHHAIDRIPDKVASEGIKSFLTVVHAIVVQQADEYKQKRKSESTFKE  531

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+         KY     P+  +      + N V E++ ++E ++ + +EE+  + + 
Sbjct  532  LEKKATALRSLESKYGPYSMPDSSSNA----KKNPVAEKRAKVEVIRAKAEEEKSKHEKL  587

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRE  121
                R  ++ +L+ G P +F AM  FS  C   ++ L +     N E
Sbjct  588  VSVTRTMTINNLQMGFPHVFEAMVGFSSVCMQAFEQLYNQAKSANEE  634



>ref|NP_001190052.1| protein ALTERED PHOSPHATE STARVATION RESPONSE 1 [Arabidopsis 
thaliana]
 gb|AEE78775.1| uncharacterized protein AT3G51290 [Arabidopsis thaliana]
Length=798

 Score =   109 bits (273),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 107/220 (49%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  417  TSELHRQSTLQLELEVQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYES  476

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q DE K K R +   K+
Sbjct  477  K-----IYSFCEEWHLAIDRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTESMLKD  531

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK++        KY     P          + N VIE+++++E LK + +EE+  + + 
Sbjct  532  FEKKSASLRALESKYSPYSVPES-------RKKNPVIEKRVKVEMLKGKAEEEKSKHEKS  584

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  585  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  621



>gb|KEH17841.1| BZIP transcription factor bZIP80, putative [Medicago truncatula]
Length=723

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 123/230 (53%), Gaps = 16/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   +  WHS F ++I  Q+++I  L+ W KLNL+P++ +      S +
Sbjct  492  TSESHKQATRDLESALSAWHSSFIRIIKFQRDFILSLHGWFKLNLIPVNNDNNNSSISNK  551

Query  621  -RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
              P +   L+    W+  + ++PD +A  AI SF  VV+ I   Q  E+K+K +     K
Sbjct  552  MEPSDA--LSFCDGWKLALDRVPDTVASEAIKSFINVVHVISVKQCQELKIKRKTDTAYK  609

Query  444  ELEKRT-------RKFEDWYHKYMQRRTPN--DDTEQDGPHEDNNVIERQLQLEALKQRL  292
            EL K++       +KF + Y      + PN  +D  Q G    + + E++L+LEA ++R+
Sbjct  610  ELVKKSSSLKNIEKKFYNSYSMVGIGKIPNSVEDIGQ-GLDARDPLAEKKLELEACQRRV  668

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             +E+  + +     R  +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  669  DDEKLKHSKAIEVTRAMTLNNLQTGLPGMFQALTSFS---SLFIEALESV  715



>ref|XP_006425413.1| hypothetical protein CICLE_v10025182mg [Citrus clementina]
 gb|ESR38653.1| hypothetical protein CICLE_v10025182mg [Citrus clementina]
Length=615

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 112/223 (50%), Gaps = 21/223 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+W   F  ++  Q++Y++ L  WL+L+L    T+   + +   
Sbjct  393  TSEIHRQATLQLELQVQQWLQSFSSLVKAQQDYVQSLTGWLRLSLFQFSTSPLSRTT---  449

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q   I +L   WQ  + ++PD++A   I SF AVV+ IV  Q DE K K + + + KE
Sbjct  450  --QESGIYSLCEEWQQAVERIPDKVASEGIKSFLAVVHAIVVQQSDEHKQKKKAESSFKE  507

Query  441  LEKRT---RKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             EK+    R  E  Y  +  R +   D           V E+++++E L+ + +EE+  +
Sbjct  508  YEKKAAELRSLESKYGPFSMRESFGKDP----------VGEKRVKVEMLRTKAEEEKTKH  557

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             +     R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  558  EKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  597



>ref|XP_006660902.1| PREDICTED: uncharacterized protein LOC102703332 [Oryza brachyantha]
Length=392

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 108/222 (49%), Gaps = 17/222 (8%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS  H +   QL + V  W+S F  ++  Q++Y+  L  WL+L+L        +    P 
Sbjct  166  TSNVHRQAALQLEIEVDRWYSAFCSLVKSQRDYVYSLTGWLRLSLF-------QSYHDPH  218

