BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043I04

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP17325.1|  unnamed protein product                                167   5e-44   Coffea canephora [robusta coffee]
gb|KDO78075.1|  hypothetical protein CISIN_1g0026401mg                  157   2e-43   Citrus sinensis [apfelsine]
gb|KDO78070.1|  hypothetical protein CISIN_1g0026401mg                  157   5e-43   Citrus sinensis [apfelsine]
ref|XP_007025176.1|  Uncharacterized protein TCM_029557                 161   7e-42   
ref|XP_006467530.1|  PREDICTED: uncharacterized protein LOC102630...    160   3e-41   Citrus sinensis [apfelsine]
ref|XP_006449624.1|  hypothetical protein CICLE_v10014224mg             160   3e-41   
ref|XP_006449625.1|  hypothetical protein CICLE_v10014224mg             160   3e-41   Citrus clementina [clementine]
ref|XP_006467531.1|  PREDICTED: uncharacterized protein LOC102630...    159   3e-41   
ref|XP_006377248.1|  hypothetical protein POPTR_0011s02850g             157   4e-40   
ref|XP_002317304.2|  kinase-related family protein                      156   5e-40   
gb|KHF99174.1|  hypothetical protein F383_17166                         155   1e-39   Gossypium arboreum [tree cotton]
gb|KJB69765.1|  hypothetical protein B456_011G041100                    154   2e-39   Gossypium raimondii
gb|KJB69763.1|  hypothetical protein B456_011G041100                    154   2e-39   Gossypium raimondii
ref|XP_006355598.1|  PREDICTED: signaling mucin HKR1-like               154   3e-39   Solanum tuberosum [potatoes]
ref|XP_009785957.1|  PREDICTED: uncharacterized protein LOC104234...    154   3e-39   Nicotiana sylvestris
ref|XP_009785950.1|  PREDICTED: uncharacterized protein LOC104234...    153   4e-39   Nicotiana sylvestris
ref|XP_009785963.1|  PREDICTED: uncharacterized protein LOC104234...    153   5e-39   Nicotiana sylvestris
ref|XP_009614040.1|  PREDICTED: uncharacterized protein LOC104107...    153   5e-39   Nicotiana tomentosiformis
ref|XP_009614041.1|  PREDICTED: uncharacterized protein LOC104107...    153   5e-39   Nicotiana tomentosiformis
ref|XP_009614044.1|  PREDICTED: uncharacterized protein LOC104107...    153   5e-39   Nicotiana tomentosiformis
emb|CBI30819.3|  unnamed protein product                                153   6e-39   Vitis vinifera
ref|XP_009614043.1|  PREDICTED: uncharacterized protein LOC104107...    152   6e-39   Nicotiana tomentosiformis
ref|XP_010655630.1|  PREDICTED: protein lingerer-like                   153   9e-39   Vitis vinifera
gb|KHN48057.1|  hypothetical protein glysoja_015527                     152   1e-38   Glycine soja [wild soybean]
ref|XP_011045309.1|  PREDICTED: uncharacterized protein LOC105140...    152   2e-38   Populus euphratica
ref|XP_011045308.1|  PREDICTED: uncharacterized protein LOC105140...    152   2e-38   Populus euphratica
ref|XP_011045310.1|  PREDICTED: uncharacterized protein LOC105140...    152   2e-38   Populus euphratica
gb|KDP21205.1|  hypothetical protein JCGZ_21676                         150   6e-38   Jatropha curcas
ref|XP_011005847.1|  PREDICTED: uncharacterized protein LOC105112...    150   1e-37   Populus euphratica
ref|XP_011005848.1|  PREDICTED: uncharacterized protein LOC105112...    149   1e-37   Populus euphratica
ref|XP_011005846.1|  PREDICTED: uncharacterized protein LOC105112...    149   1e-37   Populus euphratica
ref|XP_011005845.1|  PREDICTED: uncharacterized protein LOC105112...    149   1e-37   Populus euphratica
ref|XP_008225365.1|  PREDICTED: dentin sialophosphoprotein isofor...    149   2e-37   Prunus mume [ume]
ref|XP_008225366.1|  PREDICTED: dentin sialophosphoprotein isofor...    149   2e-37   Prunus mume [ume]
ref|XP_006369885.1|  hypothetical protein POPTR_0001s34440g             148   3e-37   
gb|KHF99173.1|  hypothetical protein F383_17166                         147   8e-37   Gossypium arboreum [tree cotton]
