BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043I08

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009333709.1|  PREDICTED: uncharacterized aarF domain-conta...    181   3e-48   Pyrus x bretschneideri [bai li]
ref|XP_008236447.1|  PREDICTED: uncharacterized aarF domain-conta...    178   3e-47   Prunus mume [ume]
ref|XP_008381980.1|  PREDICTED: uncharacterized aarF domain-conta...    177   6e-47   
ref|XP_007199666.1|  hypothetical protein PRUPE_ppa001434mg             177   7e-47   Prunus persica
ref|XP_009792369.1|  PREDICTED: uncharacterized aarF domain-conta...    175   2e-46   Nicotiana sylvestris
ref|XP_009792370.1|  PREDICTED: uncharacterized aarF domain-conta...    175   2e-46   Nicotiana sylvestris
gb|KCW65391.1|  hypothetical protein EUGRSUZ_G02820                     172   3e-45   Eucalyptus grandis [rose gum]
gb|KCW65390.1|  hypothetical protein EUGRSUZ_G02820                     172   4e-45   Eucalyptus grandis [rose gum]
ref|XP_010067294.1|  PREDICTED: uncharacterized aarF domain-conta...    172   4e-45   Eucalyptus grandis [rose gum]
emb|CDP04368.1|  unnamed protein product                                171   6e-45   Coffea canephora [robusta coffee]
ref|XP_007009803.1|  Kinase superfamily protein isoform 2               168   2e-44   
ref|XP_007009802.1|  Kinase superfamily protein isoform 1               169   7e-44   
ref|XP_010099629.1|  Uncharacterized protein L484_013421                166   4e-43   
gb|KDP25718.1|  hypothetical protein JCGZ_23939                         166   8e-43   Jatropha curcas
ref|XP_006340562.1|  PREDICTED: uncharacterized aarF domain-conta...    162   1e-41   Solanum tuberosum [potatoes]
ref|XP_004307396.1|  PREDICTED: uncharacterized aarF domain-conta...    160   7e-41   Fragaria vesca subsp. vesca
gb|KHG27320.1|  hypothetical protein F383_11406                         150   1e-40   Gossypium arboreum [tree cotton]
ref|XP_004237543.1|  PREDICTED: uncharacterized aarF domain-conta...    158   5e-40   Solanum lycopersicum
ref|XP_009595990.1|  PREDICTED: uncharacterized protein LOC104092166    150   2e-39   Nicotiana tomentosiformis
ref|XP_002274556.1|  PREDICTED: uncharacterized aarF domain-conta...    154   7e-39   Vitis vinifera
gb|KDO48432.1|  hypothetical protein CISIN_1g0041461mg                  151   7e-39   Citrus sinensis [apfelsine]
gb|KDO48431.1|  hypothetical protein CISIN_1g0041461mg                  152   1e-38   Citrus sinensis [apfelsine]
gb|KDO48430.1|  hypothetical protein CISIN_1g0041461mg                  151   2e-38   Citrus sinensis [apfelsine]
ref|XP_006436281.1|  hypothetical protein CICLE_v10030711mg             153   2e-38   Citrus clementina [clementine]
gb|KDO48427.1|  hypothetical protein CISIN_1g0041461mg                  151   2e-38   Citrus sinensis [apfelsine]
ref|XP_002316360.2|  hypothetical protein POPTR_0010s22780g             152   5e-38   Populus trichocarpa [western balsam poplar]
emb|CAN75565.1|  hypothetical protein VITISV_032583                     152   5e-38   Vitis vinifera
ref|XP_002533250.1|  Ubiquinone biosynthesis protein coq-8, putative    152   6e-38   
gb|KJB73606.1|  hypothetical protein B456_011G240500                    148   8e-38   Gossypium raimondii
gb|KJB73605.1|  hypothetical protein B456_011G240500                    148   8e-38   Gossypium raimondii
ref|XP_011040974.1|  PREDICTED: uncharacterized aarF domain-conta...    151   1e-37   Populus euphratica
ref|XP_011040973.1|  PREDICTED: uncharacterized aarF domain-conta...    151   1e-37   Populus euphratica
gb|KJB73603.1|  hypothetical protein B456_011G240500                    148   2e-37   Gossypium raimondii
ref|XP_011084352.1|  PREDICTED: uncharacterized aarF domain-conta...    149   5e-37   Sesamum indicum [beniseed]
gb|KJB73602.1|  hypothetical protein B456_011G240500                    148   1e-36   Gossypium raimondii
ref|XP_010253633.1|  PREDICTED: uncharacterized aarF domain-conta...    148   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_003556229.1|  PREDICTED: uncharacterized aarF domain-conta...    146   6e-36   Glycine max [soybeans]
gb|KHN00834.1|  Hypothetical protein glysoja_000502                     146   7e-36   Glycine soja [wild soybean]
ref|XP_004496288.1|  PREDICTED: uncharacterized protein sll0005-like    146   8e-36   Cicer arietinum [garbanzo]
ref|XP_007143695.1|  hypothetical protein PHAVU_007G093900g             144   3e-35   Phaseolus vulgaris [French bean]
gb|KHN17125.1|  Hypothetical protein glysoja_011599                     142   5e-35   Glycine soja [wild soybean]
ref|XP_003591940.1|  aarF domain-containing protein kinase, putative    143   9e-35   Medicago truncatula
ref|XP_003536357.1|  PREDICTED: uncharacterized aarF domain-conta...    142   1e-34   Glycine max [soybeans]
ref|XP_006589432.1|  PREDICTED: uncharacterized aarF domain-conta...    142   1e-34   Glycine max [soybeans]
ref|XP_004142394.1|  PREDICTED: uncharacterized protein sll0005-like    141   4e-34   
ref|XP_004157521.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    141   4e-34   
gb|KGN52281.1|  hypothetical protein Csa_5G623450                       141   4e-34   Cucumis sativus [cucumbers]
ref|XP_010670015.1|  PREDICTED: uncharacterized aarF domain-conta...    139   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008446897.1|  PREDICTED: uncharacterized aarF domain-conta...    138   3e-33   Cucumis melo [Oriental melon]
gb|EYU39822.1|  hypothetical protein MIMGU_mgv1a001466mg                137   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_006854489.1|  hypothetical protein AMTR_s00175p00037000          122   2e-27   Amborella trichopoda
ref|XP_002879787.1|  hypothetical protein ARALYDRAFT_903159             121   2e-27   
ref|XP_010534416.1|  PREDICTED: uncharacterized aarF domain-conta...    118   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_006411144.1|  hypothetical protein EUTSA_v10016257mg             118   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_008807282.1|  PREDICTED: uncharacterized protein LOC103719...    115   4e-26   
ref|XP_008807196.1|  PREDICTED: uncharacterized protein LOC103719...    114   4e-26   
ref|XP_010534414.1|  PREDICTED: uncharacterized aarF domain-conta...    117   4e-26   
ref|XP_008807297.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    115   4e-25   
ref|XP_009133346.1|  PREDICTED: uncharacterized aarF domain-conta...    115   4e-25   Brassica rapa
ref|XP_010509063.1|  PREDICTED: uncharacterized aarF domain-conta...    114   7e-25   Camelina sativa [gold-of-pleasure]
emb|CDY14403.1|  BnaC03g21920D                                          113   2e-24   Brassica napus [oilseed rape]
ref|NP_565900.1|  ATH subfamily protein ATH8                            111   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36812.1|  hypothetical protein AALP_AA4G174700                    111   9e-24   Arabis alpina [alpine rockcress]
ref|XP_010906485.1|  PREDICTED: uncharacterized aarF domain-conta...    109   4e-23   
ref|XP_006293689.1|  hypothetical protein CARUB_v10022647mg             108   8e-23   Capsella rubella
ref|XP_010517256.1|  PREDICTED: uncharacterized aarF domain-conta...    108   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010507623.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_009392279.1|  PREDICTED: uncharacterized aarF domain-conta...    107   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAG90272.1|  unnamed protein product                                100   5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048444.2|  Os02g0805800                                       100   5e-20   
gb|EEC74196.1|  hypothetical protein OsI_09349                          100   6e-20   Oryza sativa Indica Group [Indian rice]
gb|AAK98701.1|AC069158_13  Putative ABC transporter                   99.8    8e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649145.1|  PREDICTED: uncharacterized protein LOC102711509  97.8    4e-19   
ref|XP_004954281.1|  PREDICTED: uncharacterized aarF domain-conta...  91.3    5e-17   Setaria italica
ref|XP_010235940.1|  PREDICTED: uncharacterized aarF domain-conta...  90.9    7e-17   Brachypodium distachyon [annual false brome]
gb|EMT28124.1|  hypothetical protein F775_28121                       87.8    6e-16   
ref|NP_001183656.1|  uncharacterized protein LOC100502250             82.8    3e-15   
dbj|BAJ99480.1|  predicted protein                                    84.0    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW73935.1|  hypothetical protein ZEAMMB73_748391                  82.8    1e-14   
ref|XP_002454741.1|  hypothetical protein SORBIDRAFT_04g036510        82.8    2e-14   
ref|XP_008644226.1|  PREDICTED: uncharacterized protein LOC100502...  82.4    3e-14   Zea mays [maize]
ref|XP_008644225.1|  PREDICTED: uncharacterized protein LOC100502...  82.4    3e-14   
ref|XP_002968686.1|  hypothetical protein SELMODRAFT_170150           58.5    2e-06   
ref|XP_002989934.1|  hypothetical protein SELMODRAFT_130784           58.5    2e-06   



>ref|XP_009333709.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Pyrus x bretschneideri]
Length=839

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 117/157 (75%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADGASL +AMVS+EA V+RQ FCRV+ADVLYQWM  A G+    TQ
Sbjct  682  PSKDGVVLRRLLMTADGASLVQAMVSKEAKVYRQQFCRVIADVLYQWMYAANGRGVTKTQ  741

Query  552  FSSDVQLATG-----------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            +SSD+++A G             IYDY+ I RD+RL+VI  N L+SARK+PILMLR +++
Sbjct  742  YSSDLKMAGGPENRERGPSSRAPIYDYRAIYRDRRLRVIVSNVLNSARKNPILMLRLYWT  801

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
              V+F  A ALACHR L+SF+E +L  +SFAP+++A+
Sbjct  802  SFVMFATAFALACHRALLSFAEDHLGPISFAPKQYAI  838



>ref|XP_008236447.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Prunus mume]
Length=832

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 116/157 (74%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADGASL +AMVS+EA  FRQ FC V+AD+LYQW+  A G+    T+
Sbjct  675  PSKDGVVLRRLLMTADGASLVQAMVSKEAKFFRQQFCSVIADILYQWIFAAFGRGITTTR  734

Query  552  FSSDVQLATG-----------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            +SSD++LA+            T IYDY+ I RD+RLKVIF N L+SARK+PILMLR +++
Sbjct  735  YSSDLRLASAHDNRDLEPSSKTPIYDYRTIFRDRRLKVIFSNVLNSARKNPILMLRFYWT  794

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
              V+F  A ALACHR LVSFSE YL  +SFA +++A+
Sbjct  795  SFVMFTIALALACHRALVSFSEAYLSPISFARKQYAI  831



>ref|XP_008381980.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Malus domestica]
Length=839

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 115/157 (73%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADGASL +AMVS+EA V+RQ FCRV+ADVLYQWM  A G+    T+
Sbjct  682  PSKDGVVLRRLLMTADGASLVQAMVSKEAKVYRQQFCRVIADVLYQWMYAANGRGITKTR  741