Query  621  RP--QNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
                QN  I +L   WQ  I ++PD++A   I +   V++ +V  Q +E K K R +   
Sbjct  219  SKGHQNSDIYSLCEEWQLAIDRIPDKVASEGIKTLLTVIHAVVVQQAEEQKQKKRSESAF  278

Query  447  KELEKRT---RKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE  277
            KELEK+T   R  E  Y  Y        D  +  P     V +++ ++EAL+ R  EE+ 
Sbjct  279  KELEKKTEELRSLESKYGPYSGAEGGFGDMSRKSP-----VSDKRAKVEALRCRADEEKS  333

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
             Y +     R  +L +L+TG P +F AM+ F+  C   ++++
Sbjct  334  KYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESV  375



>gb|KFK35242.1| hypothetical protein AALP_AA5G258900 [Arabis alpina]
Length=783

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/226 (30%), Positives = 117/226 (52%), Gaps = 14/226 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+++I+ ++ W KL L+P+     E  ++ Q
Sbjct  558  TSELHRQATRDLESTVSSWHSSFSRLIKFQRDFIQSVHAWFKLTLLPV---CHEDAAANQ  614

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              +     A    W+  + ++PD +A  AI SF  VV+ I   Q DE K+K R +   KE
Sbjct  615  LKEPLDAFAFCDEWKLALDRVPDTVASEAIKSFINVVHVISAKQADEHKIKKRTESASKE  674

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDN------NVIERQLQLEALKQRLKEEE  280
            LEK+     +   KY Q  +        GPH  N       + +++ +L A ++R++EE 
Sbjct  675  LEKKASSVRNLERKYYQSYSMVG--VDSGPHNQNILDARDPLSDKKSELAACQRRVEEEM  732

Query  279  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
              + +     R  +L +L+TGLP +F A++ FS   ++  ++L+++
Sbjct  733  VKHSKAIDVTRAMTLNNLQTGLPGVFQALTSFS---ALFMESLQTV  775



>ref|XP_010426683.1| PREDICTED: uncharacterized protein LOC104711671 isoform X2 [Camelina 
sativa]
Length=643

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 107/220 (49%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + +Q+WH  F  ++  Q++YI+ L  WL+L+L     N   K S   
Sbjct  420  TSELHRQSTLQLELEIQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVKSSYES  479

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q DE K K R +   K+
Sbjct  480  K-----IYSFCEEWHLAIDRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKD  534

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK++        KY     P          + N V+E+++++E LK + +EE+  + + 
Sbjct  535  FEKKSAALRALESKYSPYSVPES-------RKTNPVVEKRVKVEMLKGKAEEEKSKHEKS  587

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  588  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  624



>ref|XP_006466986.1| PREDICTED: uncharacterized protein LOC102630487 [Citrus sinensis]
Length=615

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/223 (31%), Positives = 112/223 (50%), Gaps = 21/223 (9%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+W   F  ++  Q++Y++ L  WL+L+L    T+   + +   
Sbjct  393  TSEIHRQATLQLELQVQQWLQSFSSLVKAQQDYVQSLTGWLRLSLFQFSTSPLSRTT---  449

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q   I +L   WQ  + ++PD++A   I SF AVV+ IV  Q DE K K + + + KE
Sbjct  450  --QESGIYSLCEEWQQAVERIPDKVASEGIKSFLAVVHAIVVQQSDEHKQKKKAESSFKE  507

Query  441  LEKRT---RKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             EK+    R  E  Y  +  R +   D           V E+++++E L+ + +EE+  +
Sbjct  508  YEKKAAELRSLESKYGPFSMRESFGKDP----------VGEKRVKVEMLRTKAEEEKTKH  557

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
             +     R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  558  EKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  597



>ref|XP_009398488.1| PREDICTED: uncharacterized protein LOC103983064 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009398489.1| PREDICTED: uncharacterized protein LOC103983064 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=758

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 120/230 (52%), Gaps = 17/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSP  625
            TS+ H   T  L   +  WHS F+++I +Q++Y+  L  WLKL L+ +   N++E  SSP
Sbjct  529  TSDLHRLATRDLEAAISAWHSSFDRLIKYQRDYVNALYGWLKLTLLRVGGDNIQEDHSSP  588