ref|XP_007214618.1|  hypothetical protein PRUPE_ppa001304mg             145   3e-36   Prunus persica
ref|XP_002519742.1|  conserved hypothetical protein                     145   4e-36   Ricinus communis
ref|XP_004232971.1|  PREDICTED: uncharacterized protein LOC101252351    142   6e-35   Solanum lycopersicum
ref|XP_011460396.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    139   4e-34   Fragaria vesca subsp. vesca
ref|XP_007159534.1|  hypothetical protein PHAVU_002G245500g             139   4e-34   Phaseolus vulgaris [French bean]
ref|XP_006356118.1|  PREDICTED: cell wall protein AWA1-like             137   2e-33   Solanum tuberosum [potatoes]
ref|XP_010317412.1|  PREDICTED: uncharacterized protein LOC101266...    137   3e-33   Solanum lycopersicum
ref|XP_004234052.1|  PREDICTED: uncharacterized protein LOC101266...    137   3e-33   Solanum lycopersicum
ref|XP_006580202.1|  PREDICTED: uncharacterized serine-rich prote...    136   5e-33   Glycine max [soybeans]
ref|XP_008439672.1|  PREDICTED: probable GPI-anchored adhesin-lik...    134   2e-32   Cucumis melo [Oriental melon]
ref|XP_008439673.1|  PREDICTED: probable GPI-anchored adhesin-lik...    134   2e-32   Cucumis melo [Oriental melon]
ref|XP_004134562.1|  PREDICTED: uncharacterized protein LOC101211388    134   2e-32   Cucumis sativus [cucumbers]
ref|XP_004162612.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    134   2e-32   
gb|KGN49366.1|  hypothetical protein Csa_6G522110                       134   2e-32   
ref|XP_011096498.1|  PREDICTED: uncharacterized protein LOC105175...    133   6e-32   
ref|XP_011096496.1|  PREDICTED: uncharacterized protein LOC105175...    133   6e-32   Sesamum indicum [beniseed]
ref|XP_010275810.1|  PREDICTED: uncharacterized protein LOC104610...    130   6e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010275801.1|  PREDICTED: uncharacterized protein LOC104610...    130   6e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010243690.1|  PREDICTED: uncharacterized protein LOC104587...    129   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010243689.1|  PREDICTED: uncharacterized protein LOC104587...    129   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_009790935.1|  PREDICTED: uncharacterized protein LOC104238306    127   9e-30   Nicotiana sylvestris
emb|CBI20348.3|  unnamed protein product                                120   1e-29   Vitis vinifera
gb|KJB57294.1|  hypothetical protein B456_009G157400                    125   2e-29   Gossypium raimondii
gb|KJB57297.1|  hypothetical protein B456_009G157400                    125   2e-29   Gossypium raimondii
gb|KJB57295.1|  hypothetical protein B456_009G157400                    126   2e-29   Gossypium raimondii
gb|KHG18569.1|  Protein translocase subunit SecA                        125   2e-29   Gossypium arboreum [tree cotton]
ref|XP_008349816.1|  PREDICTED: serine/threonine-protein kinase C...    118   7e-29   
ref|XP_010926244.1|  PREDICTED: uncharacterized protein LOC105048593    123   3e-28   Elaeis guineensis
ref|XP_008797517.1|  PREDICTED: uncharacterized protein LOC103712...    122   4e-28   
ref|XP_008797516.1|  PREDICTED: uncharacterized protein LOC103712...    122   4e-28   Phoenix dactylifera
ref|XP_003629905.1|  hypothetical protein MTR_8g088190                  121   1e-27   Medicago truncatula
ref|XP_008364176.1|  PREDICTED: uncharacterized protein LOC103427...    120   2e-27   
ref|XP_008364175.1|  PREDICTED: uncharacterized protein LOC103427...    120   3e-27   
ref|XP_010538220.1|  PREDICTED: uncharacterized protein LOC104812...    120   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_008364174.1|  PREDICTED: uncharacterized protein LOC103427...    119   4e-27   
ref|XP_010924304.1|  PREDICTED: signaling mucin HKR1-like               119   5e-27   Elaeis guineensis