Query  552  FSSDVQLATG-----------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            +SSD+++A G             IYDY+ I RD+RL+VI  N L SARK PILMLR +++
Sbjct  742  YSSDLKMAGGPENRERGPSSRAPIYDYRAIYRDRRLRVIVSNVLKSARKSPILMLRLYWT  801

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
              V+F  A ALACHR L+SF+E +L  +SFAP+++A+
Sbjct  802  SFVMFATAFALACHRALLSFAEDHLGPISFAPKQYAI  838



>ref|XP_007199666.1| hypothetical protein PRUPE_ppa001434mg [Prunus persica]
 gb|EMJ00865.1| hypothetical protein PRUPE_ppa001434mg [Prunus persica]
Length=830

 Score =   177 bits (448),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 116/157 (74%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSK+G VLRRLLMTADGASL +AMVS++A  FRQ FC V+AD+LYQWM  A G+    T+
Sbjct  673  PSKEGVVLRRLLMTADGASLVQAMVSKKAKFFRQQFCSVIADILYQWMFTAFGRGIATTR  732

Query  552  FSSDVQLATG-----------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            +SSD++LA+            T IYDY+ I RD+RLKVIF N L+SARK+PILMLR +++
Sbjct  733  YSSDLRLASAHDNRDLEPSSRTPIYDYRTIFRDRRLKVIFSNVLNSARKNPILMLRFYWT  792

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
              V+F  A ALACHR LVSFSE YL  +SFA +++A+
Sbjct  793  SFVMFTTALALACHRALVSFSEAYLSPISFARKQYAI  829



>ref|XP_009792369.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X1 [Nicotiana sylvestris]
Length=844

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 106/157 (68%), Gaps = 13/157 (8%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSS  544
            PSKDG VLRRLLMTADGASL RA +S EA  FRQH CR+ AD+L QW+ + LG +   SS
Sbjct  689  PSKDGIVLRRLLMTADGASLVRAFISREAEFFRQHLCRIAADILSQWIFETLG-SNVISS  747

Query  543  DVQLATGTAI------------YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLC  400
             VQL   T +            YDYKL LRD+RLK+I F  L SARK PILM+R F S  
Sbjct  748  RVQLTGATTVKMGSSSAVFSPDYDYKLTLRDRRLKLILFKVLGSARKSPILMMRFFCSSF  807

Query  399  VIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            +IFVKASALACHR LV  S  YLDR+S  PRK  +GA
Sbjct  808  LIFVKASALACHRFLVCLSNAYLDRVSLVPRKVVVGA  844



>ref|XP_009792370.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X2 [Nicotiana sylvestris]
Length=843

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 106/157 (68%), Gaps = 13/157 (8%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSS  544
            PSKDG VLRRLLMTADGASL RA +S EA  FRQH CR+ AD+L QW+ + LG +   SS
Sbjct  688  PSKDGIVLRRLLMTADGASLVRAFISREAEFFRQHLCRIAADILSQWIFETLG-SNVISS  746

Query  543  DVQLATGTAI------------YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLC  400
             VQL   T +            YDYKL LRD+RLK+I F  L SARK PILM+R F S  
Sbjct  747  RVQLTGATTVKMGSSSAVFSPDYDYKLTLRDRRLKLILFKVLGSARKSPILMMRFFCSSF  806

Query  399  VIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            +IFVKASALACHR LV  S  YLDR+S  PRK  +GA
Sbjct  807  LIFVKASALACHRFLVCLSNAYLDRVSLVPRKVVVGA  843



>gb|KCW65391.1| hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis]
Length=831

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 16/159 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT---Q  553
            PSK G VLRRLLMTADGASL RAMVS+E   FRQ  C ++A++LY WM  A+G +T   Q
Sbjct  671  PSKQGVVLRRLLMTADGASLIRAMVSKEGGFFRQQLCGIIAEILYHWMLGAIGSSTRVAQ  730

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            ++S V+LA+GT+             IYDY+ I RD+RL+VIF  AL SA+ DP+LMLR  
Sbjct  731  YNSRVKLASGTSNYELGPSSGRSTSIYDYQSIFRDRRLRVIFSKALRSAQSDPVLMLRFC  790

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            +S  VIFV ASALACHR +V+ SE YL  LSF P++FA+
Sbjct  791  WSSLVIFVTASALACHRAVVNLSEAYLGPLSFVPKRFAI  829



>gb|KCW65390.1| hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis]
Length=839

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 16/159 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT---Q  553
            PSK G VLRRLLMTADGASL RAMVS+E   FRQ  C ++A++LY WM  A+G +T   Q
Sbjct  679  PSKQGVVLRRLLMTADGASLIRAMVSKEGGFFRQQLCGIIAEILYHWMLGAIGSSTRVAQ  738

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            ++S V+LA+GT+             IYDY+ I RD+RL+VIF  AL SA+ DP+LMLR  
Sbjct  739  YNSRVKLASGTSNYELGPSSGRSTSIYDYQSIFRDRRLRVIFSKALRSAQSDPVLMLRFC  798

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            +S  VIFV ASALACHR +V+ SE YL  LSF P++FA+
Sbjct  799  WSSLVIFVTASALACHRAVVNLSEAYLGPLSFVPKRFAI  837



>ref|XP_010067294.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Eucalyptus grandis]
 gb|KCW65392.1| hypothetical protein EUGRSUZ_G02820 [Eucalyptus grandis]
Length=842

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 112/159 (70%), Gaps = 16/159 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT---Q  553
            PSK G VLRRLLMTADGASL RAMVS+E   FRQ  C ++A++LY WM  A+G +T   Q
Sbjct  682  PSKQGVVLRRLLMTADGASLIRAMVSKEGGFFRQQLCGIIAEILYHWMLGAIGSSTRVAQ  741

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            ++S V+LA+GT+             IYDY+ I RD+RL+VIF  AL SA+ DP+LMLR  
Sbjct  742  YNSRVKLASGTSNYELGPSSGRSTSIYDYQSIFRDRRLRVIFSKALRSAQSDPVLMLRFC  801

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            +S  VIFV ASALACHR +V+ SE YL  LSF P++FA+
Sbjct  802  WSSLVIFVTASALACHRAVVNLSEAYLGPLSFVPKRFAI  840



>emb|CDP04368.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 111/159 (70%), Gaps = 15/159 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG---KATQ  553
            PSKDG VLRRLLMTA+G SL RAMVS+EAN  RQ FCRV+AD+LYQW+S+ LG   +  Q
Sbjct  664  PSKDGYVLRRLLMTANGTSLVRAMVSKEANSMRQQFCRVIADILYQWISRVLGNGVQVVQ  723

Query  552  FSSDVQLATG------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFF  409
            FS  VQL  G            T + DY+ +LRD+R+K+I F  L SAR+DPILMLR ++
Sbjct  724  FSPQVQLGRGASNIEIDSSSRITPMIDYQSLLRDRRIKIILFKILDSARRDPILMLRFYW  783

Query  408  SLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMG  292
            +  ++ V ASA+ACHRVLV+  E  L  +S AP++ A+G
Sbjct  784  TSFIMLVTASAMACHRVLVTLFEASLAHISLAPKRIAVG  822



>ref|XP_007009803.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY18613.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=579

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 116/159 (73%), Gaps = 16/159 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA+VS+EA VFR   CR++AD+L QWM ++LG+   A+Q
Sbjct  419  PSKDGVVLRRLIMTADGASLVRAVVSKEAKVFRFQLCRIIADILCQWMFESLGQIVPASQ  478

Query  552  FSSDVQLATG-------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  ++LA G             T  YDY+ +L+D+RLKVIFF  L+SARK+P LMLR +
Sbjct  479  YSYHLRLAGGPENRELGPSSRLFTPTYDYQSLLKDRRLKVIFFKILNSARKEPALMLRFY  538

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  V+F+ ASALA HR+L+S SE +L  L FAP++FAM
Sbjct  539  WTSFVMFIAASALAFHRLLISLSEAHLGTLPFAPKRFAM  577



>ref|XP_007009802.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007009804.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18612.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY18614.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=845

 Score =   169 bits (427),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 116/159 (73%), Gaps = 16/159 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA+VS+EA VFR   CR++AD+L QWM ++LG+   A+Q
Sbjct  685  PSKDGVVLRRLIMTADGASLVRAVVSKEAKVFRFQLCRIIADILCQWMFESLGQIVPASQ  744

Query  552  FSSDVQLATG-------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  ++LA G             T  YDY+ +L+D+RLKVIFF  L+SARK+P LMLR +
Sbjct  745  YSYHLRLAGGPENRELGPSSRLFTPTYDYQSLLKDRRLKVIFFKILNSARKEPALMLRFY  804

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  V+F+ ASALA HR+L+S SE +L  L FAP++FAM
Sbjct  805  WTSFVMFIAASALAFHRLLISLSEAHLGTLPFAPKRFAM  843



>ref|XP_010099629.1| Uncharacterized protein L484_013421 [Morus notabilis]
 gb|EXB80095.1| Uncharacterized protein L484_013421 [Morus notabilis]
Length=829

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 112/159 (70%), Gaps = 16/159 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQF  550
            S DGAVLRRLLMTADGAS+ +A+VS+EA VFR+ FCRV+ADVLY W+ KALG+    T++
Sbjct  670  SNDGAVLRRLLMTADGASIIQAVVSKEAKVFREQFCRVIADVLYLWIFKALGQDITTTRY  729

Query  549  SSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFF  409
             S V L+ G               IYDY  ILRD+RLKVIF + L SAR+ P+LMLR ++
Sbjct  730  GSKVILSIGAGNRELSSSSRSSMPIYDYDSILRDRRLKVIFSHILKSARRKPVLMLRFYW  789

Query  408  SLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMG  292
               V+ + ASA+ACHRV+VS SE Y   +S AP+++AMG
Sbjct  790  VSFVMLLTASAIACHRVVVSLSEAYFGPVSLAPKQYAMG  828



>gb|KDP25718.1| hypothetical protein JCGZ_23939 [Jatropha curcas]
Length=838

 Score =   166 bits (419),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 122/178 (69%), Gaps = 16/178 (9%)
 Frame = -2

Query  774  RKSVGqlmlqxlvvrlLPSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADV  595
            R S G   +  LV+ LLPS+DG VLR+LLMTADG SL +AMVS+EA +FRQ  CRV+AD+
Sbjct  661  RPSSGVFDVAQLVLMLLPSRDGIVLRKLLMTADGVSLVQAMVSKEAVIFRQQLCRVIADL  720

Query  594  LYQWMSKALG---KATQFSSDVQLATGT-------------AIYDYKLILRDQRLKVIFF  463
            LYQW  + LG   KAT ++S V+L   +              IYDY+ I++D+RLK+IFF
Sbjct  721  LYQWTVQTLGLGTKATLYASQVRLTNESDKRDLFPSSRLSMPIYDYQSIIKDRRLKIIFF  780

Query  462  NALSSARKDPILMLRSFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
              L SARKDP+L+L+  ++  V+ V ASALACHRVLVS SE Y+  LSFA ++ A+ A
Sbjct  781  RILDSARKDPVLILKFCWTSIVMIVTASALACHRVLVSLSEVYISPLSFARKRVAISA  838