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
                    L     W+  + +LPD++A  AI SF +V++ I   Q +E+K+K R +   K
Sbjct  589  L----SIALTAFCEWKQALDRLPDKVASEAIKSFMSVIHVICTKQAEELKIKKRAETYSK  644

Query  444  ELEKRTRKFEDWYHKYMQRRT------PNDDTEQDGP---HEDNNVIERQLQLEALKQRL  292
            ELEK++        KY Q  +      P    E  G       + + E++L++ A ++++
Sbjct  645  ELEKKSTSLRSIEKKYYQSYSTVGIGLPGGGIENKGHVLFDARDPLAEKKLEIAACRRKV  704

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            ++E   + +     R  +L +++TGLP +F A++ FS    +  + LE++
Sbjct  705  EDEMVKHAKAVEVTRSMTLNNIQTGLPGVFQAITGFS---GLFVEVLEAV  751



>ref|XP_009133690.1| PREDICTED: uncharacterized protein LOC103858146 [Brassica rapa]
Length=802

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/226 (32%), Positives = 112/226 (50%), Gaps = 16/226 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPI--DTNLKEKVSS  628
            TSE H + T  L   V  WHS F ++I  Q+E+IR +  W KL L+P+  D N       
Sbjct  576  TSELHRQATRDLETAVSLWHSSFCRLIKFQREFIRSVQAWFKLTLLPVCHDEN-------  628

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
            P   +     A    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   
Sbjct  629  PGHKEPVDAYAFCDEWKLTLDRVPDTVASEAIKSFINVVHVISAKQSEELKIKKRTESAS  688

Query  447  KELEKRTRKFEDWYHKYMQR-RTPNDDTEQDGPHEDNN------VIERQLQLEALKQRLK  289
            KELEK+     +   KY Q   T        GP   +       + E++L+L A ++R++
Sbjct  689  KELEKKASSLRNIERKYYQSYSTVGFGLPDSGPDNGHGLDARDPLTEKKLELGACQRRVE  748

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            EE   + +     R  +L +L+TGLP +F A++ FS   +   QT+
Sbjct  749  EEMLKHSKAIEVTRAMTLNNLQTGLPGVFQALTSFSALFTESLQTV  794



>ref|XP_009398490.1| PREDICTED: uncharacterized protein LOC103983064 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=756

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 120/230 (52%), Gaps = 17/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSP  625
            TS+ H   T  L   +  WHS F+++I +Q++Y+  L  WLKL L+ +   N++E  SSP
Sbjct  527  TSDLHRLATRDLEAAISAWHSSFDRLIKYQRDYVNALYGWLKLTLLRVGGDNIQEDHSSP  586

Query  624  QRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRK  445
                    L     W+  + +LPD++A  AI SF +V++ I   Q +E+K+K R +   K
Sbjct  587  L----SIALTAFCEWKQALDRLPDKVASEAIKSFMSVIHVICTKQAEELKIKKRAETYSK  642

Query  444  ELEKRTRKFEDWYHKYMQRRT------PNDDTEQDGP---HEDNNVIERQLQLEALKQRL  292
            ELEK++        KY Q  +      P    E  G       + + E++L++ A ++++
Sbjct  643  ELEKKSTSLRSIEKKYYQSYSTVGIGLPGGGIENKGHVLFDARDPLAEKKLEIAACRRKV  702

Query  291  KEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            ++E   + +     R  +L +++TGLP +F A++ FS    +  + LE++
Sbjct  703  EDEMVKHAKAVEVTRSMTLNNIQTGLPGVFQAITGFS---GLFVEVLEAV  749



>ref|XP_010503820.1| PREDICTED: uncharacterized protein LOC104780964 [Camelina sativa]
Length=644

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 107/220 (49%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + +Q+WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  421  TSELHRQSTLQLELEIQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYES  480

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q DE K K R +   K+
Sbjct  481  K-----IYSFCEEWHLAIDRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKD  535

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK++        KY     P          + N VIE+++++E LK + +EE+  + + 
Sbjct  536  FEKKSAALRALESKYSPYSVPES-------RKTNPVIEKRVKVEMLKAKAEEEKSKHEKS  588