ref|XP_010538221.1|  PREDICTED: uncharacterized protein LOC104812...    118   8e-27   Tarenaya hassleriana [spider flower]
emb|CAN79286.1|  hypothetical protein VITISV_039797                     114   1e-26   Vitis vinifera
gb|EYU28172.1|  hypothetical protein MIMGU_mgv1a001362mg                118   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_009618326.1|  PREDICTED: uncharacterized protein LOC104110...    116   4e-26   Nicotiana tomentosiformis
ref|XP_008358625.1|  PREDICTED: cell wall protein RBR3-like             112   4e-26   
ref|XP_009618328.1|  PREDICTED: uncharacterized protein LOC104110...    116   5e-26   Nicotiana tomentosiformis
ref|XP_009353841.1|  PREDICTED: uncharacterized protein LOC103945...    116   5e-26   
ref|XP_009353840.1|  PREDICTED: uncharacterized protein LOC103945...    116   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_009353842.1|  PREDICTED: uncharacterized protein LOC103945...    115   7e-26   Pyrus x bretschneideri [bai li]
ref|XP_009353838.1|  PREDICTED: uncharacterized protein LOC103945...    115   7e-26   
ref|XP_009353839.1|  PREDICTED: uncharacterized protein LOC103945...    115   7e-26   
ref|XP_004486425.1|  PREDICTED: serine-rich adhesin for platelets...    115   7e-26   Cicer arietinum [garbanzo]
ref|XP_008800693.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    114   2e-25   
ref|XP_008366008.1|  PREDICTED: protein lingerer-like                   114   3e-25   
ref|XP_011085623.1|  PREDICTED: uncharacterized protein LOC105167549    114   3e-25   
ref|XP_010666704.1|  PREDICTED: uncharacterized protein LOC104883...    113   7e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666705.1|  PREDICTED: uncharacterized protein LOC104883...    113   8e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX94662.1|  BnaC07g09960D                                          112   2e-24   
ref|XP_010056862.1|  PREDICTED: uncharacterized protein LOC104444...    112   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010056861.1|  PREDICTED: uncharacterized protein LOC104444...    111   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010056860.1|  PREDICTED: uncharacterized protein LOC104444...    111   2e-24   Eucalyptus grandis [rose gum]
ref|XP_010549430.1|  PREDICTED: uncharacterized protein LOC104820614    111   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_004504230.1|  PREDICTED: serine/threonine-protein kinase p...    110   6e-24   Cicer arietinum [garbanzo]
emb|CDJ26391.1|  unnamed protein product                                107   6e-23   Triticum aestivum [Canadian hard winter wheat]
gb|EMT31975.1|  Retrovirus-related Pol polyprotein LINE-1               106   2e-22   
ref|XP_009410964.1|  PREDICTED: uncharacterized protein LOC103992...    104   8e-22   
ref|XP_009410965.1|  PREDICTED: uncharacterized protein LOC103992...    103   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410962.1|  PREDICTED: uncharacterized protein LOC103992...    103   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410966.1|  PREDICTED: uncharacterized protein LOC103992...    103   9e-22   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAE00871.1|  TA9 protein                                          96.7    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306765.1|  hypothetical protein CARUB_v10008305mg             101   6e-21   Capsella rubella
ref|XP_006306766.1|  hypothetical protein CARUB_v10008305mg             101   6e-21   Capsella rubella
ref|XP_006646178.1|  PREDICTED: putative GPI-anchored protein PB1...    100   1e-20   
ref|XP_006415582.1|  hypothetical protein EUTSA_v10006794mg           99.8    3e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006415581.1|  hypothetical protein EUTSA_v10006794mg           99.8    3e-20   Eutrema salsugineum [saltwater cress]