>ref|XP_006340562.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Solanum tuberosum]
Length=844

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 108/156 (69%), Gaps = 11/156 (7%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRLLMTADGASL RA +S+EA  FRQH CR++AD+L QW+ +ALG    ++Q
Sbjct  689  PSKDGIVLRRLLMTADGASLVRAFISKEAKFFRQHLCRIVADILSQWIFEALGSNVISSQ  748

Query  552  F----SSDVQLATGTAI----YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCV  397
                 + +V L + +A+    YD    LRD+RLK+I F  L SARK PILM+R   S  +
Sbjct  749  MQLTGAPNVMLGSSSAVFSRDYDCNSTLRDRRLKLILFKVLGSARKSPILMMRFLCSSSL  808

Query  396  IFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            IF+KASA+ACHR LV  S  YLDR S APR+  +GA
Sbjct  809  IFIKASAVACHRFLVCLSMAYLDRASLAPREVVVGA  844



>ref|XP_004307396.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic [Fragaria vesca subsp. vesca]
Length=832

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 114/159 (72%), Gaps = 16/159 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADGASL +AMVS+EA  FRQ FCR +AD+L+QWM + L +     Q
Sbjct  673  PSKDGVVLRRLLMTADGASLTQAMVSKEAKFFRQQFCRFVADILHQWMLETLVRGITTVQ  732

Query  552  FSSDVQLATG-------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +SS +++A+G             T +YDY+ +LRD+RLKVIF + L+S RK+PILMLR +
Sbjct  733  YSSSLRVASGPDNRELGPSSRLSTPLYDYRSVLRDRRLKVIFSHILNSTRKNPILMLRLY  792

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  V+ V A A+A HRV++S SE YL  +SFA +++A+
Sbjct  793  WTSFVMSVVALAMASHRVIISLSEAYLGPISFASKQYAI  831



>gb|KHG27320.1| hypothetical protein F383_11406 [Gossypium arboreum]
Length=206

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 109/163 (67%), Gaps = 18/163 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA VS+EA  FR   C+++AD+LYQ M KALG+   A+Q
Sbjct  44   PSKDGVVLRRLIMTADGASLVRAAVSKEAKAFRFQLCKIIADILYQRMVKALGQLVPASQ  103

Query  552  FSSDVQLATG---------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLR  418
            +S  ++LA G               + +YDY+ +L D+RLK+I    L+SARK+P LMLR
Sbjct  104  YSYKLRLAGGHQNTELHPSARLSTSSTVYDYQSLLSDRRLKLILSKILNSARKEPALMLR  163

Query  417  SFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
             ++   V F+ ASALA HR+L+S S  Y+   SF P++FA+ A
Sbjct  164  FYWVSFVTFIAASALAFHRLLISLSAAYIGPASFIPKRFAISA  206



>ref|XP_004237543.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Solanum lycopersicum]
Length=844

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 107/158 (68%), Gaps = 15/158 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSS  544
            PSKDG VLRRLLMTADGASL RA +S+EA  FRQH CR++A +L QW+ +ALG +   SS
Sbjct  689  PSKDGIVLRRLLMTADGASLVRAFISKEAKFFRQHLCRIVAAILSQWIFEALG-SNVISS  747

Query  543  DVQLATG--TAI-----------YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSL  403
             +QL TG   AI           YD K  LRD+RLK+I F  L SARK  ILM+R   S 
Sbjct  748  QMQL-TGALNAIVGPSSAVFSRDYDCKSTLRDRRLKLIIFKVLGSARKSHILMMRFLCSS  806

Query  402  CVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            C+IF+KA+A+ACHR LV  S  YLDR S APR+  +GA
Sbjct  807  CLIFIKATAVACHRFLVCLSMAYLDRESLAPREVVVGA  844



>ref|XP_009595990.1| PREDICTED: uncharacterized protein LOC104092166 [Nicotiana tomentosiformis]
Length=310

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 104/157 (66%), Gaps = 13/157 (8%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSS  544
            PSKDG VLRRLLMTAD ASL RA +S EA  FRQH CR+ AD+L QW+ + +G +   SS
Sbjct  155  PSKDGIVLRRLLMTADEASLVRAFISREAEFFRQHLCRIAADILSQWIFETVG-SNVISS  213

Query  543  DVQLATGTAI------------YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLC  400
             VQL   T +            YDYK  LRD+RL++I F  L SARK PILM+R F S  
Sbjct  214  QVQLTGATTVKLGSSSAVFSPDYDYKSTLRDRRLRLILFKVLGSARKSPILMMRFFCSSF  273

Query  399  VIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            +IFVKASALACHR LV  S  YLDR+S  PRK  +GA
Sbjct  274  LIFVKASALACHRFLVCLSNAYLDRVSLVPRKVVVGA  310



>ref|XP_002274556.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Vitis vinifera]
 emb|CBI31476.3| unnamed protein product [Vitis vinifera]
Length=824

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 16/161 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADGASL R M+S+EA  FRQ  C+ +ADVLYQ M + +G+    TQ
Sbjct  664  PSKDGVVLRRLLMTADGASLIRMMISKEAIFFRQQLCKAIADVLYQRMLEVIGQGIAITQ  723

Query  552  FSSDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
             SS  +L +G                YDY+ +LRD+RLKVIFF  L+S R+DP+L LR  
Sbjct  724  HSSQWRLRSGPNNRDLSSLSRSSALTYDYQSVLRDRRLKVIFFKILNSVRRDPVLTLRFC  783

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++  ++F+ ASALACHR+LVS SE YL  +S   ++ A+ A
Sbjct  784  WASFIMFMTASALACHRILVSLSEIYLGPVSLPSKRVAISA  824



>gb|KDO48432.1| hypothetical protein CISIN_1g0041461mg [Citrus sinensis]
Length=444

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 16/161 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQF--S  547
            + +G VLRRLLMTADGASL RA VS+EA+ FR   CRV+AD LYQWM +ALG+      S
Sbjct  284  TNNGVVLRRLLMTADGASLIRAFVSKEASFFRHELCRVIADALYQWMCEALGRGIPVTRS  343

Query  546  SDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            S +++A G+              IYDY+  L+D+RLKVIF   L   R+DP+LMLR  ++
Sbjct  344  SQLRVAGGSDNRELEPSSGLSATIYDYQSFLKDRRLKVIFSKILDPVRRDPVLMLRLCWA  403

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGANS  283
              V+ VKASALAC R+LVS SE YL  +  AP++FA+ A++
Sbjct  404  AFVMLVKASALACQRMLVSLSEAYLGPV-LAPKRFAISASN  443



>gb|KDO48431.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
Length=594

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 16/161 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQF--S  547
            + +G VLRRLLMTADGASL RA VS+EA+ FR   CRV+AD LYQWM +ALG+      S
Sbjct  434  TNNGVVLRRLLMTADGASLIRAFVSKEASFFRHELCRVIADALYQWMCEALGRGIPVTRS  493

Query  546  SDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            S +++A G+              IYDY+  L+D+RLKVIF   L   R+DP+LMLR  ++
Sbjct  494  SQLRVAGGSDNRELEPSSGLSATIYDYQSFLKDRRLKVIFSKILDPVRRDPVLMLRLCWA  553

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGANS  283
              V+ VKASALAC R+LVS SE YL  +  AP++FA+ A++
Sbjct  554  AFVMLVKASALACQRMLVSLSEAYLGPV-LAPKRFAISASN  593



>gb|KDO48430.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
Length=628

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 16/161 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQF--S  547
            + +G VLRRLLMTADGASL RA VS+EA+ FR   CRV+AD LYQWM +ALG+      S
Sbjct  468  TNNGVVLRRLLMTADGASLIRAFVSKEASFFRHELCRVIADALYQWMCEALGRGIPVTRS  527

Query  546  SDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            S +++A G+              IYDY+  L+D+RLKVIF   L   R+DP+LMLR  ++
Sbjct  528  SQLRVAGGSDNRELEPSSGLSATIYDYQSFLKDRRLKVIFSKILDPVRRDPVLMLRLCWA  587

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGANS  283
              V+ VKASALAC R+LVS SE YL  +  AP++FA+ A++
Sbjct  588  AFVMLVKASALACQRMLVSLSEAYLGPV-LAPKRFAISASN  627



>ref|XP_006436281.1| hypothetical protein CICLE_v10030711mg [Citrus clementina]
 ref|XP_006485871.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Citrus sinensis]
 gb|ESR49521.1| hypothetical protein CICLE_v10030711mg [Citrus clementina]
Length=829

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 108/161 (67%), Gaps = 16/161 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQF--S  547
            + DG VLRRLLMTADGASL RA VS+EA+ FR   CRV+AD LYQWM +ALG+      S
Sbjct  669  TNDGVVLRRLLMTADGASLIRAFVSKEASFFRHELCRVIADALYQWMCEALGRGIPVTRS  728

Query  546  SDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            S +++A G+              IYDY+  L+D+RLKVIF   L   R+DP+LMLR  ++
Sbjct  729  SQLRVAGGSDKRELEPSSGLSATIYDYQSFLKDRRLKVIFSKILDPVRRDPVLMLRLCWA  788

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGANS  283
              V+ VKASALAC R+LVS SE YL  +  AP++FA+ A++
Sbjct  789  AFVMLVKASALACQRMLVSLSEAYLGPV-LAPKRFAISASN  828



>gb|KDO48427.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
 gb|KDO48428.1| hypothetical protein CISIN_1g0041461mg, partial [Citrus sinensis]
Length=667

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 16/161 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQF--S  547
            + +G VLRRLLMTADGASL RA VS+EA+ FR   CRV+AD LYQWM +ALG+      S
Sbjct  507  TNNGVVLRRLLMTADGASLIRAFVSKEASFFRHELCRVIADALYQWMCEALGRGIPVTRS  566

Query  546  SDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
            S +++A G+              IYDY+  L+D+RLKVIF   L   R+DP+LMLR  ++
Sbjct  567  SQLRVAGGSDNRELEPSSGLSATIYDYQSFLKDRRLKVIFSKILDPVRRDPVLMLRLCWA  626

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGANS  283
              V+ VKASALAC R+LVS SE YL  +  AP++FA+ A++
Sbjct  627  AFVMLVKASALACQRMLVSLSEAYLGPV-LAPKRFAISASN  666



>ref|XP_002316360.2| hypothetical protein POPTR_0010s22780g [Populus trichocarpa]
 gb|EEF02531.2| hypothetical protein POPTR_0010s22780g [Populus trichocarpa]
Length=826

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 113/173 (65%), Gaps = 16/173 (9%)
 Frame = -2

Query  777  PRKSVGqlmlqxlvvrlLPSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLAD  598
            P+++ G      LV+RLLPS+DG VLR+LLMTA+GASL RAMVS+EA   RQ  CRV+AD
Sbjct  649  PKRASGVFDTAHLVLRLLPSRDGIVLRKLLMTANGASLIRAMVSKEAIFVRQQLCRVIAD  708

Query  597  VLYQWMSKALGK---ATQFSSDVQLAT-------------GTAIYDYKLILRDQRLKVIF  466
             LY WM++  G+   AT++ S V+L +                +YDY+ I+RD+RLKVIF
Sbjct  709  ALYHWMTQTFGRGIMATRYGSQVRLTSEADNRELSTSSRLTVPVYDYQSIIRDRRLKVIF  768

Query  465  FNALSSARKDPILMLRSFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPR  307
               L SARKDP+LML+ +++  V+ V AS  ACHRVLVS SE  L    F PR
Sbjct  769  SRILDSARKDPVLMLKFYWTTFVMVVTASVRACHRVLVSLSEATLAPSRFLPR  821



>emb|CAN75565.1| hypothetical protein VITISV_032583 [Vitis vinifera]
Length=825

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 105/161 (65%), Gaps = 16/161 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADGASL R M+S+EA  FRQ  C+ +ADVLYQ M + +G+    TQ
Sbjct  665  PSKDGVVLRRLLMTADGASLIRMMISKEAIFFRQQLCKAIADVLYQRMLEVIGQGIAITQ  724

Query  552  FSSDVQLATGT-------------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
             SS  +L +G                YDY+ +LRD+RLKVIFF    S R+DP+L LR  
Sbjct  725  HSSQWRLRSGPNNRDLSSLSRSSALTYDYQSVLRDRRLKVIFFKIFDSVRRDPVLTLRFC  784

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++  ++F+ ASALACHR+LVS SE YL  +S   ++ A+ A
Sbjct  785  WASFIMFMTASALACHRILVSLSEIYLGPVSLPSKRVAISA  825



>ref|XP_002533250.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
 gb|EEF29135.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis]
Length=791

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 110/161 (68%), Gaps = 16/161 (10%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG---KATQ  553
            PS+DG  LR+LLMTADGASL RA+VS+EA  FRQ   RV+AD+LYQW+ K LG   KAT+
Sbjct  631  PSRDGIALRKLLMTADGASLVRAVVSKEAVFFRQQLSRVIADLLYQWVVKTLGIGNKATK  690

Query  552  FSSDVQLAT-------------GTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +SS V+L +               ++YDY+ I +D+RLKVIF   L+SA K+P+LML+  
Sbjct  691  YSSQVRLTSELDNKELGPSSNLSMSMYDYQSIFQDRRLKVIFSRILNSAMKNPVLMLKLC  750

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++  V+ V ASALACHRVLVS SE Y+   S A ++ A+ A
Sbjct  751  WTSVVMVVAASALACHRVLVSLSEIYIAPFSLARKEVALSA  791



>gb|KJB73606.1| hypothetical protein B456_011G240500 [Gossypium raimondii]
Length=451

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA VS+EA  FR   C+++AD+LYQ M KALG+    +Q
Sbjct  289  PSKDGVVLRRLIMTADGASLVRAAVSKEAKAFRFQLCKIIADILYQRMVKALGQLVPVSQ  348

Query  552  FSSDVQLATG---------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLR  418
            +S  ++LA G               + +YDY+ +L D+RLK+I    L+SARK+P LMLR
Sbjct  349  YSYKLRLAGGQQNTELHPSARLSASSTVYDYQSLLSDRRLKLILSKILNSARKEPALMLR  408

Query  417  SFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
             ++   V F+ ASALA HR+L+S S  Y+   SF P++FA+ A
Sbjct  409  FYWVSFVTFIAASALAFHRLLISLSAAYIGPASFIPKRFAISA  451



>gb|KJB73605.1| hypothetical protein B456_011G240500 [Gossypium raimondii]
Length=463

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA VS+EA  FR   C+++AD+LYQ M KALG+    +Q
Sbjct  301  PSKDGVVLRRLIMTADGASLVRAAVSKEAKAFRFQLCKIIADILYQRMVKALGQLVPVSQ  360

Query  552  FSSDVQLATG---------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLR  418
            +S  ++LA G               + +YDY+ +L D+RLK+I    L+SARK+P LMLR
Sbjct  361  YSYKLRLAGGQQNTELHPSARLSASSTVYDYQSLLSDRRLKLILSKILNSARKEPALMLR  420

Query  417  SFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
             ++   V F+ ASALA HR+L+S S  Y+   SF P++FA+ A
Sbjct  421  FYWVSFVTFIAASALAFHRLLISLSAAYIGPASFIPKRFAISA  463



>ref|XP_011040974.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X2 [Populus euphratica]
Length=813

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 110/173 (64%), Gaps = 16/173 (9%)
 Frame = -2

Query  777  PRKSVGqlmlqxlvvrlLPSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLAD  598
            P +S G      LV+RLLPS+DG VLR+LLMTA+GASL RAMVS+EA   RQ  CRV+AD
Sbjct  636  PNRSGGVFDTAHLVLRLLPSRDGIVLRKLLMTANGASLIRAMVSKEAIFVRQQLCRVIAD  695

Query  597  VLYQWMSKALGK---ATQFSSDVQLAT-------------GTAIYDYKLILRDQRLKVIF  466
            VLY WM++  G+   AT + S V+L +                +YDY+ I RD+RLKVIF
Sbjct  696  VLYHWMTQTFGRGIMATWYGSQVRLTSEADNRELSPSSRLTVPVYDYQSIFRDRRLKVIF  755

Query  465  FNALSSARKDPILMLRSFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPR  307
               L SARKDP+LML+ +++   + V AS  ACHRVLVS SE  L    F PR
Sbjct  756  SRILDSARKDPVLMLKFYWTTFAMIVSASVRACHRVLVSLSEATLAPSRFLPR  808



>ref|XP_011040973.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic isoform X1 [Populus euphratica]
Length=826

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 110/173 (64%), Gaps = 16/173 (9%)
 Frame = -2

Query  777  PRKSVGqlmlqxlvvrlLPSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLAD  598
            P +S G      LV+RLLPS+DG VLR+LLMTA+GASL RAMVS+EA   RQ  CRV+AD
Sbjct  649  PNRSGGVFDTAHLVLRLLPSRDGIVLRKLLMTANGASLIRAMVSKEAIFVRQQLCRVIAD  708

Query  597  VLYQWMSKALGK---ATQFSSDVQLAT-------------GTAIYDYKLILRDQRLKVIF  466
            VLY WM++  G+   AT + S V+L +                +YDY+ I RD+RLKVIF
Sbjct  709  VLYHWMTQTFGRGIMATWYGSQVRLTSEADNRELSPSSRLTVPVYDYQSIFRDRRLKVIF  768

Query  465  FNALSSARKDPILMLRSFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPR  307
               L SARKDP+LML+ +++   + V AS  ACHRVLVS SE  L    F PR
Sbjct  769  SRILDSARKDPVLMLKFYWTTFAMIVSASVRACHRVLVSLSEATLAPSRFLPR  821



>gb|KJB73603.1| hypothetical protein B456_011G240500 [Gossypium raimondii]
 gb|KJB73604.1| hypothetical protein B456_011G240500 [Gossypium raimondii]
Length=621

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA VS+EA  FR   C+++AD+LYQ M KALG+    +Q
Sbjct  459  PSKDGVVLRRLIMTADGASLVRAAVSKEAKAFRFQLCKIIADILYQRMVKALGQLVPVSQ  518

Query  552  FSSDVQLATG---------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLR  418
            +S  ++LA G               + +YDY+ +L D+RLK+I    L+SARK+P LMLR
Sbjct  519  YSYKLRLAGGQQNTELHPSARLSASSTVYDYQSLLSDRRLKLILSKILNSARKEPALMLR  578

Query  417  SFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
             ++   V F+ ASALA HR+L+S S  Y+   SF P++FA+ A
Sbjct  579  FYWVSFVTFIAASALAFHRLLISLSAAYIGPASFIPKRFAISA  621



>ref|XP_011084352.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Sesamum indicum]
Length=814

 Score =   149 bits (376),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 112/156 (72%), Gaps = 12/156 (8%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSK+G VLRRLLMTADGASL +A+VS+E + FR   C+ +AD+LYQWM KAL      T+
Sbjct  660  PSKNGLVLRRLLMTADGASLIQALVSKEGSPFRHQLCKAVADILYQWMCKALTPVLNITK  719

Query  552  FSSDVQLATG-------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLR-SFFSLCV  397
            FSS + ++TG       +   +Y+ ILRD+RL+VIFF +L+SA+KDPIL+LR  + S  +
Sbjct  720  FSSPILISTGAENPQISSTNIEYESILRDRRLRVIFFKSLNSAKKDPILLLRFCWASFIL  779

Query  396  IFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            +FV ASA+A HR+LVS +  YL RLS+  ++ A+ A
Sbjct  780  VFV-ASAMASHRLLVSIAGAYLGRLSYNSKQIAVTA  814



>gb|KJB73602.1| hypothetical protein B456_011G240500 [Gossypium raimondii]
Length=845

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 108/163 (66%), Gaps = 18/163 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGK---ATQ  553
            PSKDG VLRRL+MTADGASL RA VS+EA  FR   C+++AD+LYQ M KALG+    +Q
Sbjct  683  PSKDGVVLRRLIMTADGASLVRAAVSKEAKAFRFQLCKIIADILYQRMVKALGQLVPVSQ  742

Query  552  FSSDVQLATG---------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLR  418
            +S  ++LA G               + +YDY+ +L D+RLK+I    L+SARK+P LMLR
Sbjct  743  YSYKLRLAGGQQNTELHPSARLSASSTVYDYQSLLSDRRLKLILSKILNSARKEPALMLR  802

Query  417  SFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
             ++   V F+ ASALA HR+L+S S  Y+   SF P++FA+ A
Sbjct  803  FYWVSFVTFIAASALAFHRLLISLSAAYIGPASFIPKRFAISA  845



>ref|XP_010253633.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Nelumbo nucifera]
Length=831

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 109/160 (68%), Gaps = 15/160 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG VLRRLLMTADG SL RAMVS+EA  FRQ   R LADVLYQWM KALG+    +Q
Sbjct  672  PSKDGVVLRRLLMTADGTSLVRAMVSKEAVFFRQQVSRALADVLYQWMVKALGQDDTRSQ  731

Query  552  FSS----------DVQLATG--TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFF  409
            ++S          +V  ++G  T +YDY+  L+D+R KVIF+  L+SARKD +LM+R  +
Sbjct  732  YASYIRSTCVPQREVLTSSGPSTFVYDYQSFLKDRRFKVIFYKILASARKDTLLMVRLCW  791

Query  408  SLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            +  VI V ASA AC RVL+S+SET    +  APR+ A+ +
Sbjct  792  ASFVILVTASASACRRVLLSWSETCRKSVLLAPRRLAISS  831



>ref|XP_003556229.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Glycine max]
Length=823

 Score =   146 bits (368),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 103/159 (65%), Gaps = 17/159 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG  +RRLLMTADGASL +AMVS+E   FRQ  C+++ D+LYQWM K  G+    TQ
Sbjct  664  PSKDGVAIRRLLMTADGASLIKAMVSKEGKFFRQQLCKIIVDLLYQWMIKLFGQGITVTQ  723

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  V LA G +              YDY  I RD+RL+VIF   L SA +D ILMLR  
Sbjct  724  YSR-VVLANGPSNKESGLSPRSSLPTYDYNSIFRDRRLRVIFSKVLKSASRDKILMLRFS  782

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  +I + AS LACH+++VS SE YL ++  AP+++A+
Sbjct  783  WASLLIIITASTLACHQLVVSLSEAYLGKIFDAPKRYAV  821