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  589  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  625



>ref|XP_007052313.1| BZIP domain class transcription factor [Theobroma cacao]
 gb|EOX96470.1| BZIP domain class transcription factor [Theobroma cacao]
Length=823

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/214 (32%), Positives = 111/214 (52%), Gaps = 12/214 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+++I  L+ W KL L+P+     + V   +
Sbjct  597  TSELHRQATRDLESAVSAWHSSFCRLIKFQRDFIHSLHGWFKLTLLPVSN---DNVDGNR  653

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
             P +  + A    W+  + ++PD +A  AI SF  VVN I   Q +E+K+K R +   KE
Sbjct  654  EPSD--VFAFCDEWKLALDRVPDTVASEAIKSFINVVNVISVKQTEELKIKKRTETVSKE  711

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQD-GPHED--NNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        D+  D G   D  + + E++ +L   ++R+++E
Sbjct  712  LEKKASSLRNIERKFYHSYSMVGIGLPDSGPDHGQVLDARDPLAEKKSELAGCQRRVEDE  771

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
               + +     R  +L +L+TGLP +F AM+ FS
Sbjct  772  MLRHAKAVEVTRAMTLNNLQTGLPGVFQAMTSFS  805



>ref|XP_010426682.1| PREDICTED: uncharacterized protein LOC104711671 isoform X1 [Camelina 
sativa]
Length=668

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 107/220 (49%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + +Q+WH  F  ++  Q++YI+ L  WL+L+L     N   K S   
Sbjct  445  TSELHRQSTLQLELEIQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVKSSYES  504

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q DE K K R +   K+
Sbjct  505  K-----IYSFCEEWHLAIDRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKD  559

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK++        KY     P          + N V+E+++++E LK + +EE+  + + 
Sbjct  560  FEKKSAALRALESKYSPYSVPES-------RKTNPVVEKRVKVEMLKGKAEEEKSKHEKS  612

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  613  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  649



>emb|CAN79228.1| hypothetical protein VITISV_011041 [Vitis vinifera]
Length=924

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 113/214 (53%), Gaps = 12/214 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I +Q+++I  L  WL+L L+P++ +         
Sbjct  652  TSELHRQATRDLESAVSAWHSSFCRLIKYQRDFILSLQGWLRLTLIPLNNDNING----H  707

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R Q+  + A +  W+  + +LPD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  708  REQS-VVFAFIDEWKLALDRLPDTVASEAIKSFVHVVHAISGKQAEELKIKKRTETASKE  766

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQD---GPHEDNNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        D+  D   G    + + E++ +L A ++R+++E
Sbjct  767  LEKKASSLRNIEKKFYHSYSMVGIGLPDSGPDNGQGLDARDPLSEKKAELAACQRRVEDE  826

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
               + +     R  +L +++TGLP +F AM+ FS
Sbjct  827  MVRHSKAVEVTRALTLNNIQTGLPGVFQAMTSFS  860



>ref|XP_010692050.1| PREDICTED: uncharacterized protein LOC104905271 [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 110/214 (51%), Gaps = 12/214 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I +Q+++IR L+ W KL L+P+     EK S+  
Sbjct  587  TSELHRQATRDLESAVSAWHSSFCRLIRYQRDFIRSLHGWFKLTLLPV-----EKESTNM  641

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
             P++         W++ + +LPD +   AI SF  VV+ I   Q +E K++ R +   KE
Sbjct  642  MPESSDAYPFFDEWKNALDRLPDTVTSEAIKSFVNVVHVISLKQTEEFKIQKRTETISKE  701

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRLKEE  283
            LEK+         KY    +       D   E+  V+       E++ +L+A ++R+++E
Sbjct  702  LEKKASGVRVLEKKYYNSYSMVGLGYPDAGPENGQVLDARDPLAEKKAELQACQRRVEDE  761

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
               + +     R  +L +++TGLP +F A++ FS
Sbjct  762  MMKHSKAVEVTRAMTLNNIQTGLPGVFQALTSFS  795



>ref|XP_002273471.2| PREDICTED: uncharacterized protein LOC100266818 [Vitis vinifera]
Length=845