ref|XP_003569505.1|  PREDICTED: uncharacterized protein LOC100846...  99.8    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_010232108.1|  PREDICTED: uncharacterized protein LOC100846...  99.8    3e-20   Brachypodium distachyon [annual false brome]
gb|EYU43283.1|  hypothetical protein MIMGU_mgv1a002920mg              99.0    3e-20   Erythranthe guttata [common monkey flower]
dbj|BAD72339.1|  TA9 protein-like                                     96.7    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006597650.1|  PREDICTED: cell wall protein AWA1-like isofo...  99.4    4e-20   
ref|XP_006597649.1|  PREDICTED: cell wall protein AWA1-like isofo...  99.0    5e-20   
gb|KHN14369.1|  hypothetical protein glysoja_012407                   99.0    5e-20   Glycine soja [wild soybean]
ref|XP_010539204.1|  PREDICTED: putative uncharacterized protein ...  98.6    6e-20   Tarenaya hassleriana [spider flower]
ref|NP_001130067.1|  uncharacterized protein LOC100191159             94.0    1e-19   
ref|XP_008648655.1|  PREDICTED: uncharacterized protein LOC103629266  94.4    1e-19   
ref|NP_001043788.1|  Os01g0663800                                     97.8    1e-19   
ref|XP_009395691.1|  PREDICTED: mucin-17-like                         97.1    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002893558.1|  hypothetical protein ARALYDRAFT_473146           96.7    3e-19   
ref|XP_009102863.1|  PREDICTED: uncharacterized protein LOC103828...  95.5    6e-19   Brassica rapa
emb|CDY15632.1|  BnaA07g08030D                                        95.5    6e-19   Brassica napus [oilseed rape]
ref|XP_009102861.1|  PREDICTED: uncharacterized protein LOC103828...  95.5    7e-19   Brassica rapa
ref|XP_009102862.1|  PREDICTED: uncharacterized protein LOC103828...  95.5    7e-19   Brassica rapa
ref|XP_010499452.1|  PREDICTED: RNA polymerase II degradation fac...  95.1    1e-18   
ref|XP_006827353.1|  hypothetical protein AMTR_s00011p00072820        95.1    1e-18   Amborella trichopoda
ref|NP_174230.2|  Kinase-related protein                              94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51735.1|AC068667_14  unknown protein; 25451-20507               94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478296.1|  PREDICTED: probable serine/threonine-protein...  94.4    2e-18   
tpg|DAA58234.1|  TPA: putative DUF1296 domain containing family p...  94.4    2e-18   
gb|EMS47817.1|  hypothetical protein TRIUR3_20557                     94.4    2e-18   Triticum urartu
ref|XP_008671999.1|  PREDICTED: uncharacterized protein LOC100191...  94.0    2e-18   
ref|XP_010460714.1|  PREDICTED: putative uncharacterized protein ...  93.6    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010460715.1|  PREDICTED: putative uncharacterized protein ...  93.6    3e-18   
gb|EEC71225.1|  hypothetical protein OsI_03160                        93.2    4e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_174229.2|  uncharacterized protein                             92.8    6e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51729.1|AC068667_8  unknown protein; 16040-11188                92.8    6e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99817.1|  BnaC05g22390D                                        92.0    7e-18   
emb|CDY48333.1|  BnaA09g26880D                                        91.7    1e-17   Brassica napus [oilseed rape]
ref|XP_008645740.1|  PREDICTED: uncharacterized protein LOC103627229  87.4    3e-17   
ref|XP_007147529.1|  hypothetical protein PHAVU_006G132200g           90.5    4e-17   Phaseolus vulgaris [French bean]
ref|XP_002440264.1|  hypothetical protein SORBIDRAFT_09g028730        89.7    6e-17   
ref|XP_006586817.1|  PREDICTED: cell wall protein AWA1-like isofo...  89.7    6e-17   Glycine max [soybeans]
ref|XP_003534759.1|  PREDICTED: cell wall protein AWA1-like isofo...  89.7    6e-17   Glycine max [soybeans]
gb|AFW71654.1|  hypothetical protein ZEAMMB73_647126                  87.8    8e-17   