>gb|KHN00834.1| Hypothetical protein glysoja_000502 [Glycine soja]
Length=823

 Score =   146 bits (368),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 103/159 (65%), Gaps = 17/159 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG  +RRLLMTADGASL +AMVS+E   FRQ  C+++ D+LYQWM K  G+    TQ
Sbjct  664  PSKDGVAIRRLLMTADGASLIKAMVSKEGKFFRQQLCKIIVDLLYQWMIKLFGQGITVTQ  723

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  V LA G +              YDY  I RD+RL+VIF   L SA +D ILMLR  
Sbjct  724  YSR-VVLANGPSNKESGLSPRSSLPTYDYNSIFRDRRLRVIFSKVLKSASRDKILMLRFS  782

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  +I + AS LACH+++VS SE YL ++  AP+++A+
Sbjct  783  WASLLIIITASTLACHQLVVSLSEAYLGKIFDAPKRYAV  821



>ref|XP_004496288.1| PREDICTED: uncharacterized protein sll0005-like [Cicer arietinum]
Length=831

 Score =   146 bits (368),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 108/174 (62%), Gaps = 16/174 (9%)
 Frame = -2

Query  777  PRKSVGqlmlqxlvvrlLPSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLAD  598
            P K+ G   +  L++RLLPSKDGA LRRLLMTADGASL RAMVSEE  V R+  C+V+ D
Sbjct  651  PNKATGTFDIAYLILRLLPSKDGAALRRLLMTADGASLIRAMVSEEGKVIREQLCKVITD  710

Query  597  VLYQWMSKALGKA---TQFSSDVQLATGTA-------------IYDYKLILRDQRLKVIF  466
             L QWM K  G+    TQ+   +  + G +              YDY  I RD+RL+VIF
Sbjct  711  ALCQWMIKLFGQGVTDTQYPRVMLTSNGPSNKESSRSPRSSSPAYDYNSIFRDRRLRVIF  770

Query  465  FNALSSARKDPILMLRSFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRK  304
               + SA  D ILMLR  +S  +IF+ ASALACHRV++S SE YL  +  AP++
Sbjct  771  SKVVKSASSDKILMLRFCWSSLLIFITASALACHRVVLSMSEVYLGSIFNAPKR  824



>ref|XP_007143695.1| hypothetical protein PHAVU_007G093900g [Phaseolus vulgaris]
 gb|ESW15689.1| hypothetical protein PHAVU_007G093900g [Phaseolus vulgaris]
Length=826

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 104/161 (65%), Gaps = 17/161 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT---Q  553
            PSKDG  +RRLLMTADGASL +A+VS+E   FRQ   +++ DV+YQWM K LG+     Q
Sbjct  667  PSKDGVAIRRLLMTADGASLIKAVVSKEGKSFRQQLGKIMVDVVYQWMIKLLGEGITVIQ  726

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  V LA G +               DY  I RD+RL+VIF+  L SA +D ILMLR F
Sbjct  727  YSR-VILANGLSNKESGLSPRSSLPTDDYNFIFRDRRLRVIFYKILKSASRDKILMLRFF  785

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++  +I V AS LACHR++VS SE YL ++  AP+++A+ A
Sbjct  786  WASLLIMVTASTLACHRLVVSLSEAYLAKIFDAPKRYAVSA  826



>gb|KHN17125.1| Hypothetical protein glysoja_011599 [Glycine soja]
Length=716

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 102/161 (63%), Gaps = 17/161 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG  +RRLLMTADGASL +AMVS+E   FR+  C+++  +LYQWM K  G+    TQ
Sbjct  557  PSKDGVAIRRLLMTADGASLIKAMVSKEGEFFREQLCKIIVGILYQWMIKLFGQGITITQ  616

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  V LA G +              YDY  I RD+RL+VIF   L SA +D ILMLR  
Sbjct  617  YSRMV-LANGPSSKESGLSPRSSLPTYDYNSIFRDRRLRVIFSKVLKSASRDKILMLRFS  675

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++   I + AS LACH+++VS SE YL ++  AP+++A+ A
Sbjct  676  WASLKIIITASTLACHQLVVSLSEAYLSKIFDAPKRYAVSA  716



>ref|XP_003591940.1| aarF domain-containing protein kinase, putative [Medicago truncatula]
 gb|AES62191.1| AarF domain kinase [Medicago truncatula]
Length=824

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 107/174 (61%), Gaps = 17/174 (10%)
 Frame = -2

Query  777  PRKSVGqlmlqxlvvrlLPSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLAD  598
            P K+ G   +  L++ +LPSKDG  LRRLLMTADGAS+ RAMVS+E  V RQ  C+V+AD
Sbjct  645  PNKAAGTFDIAYLILTILPSKDGVALRRLLMTADGASIIRAMVSKEGKVIRQQLCKVIAD  704

Query  597  VLYQWMSKALGKA---TQFSSDVQLATGTA-------------IYDYKLILRDQRLKVIF  466
             L QWM K  G+    TQ+   V LA GT+              YDY  I RD+RL+VIF
Sbjct  705  ALCQWMIKLCGQGVIDTQYPR-VMLANGTSNKESGRSPRSSSPSYDYISIFRDRRLRVIF  763

Query  465  FNALSSARKDPILMLRSFFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRK  304
               + SA    ILMLR  +S  VI + ASALACHRV++S SE YL  +  AP++
Sbjct  764  SKVVKSASSHKILMLRFCWSSLVIIITASALACHRVVLSLSEAYLGPIFDAPKR  817



>ref|XP_003536357.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X1 [Glycine max]
Length=825

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 102/161 (63%), Gaps = 17/161 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG  +RRLLMTADGASL +AMVS+E   FR+  C+++  +LYQWM K  G+    TQ
Sbjct  666  PSKDGVAIRRLLMTADGASLIKAMVSKEGEFFREQLCKIIVGILYQWMIKLFGQGITITQ  725

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  V LA G +              YDY  I RD+RL+VIF   L SA +D ILMLR  
Sbjct  726  YSRMV-LANGPSSKESGLSPRSSLPTYDYNSIFRDRRLRVIFSKVLKSASRDKILMLRFS  784

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++   I + AS LACH+++VS SE YL ++  AP+++A+ A
Sbjct  785  WASLKIIITASTLACHQLVVSLSEAYLSKIFDAPKRYAVSA  825



>ref|XP_006589432.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like isoform X2 [Glycine max]
Length=827

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 102/161 (63%), Gaps = 17/161 (11%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKA---TQ  553
            PSKDG  +RRLLMTADGASL +AMVS+E   FR+  C+++  +LYQWM K  G+    TQ
Sbjct  668  PSKDGVAIRRLLMTADGASLIKAMVSKEGEFFREQLCKIIVGILYQWMIKLFGQGITITQ  727

Query  552  FSSDVQLATGTA-------------IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
            +S  V LA G +              YDY  I RD+RL+VIF   L SA +D ILMLR  
Sbjct  728  YSRMV-LANGPSSKESGLSPRSSLPTYDYNSIFRDRRLRVIFSKVLKSASRDKILMLRFS  786

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGA  289
            ++   I + AS LACH+++VS SE YL ++  AP+++A+ A
Sbjct  787  WASLKIIITASTLACHQLVVSLSEAYLSKIFDAPKRYAVSA  827



>ref|XP_004142394.1| PREDICTED: uncharacterized protein sll0005-like [Cucumis sativus]
Length=831

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 103/159 (65%), Gaps = 18/159 (11%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFS--  547
            SK+GAVLRRL+MT +GASL +AMVS+EA  FRQ  C ++AD+++QW  K LG+ +Q +  
Sbjct  671  SKEGAVLRRLIMTVNGASLIQAMVSKEAKFFRQQLCTIVADIIHQWALKTLGQGSQATGL  730

Query  546  ---------------SDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
                           S  QL T T   DY   L D+R++++F   L SA   PILML+ F
Sbjct  731  GTTVRMGILSDKKGRSSSQLTT-TGQIDYISFLNDRRMRLLFSKVLKSASTKPILMLKFF  789

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  VIFV ASA+ACHR++VS SE YL  +S +P+++A+
Sbjct  790  WTSFVIFVTASAVACHRIVVSLSEAYLGPISLSPKQYAV  828



>ref|XP_004157521.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein sll0005-like 
[Cucumis sativus]
Length=831

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 103/159 (65%), Gaps = 18/159 (11%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFS--  547
            SK+GAVLRRL+MT +GASL +AMVS+EA  FRQ  C ++AD+++QW  K LG+ +Q +  
Sbjct  671  SKEGAVLRRLIMTVNGASLIQAMVSKEAKFFRQQLCTIVADIIHQWALKTLGQGSQATGL  730

Query  546  ---------------SDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
                           S  QL T T   DY   L D+R++++F   L SA   PILML+ F
Sbjct  731  GTTVRMGILSDKKGRSSSQLTT-TGQIDYISFLNDRRMRLLFSKVLKSASTKPILMLKFF  789

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  VIFV ASA+ACHR++VS SE YL  +S +P+++A+
Sbjct  790  WTSFVIFVTASAVACHRIVVSLSEAYLGPISLSPKQYAV  828



>gb|KGN52281.1| hypothetical protein Csa_5G623450 [Cucumis sativus]
Length=842

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 103/159 (65%), Gaps = 18/159 (11%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFS--  547
            SK+GAVLRRL+MT +GASL +AMVS+EA  FRQ  C ++AD+++QW  K LG+ +Q +  
Sbjct  682  SKEGAVLRRLIMTVNGASLIQAMVSKEAKFFRQQLCTIVADIIHQWALKTLGQGSQATGL  741

Query  546  ---------------SDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSF  412
                           S  QL T T   DY   L D+R++++F   L SA   PILML+ F
Sbjct  742  GTTVRMGILSDKKGRSSSQLTT-TGQIDYISFLNDRRMRLLFSKVLKSASTKPILMLKFF  800

Query  411  FSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
            ++  VIFV ASA+ACHR++VS SE YL  +S +P+++A+
Sbjct  801  WTSFVIFVTASAVACHRIVVSLSEAYLGPISLSPKQYAV  839



>ref|XP_010670015.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=817

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSS  544
            PSKDG VLRRLLMTADG +L +A +SEEA   RQ  CR +ADVLYQWM+  +G+     +
Sbjct  675  PSKDGIVLRRLLMTADGTTLLKAYLSEEAGTVRQQLCRAIADVLYQWMAGFIGQ--DLCA  732

Query  543  DVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASALACH  364
                 +  A  +Y+L+L D+RLKV+F   L+ AR+D +LMLR  ++  V+FV ASA+ACH
Sbjct  733  TASCHSFAANCNYRLLLTDRRLKVVFKKVLNDARRDWLLMLRFCWTSIVMFVFASAMACH  792

Query  363  RVLVSFSETYLDRLSFA  313
            ++++S SE Y+ R+SF+
Sbjct  793  QLIISLSEAYMSRISFS  809



>ref|XP_008446897.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Cucumis melo]
Length=844

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 16/161 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG---KATQF  550
            SK+G VLRRL+MT +GASL +AMVS+EA  FRQ  C ++AD+++QW+ K LG   +AT+ 
Sbjct  684  SKEGVVLRRLIMTVNGASLIQAMVSKEAKFFRQQLCTIVADIIHQWVLKTLGQGSRATEL  743

Query  549  SSDVQLA-------------TGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFF  409
             + V++              T T   DY   + D+R++++F   L SA   P LML+ F+
Sbjct  744  GTTVRMGIPSDKKGRSSPQLTATGQIDYISFVNDRRMRLLFSKVLKSASTKPTLMLKFFW  803