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 113/214 (53%), Gaps = 12/214 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I +Q+++I  L  WL+L L+P++ +         
Sbjct  618  TSELHRQATRDLESAVSAWHSSFCRLIKYQRDFILSLQGWLRLTLIPLNNDNING----H  673

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R Q+  + A +  W+  + +LPD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  674  REQS-VVFAFIDEWKLALDRLPDTVASEAIKSFVHVVHAISGKQAEELKIKKRTETASKE  732

Query  441  LEKRTRKFED----WYHKYMQRRTPNDDTEQD---GPHEDNNVIERQLQLEALKQRLKEE  283
            LEK+     +    +YH Y        D+  D   G    + + E++ +L A ++R+++E
Sbjct  733  LEKKASSLRNIEKKFYHSYSMVGIGLPDSGPDNGQGLDARDPLSEKKAELAACQRRVEDE  792

Query  282  EEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  181
               + +     R  +L +++TGLP +F AM+ FS
Sbjct  793  MVRHSKAVEVTRALTLNNIQTGLPGVFQAMTSFS  826



>ref|XP_006380598.1| proline-rich family protein [Populus trichocarpa]
 gb|ERP58395.1| proline-rich family protein [Populus trichocarpa]
Length=654

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 14/220 (6%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + V +WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  428  TSEIHRQSTLQLELEVHQWHQSFCNVVKAQRDYIQSLTGWLRLSLFQFSKNPISRTSQES  487

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I +L   W   + ++PD++A   I SF AV++ IV  Q +E K K + +   KE
Sbjct  488  R-----IYSLCEEWHHAVDRIPDKVASEGIKSFLAVIHAIVVQQAEEHKQKKKSESAFKE  542

Query  441  LEKRT---RKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAY  271
             EK+    R  E  Y  Y    TP+   ++D       V+E++ + E  + + +EE+  +
Sbjct  543  FEKKAAELRSLESKYGPYSMPETPSTTRKKD------PVMEKRAKAEISRAKAEEEKSKH  596

Query  270  MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
             +     R  ++ +L+ G P +F AM  FS  C   +++L
Sbjct  597  EKSISVTRSMTMNNLQMGFPHVFQAMVGFSSVCMNAFESL  636



>ref|XP_008365863.1| PREDICTED: uncharacterized protein LOC103429493 [Malus domestica]
Length=733

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 112/221 (51%), Gaps = 2/221 (1%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            K ++  H   T QL V +Q WH+ F + +  QK Y+  L+ WL   +VP +       SS
Sbjct  485  KFSNNSHMRATLQLLVELQNWHACFREYVAAQKAYVETLHGWLIKFVVPEEELYSRSRSS  544

Query  627  --PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKD  454
              P     PP+L + H W   + KLPD L   A+ SF+  V  ++  Q +E K K +   
Sbjct  545  AAPYGVNGPPLLLICHDWLSSMEKLPDTLVTIALRSFTKDVRALLNQQGEEQKQKRKVDS  604

Query  453  TRKELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEA  274
              KEL++R R F+    ++++ +      E D  H+  ++ ER+ Q++  ++++  E E 
Sbjct  605  LAKELDRRIRAFQKTESRFLEPKLVEQKCETDIEHKTESLTERKEQIDMFRRKVDMEREK  664

Query  273  YMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
            +     + +  +L  ++TG   +F +++EFSRA   +Y  L
Sbjct  665  HQNYVQETQRVTLNVIQTGFCSVFESLAEFSRASQKLYGDL  705



>ref|XP_010515532.1| PREDICTED: uncharacterized protein LOC104791366 [Camelina sativa]
Length=643

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/220 (31%), Positives = 107/220 (49%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + +Q+WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  420  TSELHRQSTLQLELEIQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLVRSSYES  479

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q DE K K R +   K+
Sbjct  480  K-----IYSFCEEWHLAIDRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTEAMLKD  534

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK++        KY     P          + N VIE+++++E LK + +EE+  + + 
Sbjct  535  FEKKSAALRALESKYSPYSVPES-------RKTNPVIEKRVKVEMLKGKAEEEKSKHEKS  587

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  588  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  624