Query  408  SLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGAN  286
            +  VIF  ASA+ACHR++VS SE YL  +S +P+++A+ A 
Sbjct  804  TSFVIFATASAMACHRIVVSLSEAYLGPISLSPKQYAVSAG  844



>gb|EYU39822.1| hypothetical protein MIMGU_mgv1a001466mg [Erythranthe guttata]
Length=814

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 102/144 (71%), Gaps = 0/144 (0%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SK+G VLRRLLMTADG+SL RA+VS EA+ +RQ   +V+AD+L++ M +ALGKA   +  
Sbjct  670  SKNGLVLRRLLMTADGSSLVRALVSNEASSYRQQLGKVVADILHRSMCEALGKALNLAIA  729

Query  540  VQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASALACHR  361
                  +   +Y+ ILRD+R++VIFF +L+S +K+P+L+ R   +   +F  ASA+ACHR
Sbjct  730  KTPQVSSTENEYESILRDRRIRVIFFKSLNSVKKNPMLLFRFCCASFALFFVASAVACHR  789

Query  360  VLVSFSETYLDRLSFAPRKFAMGA  289
            V ++ +E YLDRLS+  +K A+ A
Sbjct  790  VSIAIAEAYLDRLSYNSKKIAVAA  813



>ref|XP_006854489.1| hypothetical protein AMTR_s00175p00037000 [Amborella trichopoda]
 gb|ERN15956.1| hypothetical protein AMTR_s00175p00037000 [Amborella trichopoda]
Length=779

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSS  544
            PSKDG VLRRLLMTAD  SL RA+VS+EA  FR  F  VLADV+Y+W   A  +    S 
Sbjct  634  PSKDGMVLRRLLMTADTGSLVRALVSKEAAPFRHQFGMVLADVIYEWAFAAC-QPHMVSQ  692

Query  543  DVQLATG--TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASALA  370
            ++Q+       +  Y+  LRD+RLK+IF   L++ R+DP LM+R  +   ++   A A A
Sbjct  693  NLQMDESLRVQLPIYQACLRDRRLKLIFKKGLNNLRRDPFLMIRFGWVASMVVCSAFAQA  752

Query  369  CHRVLVSFSETYLDRLSFAPRKFAMGA  289
            CHR+LVS+S  Y   ++FA R+FA+G 
Sbjct  753  CHRLLVSWSMRYAAPVTFAQRQFAVGT  779



>ref|XP_002879787.1| hypothetical protein ARALYDRAFT_903159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56046.1| hypothetical protein ARALYDRAFT_903159 [Arabidopsis lyrata subsp. 
lyrata]
Length=786

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SK+G VLRRLLM A+G SL R  +S E +V RQ  C  +A+ +YQWM  +LG ++ +F S
Sbjct  639  SKNGVVLRRLLMAANGTSLIRTFLSREGHVIRQKLCMTIANTMYQWMVGSLGIESLKFIS  698

Query  543  --DVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              D  L++G  I   D+K+++RD+R++VI    L SA+ D ILMLR  ++  V+F+  +A
Sbjct  699  LSDPPLSSGINITVKDFKILIRDKRVRVILRKILESAKSDQILMLRFCWTSFVMFLTTTA  758

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  759  LACHRFVISVSEGYINYLSLS  779



>ref|XP_010534416.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X3 [Tarenaya hassleriana]
Length=684

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SKDGAVLRRL++TA+G SL R  VS EA+ FRQ  CR +AD+LY+WM    G ++ +F+ 
Sbjct  537  SKDGAVLRRLVVTANGTSLVRKFVSREAHTFRQQLCRTVADILYRWMLHITGFRSPKFAV  596

Query  543  DVQLATG---TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASAL  373
             +   +G   ++ +D  +++RD+RL+V+    L SA+KD +LM R   +  ++ + A+A+
Sbjct  597  TLDPTSGFNLSSAHDLGVLVRDKRLRVMIRKILESAKKDRVLMFRFCCTSSLLLLSATAI  656

Query  372  ACHRVLVSFSETYLDRLSFAPR  307
            AC+R L+S SET ++ LS A +
Sbjct  657  ACYRFLISVSETCINYLSLAAK  678



>ref|XP_006411144.1| hypothetical protein EUTSA_v10016257mg [Eutrema salsugineum]
 gb|ESQ52597.1| hypothetical protein EUTSA_v10016257mg [Eutrema salsugineum]
Length=817

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SKDG VLRRLLM A+G SL R  +S EA+V RQ  C  +AD LYQWM    G  + +F S
Sbjct  670  SKDGVVLRRLLMAANGTSLIRTFISREAHVIRQKLCSTIADTLYQWMVGIFGINSLKFIS  729

Query  543  DVQLATGTA----IYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              +  T +     + D+K+++RD+R++VI    + SA+ D +L LR  ++  V+F+  +A
Sbjct  730  LSEPPTSSGSNITVKDFKILIRDKRVRVILRKIVESAKSDRVLTLRFCWTSFVMFLTTTA  789

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  790  LACHRFVISVSEGYINYLSMS  810



>ref|XP_008807282.1| PREDICTED: uncharacterized protein LOC103719633 isoform X2 [Phoenix 
dactylifera]
Length=354

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 85/157 (54%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT----  556
            PSKDG VLRRLLMTAD  SL  AM+S++A   RQH    +AD++  WM KA+G       
Sbjct  197  PSKDGIVLRRLLMTADATSLTGAMISKDATFIRQHLSWAIADIICHWMIKAVGWNEALGQ  256

Query  555  ----------QFSSDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
                      Q    + L    + Y  + +L D+R+KVIF+  L   R DPILMLR  +S
Sbjct  257  HNHQVIVVKGQQERQMDLPPAPSTYVLQKVLSDRRMKVIFYKVLHDVRGDPILMLRLSWS  316

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
               IFV A+ALA HR LV         +SF PR  A+
Sbjct  317  SFTIFVTAAALALHRFLVYCLGALFTSVSFVPRHVAV  353



>ref|XP_008807196.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807201.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807209.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807215.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807222.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807230.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807238.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807246.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807255.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807262.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807269.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807274.1| PREDICTED: uncharacterized protein LOC103719633 isoform X1 [Phoenix 
dactylifera]
Length=354

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 85/157 (54%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT----  556
            PSKDG VLRRLLMTAD  SL  AM+S++A   RQH    +AD++  WM KA+G       
Sbjct  197  PSKDGIVLRRLLMTADATSLTGAMISKDATFIRQHLSWAIADIICHWMIKAVGWNEALGQ  256

Query  555  ----------QFSSDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
                      Q    + L    + Y  + +L D+R+KVIF+  L   R DPILMLR  +S
Sbjct  257  HNHQVIVVKGQQERQMDLPPAPSTYVLQKVLSDRRMKVIFYKVLHDVRGDPILMLRLSWS  316

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
               IFV A+ALA HR LV         +SF PR  A+
Sbjct  317  SFTIFVTAAALALHRFLVYCLGALFTSVSFVPRHVAV  353



>ref|XP_010534414.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010534415.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At4g31390, chloroplastic isoform X2 [Tarenaya hassleriana]
Length=808

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SKDGAVLRRL++TA+G SL R  VS EA+ FRQ  CR +AD+LY+WM    G ++ +F+ 
Sbjct  661  SKDGAVLRRLVVTANGTSLVRKFVSREAHTFRQQLCRTVADILYRWMLHITGFRSPKFAV  720

Query  543  DVQLATG---TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASAL  373
             +   +G   ++ +D  +++RD+RL+V+    L SA+KD +LM R   +  ++ + A+A+
Sbjct  721  TLDPTSGFNLSSAHDLGVLVRDKRLRVMIRKILESAKKDRVLMFRFCCTSSLLLLSATAI  780

Query  372  ACHRVLVSFSETYLDRLSFAPR  307
            AC+R L+S SET ++ LS A +
Sbjct  781  ACYRFLISVSETCINYLSLAAK  802



>ref|XP_008807297.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized aarF domain-containing 
protein kinase At1g79600, chloroplastic-like [Phoenix 
dactylifera]
Length=809

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 85/157 (54%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT----  556
            PSKDG VLRRLLMTAD  SL  AM+S++A   RQH    +AD++  WM KA+G       
Sbjct  652  PSKDGIVLRRLLMTADATSLTGAMISKDATFIRQHLSWAIADIICHWMIKAVGWNEALGQ  711

Query  555  ----------QFSSDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
                      Q    + L    + Y  + +L D+R+KVIF+  L   R DPILMLR  +S
Sbjct  712  HNHQVIVVKGQQERQMDLPPAPSTYVLQKVLSDRRMKVIFYKVLHDVRGDPILMLRLSWS  771

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
               IFV A+ALA HR LV         +SF PR  A+
Sbjct  772  SFTIFVTAAALALHRFLVYCLGALFTSVSFVPRHVAV  808



>ref|XP_009133346.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic [Brassica rapa]
 emb|CDY07670.1| BnaA03g18410D [Brassica napus]
Length=822

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SKDG VLRRLLM A+G SL R  +S+EA+  RQ  C ++AD LYQWM    G  + +F S
Sbjct  675  SKDGVVLRRLLMAANGTSLIRTFISKEAHAIRQKLCTMVADTLYQWMVGISGVNSLKFIS  734

Query  543  --DVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              D   ++GT I   D+K ++ D+R++VI    L S + D +L L+   +  V+F+ ASA
Sbjct  735  LPDPPPSSGTNITVKDFKNLIEDKRVRVILRKILESTKSDRVLTLKFGLTSFVMFLTASA  794

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  795  LACHRFVISVSEGYVNYLSLS  815



>ref|XP_010509063.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic-like [Camelina sativa]
Length=818

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SK+G VLRRLLM A+G SL R  +S EA+V RQ  C  +A+ +YQWM   LG ++ +F S
Sbjct  671  SKNGVVLRRLLMAANGTSLIRTFMSREAHVIRQKLCTTIANTMYQWMVGILGVQSLKFVS  730

Query  543  --DVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              D   ++G  I   D+K+++ D+R++VI    L SA++D +LMLR  ++  V+ +  +A
Sbjct  731  LPDPPASSGINITVKDFKILISDKRVRVILRKILESAKRDRVLMLRLCWTSFVMSLTTTA  790

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  791  LACHRFVISVSEGYINYLSMS  811



>emb|CDY14403.1| BnaC03g21920D [Brassica napus]
Length=822

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (62%), Gaps = 7/142 (5%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG----KATQ  553
            SKDG VLRRLLM A+G SL R  +S+EA+  RQ  C ++AD LYQWM    G    K   
Sbjct  675  SKDGVVLRRLLMAANGTSLIRTFISKEAHAIRQKLCTMVADTLYQWMVGISGVNSLKVIS  734

Query  552  FSSDVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKAS  379
               D   ++GT I   D+K ++ D+R++VI    L SA+ D +L L+   +  V+F+ AS
Sbjct  735  L-PDPPPSSGTNITVKDFKSLIEDKRVRVILRKILESAKSDRMLTLKFCLTSFVMFLTAS  793

Query  378  ALACHRVLVSFSETYLDRLSFA  313
            ALACHR ++S SE Y++ LS +
Sbjct  794  ALACHRFVISVSEGYVNYLSLS  815



>ref|NP_565900.1| ATH subfamily protein ATH8 [Arabidopsis thaliana]
 gb|AAC28988.2| putative ABC transporter; alternative splicing isoform gene prediction 
data combined with cDNA alignment data to generate 
this model [Arabidopsis thaliana]
 gb|AEC09644.1| ATH subfamily protein ATH8 [Arabidopsis thaliana]
Length=814