>ref|XP_004229746.1| PREDICTED: uncharacterized protein LOC101257405 [Solanum lycopersicum]
Length=853

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 122/229 (53%), Gaps = 15/229 (7%)
 Frame = -1

Query  807  KETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS  628
            + TS+ H + T  L   V  WHS + ++I  Q+++IR L+ W KL LV ++T    + ++
Sbjct  625  QSTSDLHRQATRDLESAVSAWHSSYCRLIKFQRDFIRSLHGWFKLTLVSVNT----EPTN  680

Query  627  PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTR  448
              R  +   +     W+  + ++PD +A  AI SF  VV++I   Q +E+K+K R +   
Sbjct  681  GNREFSDSFM-FCDEWKLALDRIPDTVASEAIKSFINVVHSIYVKQTEELKIKKRTESAS  739

Query  447  KELEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVI-------ERQLQLEALKQRLK  289
            KELEK+     +   KY    +       DG  ++ N++       E++ +L A ++R++
Sbjct  740  KELEKKASSVRNIERKYYNSFSMVGIGLPDGGPDNGNILDVRDPLAEKKAELAASQRRVE  799

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E   + +     R  +L +++TGLP +F AM+ FS   S+M + LE++
Sbjct  800  DEMVKHSKAVEVTRAMTLNNIQTGLPGVFQAMTSFS---SLMTEALEAV  845



>ref|XP_004515356.1| PREDICTED: uncharacterized protein LOC101490151 [Cicer arietinum]
Length=739

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 122/229 (53%), Gaps = 19/229 (8%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L + V  WHS F ++I  Q+++I  L+ W KLNL+P++ N K     P 
Sbjct  513  TSESHRQTTRDLELAVSAWHSNFCRLIKFQRDFILSLHGWFKLNLIPVNNNDKNNNIEPS  572

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
                    +    W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K +  +  KE
Sbjct  573  D-----AFSFCDEWKLALDRVPDTVASEAIKSFINVVHVISVKQSEELKIKKKTDNAYKE  627

Query  441  LEKRTRKFED----WYHKYMQ-----RRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLK  289
            LEK+T   ++    +Y+ Y         + ND+ +  G    + + E++L+L   + R++
Sbjct  628  LEKKTSSIKNIEKKFYNSYSMVGIGVPHSVNDNGQ--GLDARDPLAEKKLELSICQLRVE  685

Query  288  EEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            +E+  + +     R  +L +L+TGLP +F A++ FS   S+  + LES+
Sbjct  686  DEKMKHSKAIEVTRAMTLNNLQTGLPGVFQALTSFS---SLFIEALESV  731



>ref|XP_009363473.1| PREDICTED: uncharacterized protein LOC103953463 [Pyrus x bretschneideri]
Length=657

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 111/227 (49%), Gaps = 9/227 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  ++  Q++YI+ L  WL+L+L     +   K S   
Sbjct  432  TSEIHRQATLQLELQVQQWHLSFCSLVKAQRDYIQSLTGWLRLSLFQFRRHPIAKTSQES  491

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I  L   W   I ++PD++A   I SF  VV+ IV  Q DE K K + + T KE
Sbjct  492  R-----IYTLCEEWHHAIDRIPDKVASEGIKSFLTVVHAIVVQQADEYKQKRKSESTFKE  546

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+         KY     P+  +      + + V E++ +++ +K + +EE+  + + 
Sbjct  547  LEKKATALRSLESKYGPYSMPDSSSNT----KKSPVAEKRAKVDIIKAKAEEEKSKHEKL  602

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRE  121
                R  ++ +L+ G P +F AM  FS  C   ++ L +     N E
Sbjct  603  VSVTRTMTINNLQMGFPHVFEAMVGFSSVCMQAFEQLYNQAKSANEE  649



>emb|CDX73734.1| BnaC08g22690D [Brassica napus]
Length=640

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 105/220 (48%), Gaps = 15/220 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T+QL + +Q+WH  F  ++  Q++YI+ L  WL+L+L     N   + S   
Sbjct  417  TSELHRQSTFQLELEIQQWHHSFCNLVKAQRDYIQSLTGWLRLSLFQFSKNPLARSSYES  476

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            +     I +    W   I ++PD++A   I SF   V+ IV  Q +E K K R     K+
Sbjct  477  K-----IYSFCEEWHLAIDRIPDKVASEGINSFLTAVHGIVAQQAEEHKQKKRSDSMLKD  531

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK+         KY     P          + N VIE++ ++E LK + +EE+  + + 
Sbjct  532  FEKKAASLRGLESKYSPYSVPEG-------RKKNPVIEKRAKVEFLKGKAEEEKSKHEKA  584

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
                R  +L +L+ G P +F AM  FS  C    Q  ES+
Sbjct  585  VSVTRAMTLNNLQMGFPHVFQAMVGFSSVC---MQAFESV  621



>ref|XP_002526611.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35770.1| conserved hypothetical protein [Ricinus communis]
Length=667

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 109/223 (49%), Gaps = 9/223 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            T+++H + T QL   V  WHS F K++  QKEY+R L  W++L    +D N +   SS  
Sbjct  442  TTDYHRQATAQLVTEVTSWHSSFCKLMKSQKEYVRTLCRWIQLTNCLVDDNQQSSCSSAV  501

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R       +L   WQ +  +LPD++A  AI S  + +  I+  Q +E  L  +     K 
Sbjct  502  R-------SLCEQWQLIFDRLPDKIASEAIKSLLSAIQMIMLQQDEEYNLHKKSDKLEKR  554

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK      +   K   R    D      P    ++  ++ + EALK+R+  E+  Y+  
Sbjct  555  LEKELFSLAEMEKKVDWRFAAGDAQSDLSPKHPLSI--KRAKTEALKKRVDTEKSKYLNS  612

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHP  133
                RV +L +L+TGLP +F A+  FS A +  ++ + S + P
Sbjct  613  VQVTRVMTLNNLKTGLPSVFQALLGFSSASAQAFEAVHSDSSP  655



>ref|XP_008370338.1| PREDICTED: uncharacterized protein LOC103433829 [Malus domestica]
 ref|XP_008370339.1| PREDICTED: uncharacterized protein LOC103433829 [Malus domestica]
Length=650

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 112/227 (49%), Gaps = 9/227 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H +   +L + VQ+WH  F  ++  Q++YI+ L  WL+L+L     +   K S   
Sbjct  425  TSEIHRQAXLELELQVQQWHLSFCSLVKAQRDYIQSLTGWLRLSLFQFRRHPIAKTSQES  484

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I  L   W   I ++PD++A   I SF  VV+ IV  Q +E K K + + T KE
Sbjct  485  R-----IYTLCEEWHHAIDRIPDKVASEGIKSFLTVVHAIVVQQAEEYKQKRKSESTFKE  539

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+         KY     P+      G  + N V E++ ++E L+ + +EE+  + + 
Sbjct  540  LEKKATVLRSLESKYGPYSMPDS----SGNTKKNPVAEKRXKIEVLRAKAEEEKSKHEKL  595

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLNRE  121
                R  ++++L+ G P +F AM  FS  C   ++ L +     N+E
Sbjct  596  VNVTRTVTISNLQMGFPHVFEAMVGFSSVCMQAFEQLYNQAKSANQE  642



>ref|XP_002529641.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32728.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 107/210 (51%), Gaps = 8/210 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T QL + VQ+WH  F  +I  Q++YI+ L  WL+L+L     N   + S   
Sbjct  411  TSEIHRQSTLQLELEVQQWHQSFCNLIKAQRDYIQSLTGWLRLSLFQFSNNPLSRTSQES  470

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I +L   W   I ++PD++A   I SF  V++ IV  Q +E K K + + T KE
Sbjct  471  R-----IYSLCEEWHHAIDRIPDKVASEGIKSFLTVIHAIVVQQAEEHKQKKKSELTFKE  525

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
             EK+  +      KY     P  DT  +   +D  V E++ ++E L+ + +EE+  + + 
Sbjct  526  FEKKVSELRSLETKYGPYSMP--DTSGNTRIKD-PVTEKRAKVEILRSKAEEEKSKHEKS  582

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRAC  172
                R  ++ +L+ G P +F A+  FS  C
Sbjct  583  VSITRAMTINNLQMGFPHVFQAIVGFSSVC  612