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFS-  547
            SK+G VLRRLLM A+G SL R  +S EA V RQ  C  +A  +YQWM  +LG ++ +F  
Sbjct  667  SKNGVVLRRLLMAANGTSLIRTFISREALVIRQKLCMTIATTMYQWMVGSLGIESLKFIS  726

Query  546  -SDVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
             SD   ++G  I   D+K+++ D+R++VI    L SA+ D +LMLR  ++  V+ +  +A
Sbjct  727  LSDPPPSSGINITVKDFKILINDKRVRVILRKILESAKSDRVLMLRFCWTSFVMSLTTTA  786

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  787  LACHRFVISVSEGYVNYLSLS  807



>gb|KFK36812.1| hypothetical protein AALP_AA4G174700 [Arabis alpina]
Length=824

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 88/141 (62%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFS-  547
            SKDG VLRRLLM A+  SL R  +S +A+V RQ  C  +AD +YQWM    G K+ +F  
Sbjct  677  SKDGVVLRRLLMAANATSLIRTFISRDAHVIRQKLCTTIADTMYQWMVGIFGIKSLKFIS  736

Query  546  -SDVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
             SD   ++GT I   D+K ++ D+R++VI      S + D +LM +  ++  V+F+  SA
Sbjct  737  LSDPPSSSGTNITVKDFKSLIADKRVRVILRQIFESTKSDRVLMFKFGWTSFVMFLTTSA  796

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  797  LACHRFVISVSEGYINYLSLS  817



>ref|XP_010906485.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Elaeis guineensis]
Length=809

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 85/157 (54%), Gaps = 14/157 (9%)
 Frame = -2

Query  723  PSKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKAT----  556
            PSKDG VLRRLLMTAD  SL  AMVS++A  FR+H    LAD++  WM KA+G       
Sbjct  652  PSKDGTVLRRLLMTADATSLTGAMVSKDATFFRRHLSWALADIICHWMIKAIGWNEAIGR  711

Query  555  ----------QFSSDVQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFS  406
                      Q   ++ L    +    + +L D+R+KVI +  L   R +PILMLR  +S
Sbjct  712  HDHQAIVVKGQRGREMDLPPAPSPPVLQKVLSDRRMKVILYKVLHDVRGEPILMLRLCWS  771

Query  405  LCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAM  295
               IFV A+ALA HR +V         +SF PR  A+
Sbjct  772  SFTIFVTAAALALHRFVVHGLWALFTSVSFVPRHVAV  808



>ref|XP_006293689.1| hypothetical protein CARUB_v10022647mg [Capsella rubella]
 gb|EOA26587.1| hypothetical protein CARUB_v10022647mg [Capsella rubella]
Length=821

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SK+G VLRRLLM A+G SL +  +S EA+V RQ  C  +A+ +YQWM   LG ++ +F S
Sbjct  674  SKNGVVLRRLLMAANGTSLIQTFISREAHVIRQKLCTTIANTMYQWMVGILGIESLKFIS  733

Query  543  --DVQLATGTAIY--DYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              D   ++G  I   D K+++ D+R++VI    L SA+ D +LMLR  ++   + +  +A
Sbjct  734  LPDPPSSSGLNITVKDLKILISDKRVRVILRKILESAKSDRVLMLRFCWTSFAMSLTTTA  793

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  794  LACHRFVISVSEGYINYLSMS  814



>ref|XP_010517256.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X1 [Camelina sativa]
 ref|XP_010517257.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic isoform X2 [Camelina sativa]
Length=818

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            SK+G VLRRLLM A+G SL +  +S EA+V RQ  C  +A+ +YQWM   L  ++ +F +
Sbjct  671  SKNGVVLRRLLMAANGTSLIQTFISREAHVIRQKLCTTIANTMYQWMVGILRVQSLKFVA  730

Query  543  --DVQLATGTAI--YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              D   ++G  I   D+K+++ D+R++VI    L SA+ D +LMLR  ++  V+ +  +A
Sbjct  731  LPDPPASSGINITVQDFKMLISDKRVRVILRKILESAKSDRVLMLRLCWTSFVMSLTTTA  790

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  791  LACHRFVISVSEGYINYLSMS  811



>ref|XP_010507623.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g71810, chloroplastic-like [Camelina sativa]
Length=770

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (65%), Gaps = 5/141 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG-KATQFSS  544
            S++G VLRRLLM A+G SL +  +S EA+V RQ  C  +A+ +YQWM   L  ++ +F S
Sbjct  623  SENGVVLRRLLMAANGTSLIQTFISREAHVIRQKLCTTIANTMYQWMVGILRVQSLKFVS  682

Query  543  --DVQLATGTAI--YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASA  376
              D   ++G  I   D+K+++ D+R++VI    L SA+ D +LMLR  ++  V+ +  +A
Sbjct  683  LPDPPASSGINITVQDFKILISDKRVRVILRKILESAKSDRVLMLRLCWTSFVMSLTTTA  742

Query  375  LACHRVLVSFSETYLDRLSFA  313
            LACHR ++S SE Y++ LS +
Sbjct  743  LACHRFVISVSEGYINYLSMS  763



>ref|XP_009392279.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Musa acuminata subsp. malaccensis]
Length=801

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 98/163 (60%), Gaps = 20/163 (12%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSK------ALGKA  559
            SKDG V RR+LM AD  SL RA +S+EA +FR++    LADV +QWM K      ALG+ 
Sbjct  641  SKDGTVFRRILMIADSTSLARAFISKEAIIFRKNLSAALADVFFQWMLKAIRGNGALGQC  700

Query  558  TQ------FSSDVQ------LATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRS  415
             Q      F++  Q      L++  ++   +  + D+RLKVI++  L+  R+DPILML+ 
Sbjct  701  DQQYDEHSFAASKQKETMLGLSSVLSVPLLQAAVVDRRLKVIYYKKLNDVRRDPILMLKV  760

Query  414  FFSLCVIFVKASALACHRVLVSFSETYLDRLSFAPRKFAMGAN  286
             +S   IF+ A+ALA +  LV +SE+Y+   SF  R+FA G +
Sbjct  761  CWSFSTIFMTAAALALNSFLVYWSESYVT--SFVQRRFATGVS  801



>dbj|BAG90272.1| unnamed protein product [Oryza sativa Japonica Group]
Length=818

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG--KATQFS  547
            SK+  V+RRL+MTA+  SL R ++S++A+++R    RVLADV++QWM KA G  +A Q  
Sbjct  657  SKESIVIRRLVMTANAKSLARDLISKDASIYRVLLSRVLADVIFQWMVKATGFKRAGQLE  716

Query  546  SDVQLATG------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSL  403
               ++  G             A+  ++  +RD+RLKVIF   +   R+DPILM+R  +++
Sbjct  717  PHPRVTAGKNDEDLGLSKEAPALVTFQTAVRDRRLKVIFSKFVRDIREDPILMVRVSWNM  776

Query  402  CVIFVKASALACHRVLVSFSETYLDRL  322
              I V ++A+  HR +V  SE +L  L
Sbjct  777  FAISVVSAAIGVHRFIVVLSEEFLSTL  803



>ref|NP_001048444.2| Os02g0805800 [Oryza sativa Japonica Group]
 dbj|BAD19381.1| putative ubiquinone biosynthesis protein ubiB [Oryza sativa Japonica 
Group]
 dbj|BAD19429.1| putative ubiquinone biosynthesis protein ubiB [Oryza sativa Japonica 
Group]
 gb|EEE58008.1| hypothetical protein OsJ_08784 [Oryza sativa Japonica Group]
 dbj|BAF10358.2| Os02g0805800 [Oryza sativa Japonica Group]
Length=961

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG--KATQFS  547
            SK+  V+RRL+MTA+  SL R ++S++A+++R    RVLADV++QWM KA G  +A Q  
Sbjct  800  SKESIVIRRLVMTANAKSLARDLISKDASIYRVLLSRVLADVIFQWMVKATGFKRAGQLE  859

Query  546  SDVQLATG------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSL  403
               ++  G             A+  ++  +RD+RLKVIF   +   R+DPILM+R  +++
Sbjct  860  PHPRVTAGKNDEDLGLSKEAPALVTFQTAVRDRRLKVIFSKFVRDIREDPILMVRVSWNM  919

Query  402  CVIFVKASALACHRVLVSFSETYLDRL  322
              I V ++A+  HR +V  SE +L  L
Sbjct  920  FAISVVSAAIGVHRFIVVLSEEFLSTL  946



>gb|EEC74196.1| hypothetical protein OsI_09349 [Oryza sativa Indica Group]
Length=961

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG--KATQFS  547
            SK+  V+RRL+MTA+  SL R ++S++A+++R    RVLADV++QWM KA G  +A Q  
Sbjct  800  SKESIVIRRLVMTANAKSLARDLISKDASIYRVLLSRVLADVIFQWMVKATGFKRAGQLE  859

Query  546  SDVQLATG------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSL  403
               ++  G             A+  ++  +RD+RLKVIF   +   R+DPILM+R  +++
Sbjct  860  PHPRVTAGKNDEDLGLSKEAPALVTFQTAVRDRRLKVIFSKFVRDIREDPILMVRVSWNM  919

Query  402  CVIFVKASALACHRVLVSFSETYLDRL  322
              I V ++A+  HR +V  SE +L  L
Sbjct  920  FAISVVSAAIGVHRFIVVLSEEFLSTL  946



>gb|AAK98701.1|AC069158_13 Putative ABC transporter [Oryza sativa Japonica Group]
Length=1372

 Score = 99.8 bits (247),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = -2

Query  720   SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG--KATQFS  547
             SK+  V+RRL+MTA+  SL R ++S++A+++R    RVLADV++QWM KA G  +A Q  
Sbjct  1211  SKESIVIRRLVMTANAKSLARDLISKDASIYRVLLSRVLADVIFQWMVKATGFKRAGQLE  1270

Query  546   SDVQLATG------------TAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSL  403
                ++  G             A+  ++  +RD+RLKVIF   +   R+DPILM+R  +++
Sbjct  1271  PHPRVTAGKNDEDLGLSKEAPALVTFQTAVRDRRLKVIFSKFVRDIREDPILMVRVSWNM  1330

Query  402   CVIFVKASALACHRVLVSFSETYLDRL  322
               I V ++A+  HR +V  SE +L  L
Sbjct  1331  FAISVVSAAIGVHRFIVVLSEEFLSTL  1357



>ref|XP_006649145.1| PREDICTED: uncharacterized protein LOC102711509 [Oryza brachyantha]
Length=1229

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 87/143 (61%), Gaps = 13/143 (9%)
 Frame = -2

Query  720   SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG--KATQFS  547
             +K+  V+RRL+MTA+  SL   ++S++A+VFR    RVLADV+YQWM KA G  +A +  
Sbjct  1069  AKESIVIRRLIMTANAKSLAHDLISKDASVFRVLISRVLADVIYQWMVKASGFKRAGRLE  1128