>gb|EYU31892.1| hypothetical protein MIMGU_mgv1a0019612mg, partial [Erythranthe 
guttata]
Length=641

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 120/228 (53%), Gaps = 11/228 (5%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TS+ H + T  L   +  WHS F ++I  Q+ +++ L+ W KL L+PI +   E+    +
Sbjct  410  TSDLHRQATRDLESAITAWHSSFCRLIKFQRGFLQSLHSWFKLTLIPIHSTTTEQQQPVE  469

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q   +      W+  + ++PD +A  AI SF  VV++I   Q +E+K+K R +   KE
Sbjct  470  DRQLSNVFTFCDEWKLALDRIPDTVASEAIKSFINVVHSISLKQSEEIKIKKRAETASKE  529

Query  441  LEKRTRKF----EDWYHKY--MQRRTPNDDTEQDGPHEDNN--VIERQLQLEALKQRLKE  286
            LE++        + +YH Y  +    P+     +G   D+   + +++ +L   ++R+++
Sbjct  530  LERKASSLRTIEKKYYHSYSMVGIGLPDGGGSHEGHALDSRDPLADKKAELSNCQRRVED  589

Query  285  EEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  142
            E   + R     R  +L +++TGLP +F AM+ FS   ++M + LE++
Sbjct  590  EMVKHSRAVEVTRAMTLNNIQTGLPGVFQAMTSFS---NLMTEALETV  634



>gb|KFK42583.1| hypothetical protein AALP_AA1G014300 [Arabis alpina]
Length=715

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 119/230 (52%), Gaps = 16/230 (7%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H + T  L   V  WHS F ++I  Q+E+I  L+ W KL+LVP+     +K     
Sbjct  497  TSEVHRQVTRDLESAVSLWHSSFCRIIKFQREFISSLHAWFKLSLVPLSNEDPKK-----  551

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
              Q     AL   W+  + ++PD +A  AI SF  VV+ I   Q +E+K+K R +   KE
Sbjct  552  --QRSDSFALCEEWKLSLERVPDTVASEAIKSFVNVVHVISIKQGEEVKMKKRTESAGKE  609

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEE  277
            LEK+         KY Q  +    T   GP  +     + + E++ +L A ++++++E  
Sbjct  610  LEKKASSLRSIERKYYQAYS----TVGIGPGPETLDARDPLSEKKSELAACQRQVEDEVM  665

Query  276  AYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITHPLN  127
             +++     R  +L +L+TGLP LF A++ FS   +   QT+ S ++ +N
Sbjct  666  RHVKAVEVTRAMTLNNLQTGLPNLFQALTSFSSLFTDSLQTICSRSYSIN  715



>ref|XP_009379364.1| PREDICTED: uncharacterized protein LOC103967785 [Pyrus x bretschneideri]
 ref|XP_009379365.1| PREDICTED: uncharacterized protein LOC103967785 [Pyrus x bretschneideri]
Length=649

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 108/217 (50%), Gaps = 9/217 (4%)
 Frame = -1

Query  801  TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ  622
            TSE H +   QL + VQ+WH  F  ++  Q++YI+ L  WL+L+L     +   K S   
Sbjct  424  TSEIHRQAALQLELQVQQWHLSFCSLVKAQRDYIQSLTGWLRLSLFQFRRHPIAKTSQES  483

Query  621  RPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE  442
            R     I  L   W   I ++PD++A   I SF  VV+ IV  Q +E K K + + T KE
Sbjct  484  R-----IYTLCEEWHHAIDRIPDKVASEGIKSFLTVVHAIVVQQAEEYKQKRKSESTFKE  538

Query  441  LEKRTRKFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQ  262
            LEK+         +Y     P+      G  + N V E++ ++E L+ + +EE+  + + 
Sbjct  539  LEKKATVLRSLESRYGPYSMPDS----SGNAKKNPVAEKRAKIEVLRAKAEEEKSKHEKL  594

Query  261  CMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL  151
                R  ++++L+ G P +F AM  FS  C   ++ L
Sbjct  595  VNVTRTVTISNLQMGFPHVFEAMVGFSSVCMQAFEQL  631



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1633397860815