Query  546   SDVQLATGT-----------AIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLC  400
                ++ATG            A+  ++  +RD+RL+VIF   +   R+DPILM+R  +++ 
Sbjct  1129  PHPRMATGNDADQRLSKDAPALVTFQTAVRDRRLRVIFSKFVRDIREDPILMIRVSWNVL  1188

Query  399   VIFVKASALACHRVLVSFSETYL  331
              I V ++A+  H  +V  SE +L
Sbjct  1189  AISVVSAAIGVHHFIVFLSEEFL  1211



>ref|XP_004954281.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic-like [Setaria italica]
Length=942

 Score = 91.3 bits (225),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SKD AV+RRL+MTA+  SL R ++S +A +FR    +V+ADV+ QWM    G      +D
Sbjct  792  SKDSAVIRRLIMTANAKSLARDLISRDALMFRVLLSKVIADVVCQWMLNVTGLKRVAEND  851

Query  540  VQLA---TGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASALA  370
              L      + +   + ++RD+R++VIF   +   R++P+LM+R  +++ VI V ++A+ 
Sbjct  852  GHLVLSEESSTMVALQAVVRDRRMQVIFSKFVRELREEPVLMVRVSWNMFVISVTSAAVG  911

Query  369  CHRVLVSFSETYL  331
             HR +V  SE YL
Sbjct  912  LHRFMVFLSEKYL  924



>ref|XP_010235940.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 
At1g79600, chloroplastic [Brachypodium distachyon]
Length=941

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 85/152 (56%), Gaps = 16/152 (11%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALG--KATQFS  547
            S+D  V+RRL+MTA+  SL R ++S+ A++FR    R LADV+ QWM K  G  +  Q  
Sbjct  788  SQDSIVIRRLIMTANVKSLARDLISKGASIFRVLLSRALADVVCQWMVKVTGLKRLRQLK  847

Query  546  SDVQLATGTAIYDYKL------------ILRDQRLKVIFFNALSSARKDPILMLRSFFSL  403
             D  + T +   D +L             LRD+RLKVIF   +   R++P+LM R  +S+
Sbjct  848  PDSPVTTKSDEGDLRLSKEASIMVSLQEALRDRRLKVIFSKFVRDLREEPVLMFRVSWSM  907

Query  402  CVIFVKASALACHRVLVSFSETYLDRLSFAPR  307
             ++   ++A+  HR +V  SE YL  L+  PR
Sbjct  908  LLVSAVSAAIGVHRFVVLLSEEYLPTLT--PR  937



>gb|EMT28124.1| hypothetical protein F775_28121 [Aegilops tauschii]
Length=857

 Score = 87.8 bits (216),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 6/136 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSK--ALGKATQFS  547
            S+D  V+RRL+MTA+  SL R ++S++A +FR    R LADV+ QWM K  AL +     
Sbjct  709  SRDSIVIRRLIMTANHKSLARDLISKDAAIFRALLSRALADVVCQWMVKVTALKQLRDRG  768

Query  546  SDVQLATGTAI----YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKAS  379
             D  L+    I       + ++RD+RLKVIF   +   R++P+LM+R  +S  V+   ++
Sbjct  769  DDPGLSKEAPISPVVSSLQEVVRDRRLKVIFSKFVKDLREEPMLMVRVGWSALVVSAVST  828

Query  378  ALACHRVLVSFSETYL  331
            A+  HR  V  SE YL
Sbjct  829  AIGAHRFAVLLSEEYL  844



>ref|NP_001183656.1| uncharacterized protein LOC100502250 [Zea mays]
 gb|ACR37885.1| unknown [Zea mays]
Length=307

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (57%), Gaps = 14/139 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SK+  V+RRL+MTA+  SL R ++S +A +FR    +V+ADV+YQWM  A G      + 
Sbjct  133  SKESIVIRRLIMTANAKSLARDLISRDALMFRVLLSKVIADVVYQWMLSATGLKRVMETK  192

Query  540  VQLATGTAIYDYKLIL--------------RDQRLKVIFFNALSSARKDPILMLRSFFSL  403
            +Q    T   +  L+L              +D+R++++F   +   R++P+LM+R  +++
Sbjct  193  IQTPMTTGKNEGHLVLAEEPSTLMVLQAAVKDRRIQLMFTKFVRELREEPVLMIRVSWNV  252

Query  402  CVIFVKASALACHRVLVSF  346
             +I V ++A+  HR LV F
Sbjct  253  FLISVSSAAVGLHRFLVFF  271



>dbj|BAJ99480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=951

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 78/136 (57%), Gaps = 6/136 (4%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSK--ALGKATQFS  547
            S+D  V+RRL+MTA+  SL + ++S++A VFR    R LADV+ QWM K  AL +     
Sbjct  800  SRDSIVIRRLIMTANHKSLAQDLISKDAAVFRALLSRALADVVCQWMVKVTALKRLRDRG  859

Query  546  SDVQLATGTAI----YDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKAS  379
              + ++ G  I         ++RD+RLKVI+   +   R++P+LM R  +S  V+   ++
Sbjct  860  EALGISIGAPISPVVSSLHEVVRDRRLKVIYSKFVKDLREEPLLMARVGWSALVVSAVSA  919

Query  378  ALACHRVLVSFSETYL  331
            A+  HR  V  SE YL
Sbjct  920  AIGAHRFAVLLSEEYL  935



>gb|AFW73935.1| hypothetical protein ZEAMMB73_748391 [Zea mays]
Length=475

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (57%), Gaps = 14/139 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SK+  V+RRL+MTA+  SL R ++S +A +FR    +V+ADV+YQWM  A G      + 
Sbjct  301  SKESIVIRRLIMTANAKSLARDLISRDALMFRVLLSKVIADVVYQWMLSATGLKRVMETK  360

Query  540  VQLATGTAIYDYKLIL--------------RDQRLKVIFFNALSSARKDPILMLRSFFSL  403
            +Q    T   +  L+L              +D+R++++F   +   R++P+LM+R  +++
Sbjct  361  IQTPMTTGKNEGHLVLAEEPSTLMVLQAAVKDRRIQLMFTKFVRELREEPVLMIRVSWNV  420

Query  402  CVIFVKASALACHRVLVSF  346
             +I V ++A+  HR LV F
Sbjct  421  FLISVSSAAVGLHRFLVFF  439



>ref|XP_002454741.1| hypothetical protein SORBIDRAFT_04g036510 [Sorghum bicolor]
 gb|EES07717.1| hypothetical protein SORBIDRAFT_04g036510 [Sorghum bicolor]
Length=763

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 77/137 (56%), Gaps = 14/137 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SKD  V+RRL+MTA+  SL R ++S +A +FR    +V+ADV+ QWM  A G      + 
Sbjct  589  SKDSVVIRRLIMTANAKSLARDLISRDALMFRVLLSKVIADVVCQWMLNATGLKRVAETR  648

Query  540  VQLATGTAIYDYKLIL--------------RDQRLKVIFFNALSSARKDPILMLRSFFSL  403
            +Q    T   D  L+L              +D+R+++IF   +   R++PILM+R  +++
Sbjct  649  IQTPMTTGKNDGHLVLPEESSTLMALQAAVKDRRMQLIFTKFVRELREEPILMIRVSWNM  708

Query  402  CVIFVKASALACHRVLV  352
             +I V A+A+  HR +V
Sbjct  709  FLISVSAAAVGLHRFMV  725



>ref|XP_008644226.1| PREDICTED: uncharacterized protein LOC100502250 isoform X2 [Zea 
mays]
Length=938

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (57%), Gaps = 14/139 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SK+  V+RRL+MTA+  SL R ++S +A +FR    +V+ADV+YQWM  A G      + 
Sbjct  764  SKESIVIRRLIMTANAKSLARDLISRDALMFRVLLSKVIADVVYQWMLSATGLKRVMETK  823

Query  540  VQLATGTAIYDYKLIL--------------RDQRLKVIFFNALSSARKDPILMLRSFFSL  403
            +Q    T   +  L+L              +D+R++++F   +   R++P+LM+R  +++
Sbjct  824  IQTPMTTGKNEGHLVLAEEPSTLMVLQAAVKDRRIQLMFTKFVRELREEPVLMIRVSWNV  883

Query  402  CVIFVKASALACHRVLVSF  346
             +I V ++A+  HR LV F
Sbjct  884  FLISVSSAAVGLHRFLVFF  902



>ref|XP_008644225.1| PREDICTED: uncharacterized protein LOC100502250 isoform X1 [Zea 
mays]
Length=960

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (57%), Gaps = 14/139 (10%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            SK+  V+RRL+MTA+  SL R ++S +A +FR    +V+ADV+YQWM  A G      + 
Sbjct  786  SKESIVIRRLIMTANAKSLARDLISRDALMFRVLLSKVIADVVYQWMLSATGLKRVMETK  845

Query  540  VQLATGTAIYDYKLIL--------------RDQRLKVIFFNALSSARKDPILMLRSFFSL  403
            +Q    T   +  L+L              +D+R++++F   +   R++P+LM+R  +++
Sbjct  846  IQTPMTTGKNEGHLVLAEEPSTLMVLQAAVKDRRIQLMFTKFVRELREEPVLMIRVSWNV  905

Query  402  CVIFVKASALACHRVLVSF  346
             +I V ++A+  HR LV F
Sbjct  906  FLISVSSAAVGLHRFLVFF  924



>ref|XP_002968686.1| hypothetical protein SELMODRAFT_170150 [Selaginella moellendorffii]
 gb|EFJ29802.1| hypothetical protein SELMODRAFT_170150 [Selaginella moellendorffii]
Length=587

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 6/131 (5%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            S +GA LRR+++ AD  SL RA VS+EA   R    ++LAD  Y    K L +      D
Sbjct  453  SSNGASLRRIILEADTKSLARAFVSKEAAPVRLKVAKLLADAFYLHGKKLLQEHASVEID  512

Query  540  VQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASALACHR  361
             +    + I   +      +L+ +    ++  +K P+L+LR+ ++   +   A A A HR
Sbjct  513  ERSKLSSPIASTR------QLQFLLRALVARLQKTPLLLLRAGWTTATVMGWALAAAFHR  566

Query  360  VLVSFSETYLD  328
            + V  S TYL+
Sbjct  567  LAVGMSYTYLE  577



>ref|XP_002989934.1| hypothetical protein SELMODRAFT_130784, partial [Selaginella 
moellendorffii]
 gb|EFJ08947.1| hypothetical protein SELMODRAFT_130784, partial [Selaginella 
moellendorffii]
Length=694

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 6/131 (5%)
 Frame = -2

Query  720  SKDGAVLRRLLMTADGASLFRAMVSEEANVFRQHFCRVLADVLYQWMSKALGKATQFSSD  541
            S +GA LRR+++ AD  SL RA VS+EA   R    ++LAD  Y    K L +      D
Sbjct  560  SSNGASLRRIILEADTKSLARAFVSKEAAPVRLKVAKLLADAFYLHGKKLLQEHASVEID  619

Query  540  VQLATGTAIYDYKLILRDQRLKVIFFNALSSARKDPILMLRSFFSLCVIFVKASALACHR  361
             +    + I   +      +L+ +    ++  +K P+L+LR+ ++   +   A A A HR
Sbjct  620  ERSKLSSPIASTR------QLQFLLRALVARLQKTPLLLLRAGWTTATVMGWALAAAFHR  673

Query  360  VLVSFSETYLD  328
            + V  S TYL+
Sbjct  674  LAVGMSYTYLE  684



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730