ref|XP_009141365.1|  PREDICTED: RNA polymerase II degradation fac...  87.4    4e-16   Brassica rapa
ref|XP_009394232.1|  PREDICTED: uncharacterized protein LOC103979756  87.4    4e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115248.1|  PREDICTED: putative uncharacterized protein ...  86.7    6e-16   
emb|CDY61562.1|  BnaCnng37970D                                        86.3    1e-15   Brassica napus [oilseed rape]
ref|XP_008656717.1|  PREDICTED: uncharacterized protein LOC103636139  85.9    1e-15   
emb|CDY11787.1|  BnaC03g57910D                                        85.9    1e-15   Brassica napus [oilseed rape]
ref|XP_004969440.1|  PREDICTED: putative GPI-anchored protein PB1...  85.1    2e-15   Setaria italica
ref|XP_004969439.1|  PREDICTED: putative GPI-anchored protein PB1...  85.1    2e-15   Setaria italica
ref|XP_010540528.1|  PREDICTED: uncharacterized protein LOC104814266  85.1    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_009396491.1|  PREDICTED: uncharacterized protein LOC103981...  82.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396490.1|  PREDICTED: uncharacterized protein LOC103981...  82.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43685.1|  BnaA04g20060D                                        82.0    2e-14   Brassica napus [oilseed rape]
ref|XP_004961192.1|  PREDICTED: flocculation protein FLO11-like i...  82.0    2e-14   Setaria italica
ref|XP_004961191.1|  PREDICTED: flocculation protein FLO11-like i...  82.0    2e-14   Setaria italica
gb|AAL58943.1|AF462857_1  At1g29350/F15D2_27                          81.3    4e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43334.1|  BnaC03g59060D                                        80.5    7e-14   Brassica napus [oilseed rape]
emb|CDX90188.1|  BnaA08g17960D                                        80.1    9e-14   
ref|XP_009109669.1|  PREDICTED: RNA polymerase II degradation fac...  80.1    1e-13   Brassica rapa
ref|XP_009109668.1|  PREDICTED: RNA polymerase II degradation fac...  80.1    1e-13   Brassica rapa
gb|KFK36320.1|  hypothetical protein AALP_AA4G107400                  78.2    4e-13   Arabis alpina [alpine rockcress]
gb|EMS63247.1|  hypothetical protein TRIUR3_29233                     76.6    1e-12   Triticum urartu
ref|XP_006654800.1|  PREDICTED: uncharacterized protein LOC102700994  75.9    3e-12   Oryza brachyantha
ref|XP_008650021.1|  PREDICTED: cell wall protein AWA1-like           73.9    1e-11   
dbj|BAJ92311.1|  predicted protein                                    73.6    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010413764.1|  PREDICTED: probable serine/threonine-protein...  73.2    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010413763.1|  PREDICTED: alpha-protein kinase 1-like isofo...  72.8    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_003567874.1|  PREDICTED: uncharacterized protein LOC100840916  72.4    4e-11   Brachypodium distachyon [annual false brome]
dbj|BAJ85689.1|  predicted protein                                    72.0    4e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX84653.1|  BnaA03g15770D                                        72.0    4e-11   
ref|XP_009132981.1|  PREDICTED: uncharacterized protein LOC103857526  72.0    5e-11   Brassica rapa
ref|XP_007048866.1|  Uncharacterized protein TCM_001879               71.2    7e-11   
ref|XP_006410567.1|  hypothetical protein EUTSA_v10016218mg           71.2    8e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006410569.1|  hypothetical protein EUTSA_v10016218mg           70.9    9e-11   
ref|XP_010102151.1|  hypothetical protein L484_021385                 70.9    9e-11   Morus notabilis
ref|NP_001266740.1|  uncharacterized protein LOC101027201             68.9    2e-10   
ref|XP_002440322.1|  hypothetical protein SORBIDRAFT_09g029670        69.7    2e-10   
ref|XP_008655403.1|  PREDICTED: uncharacterized protein LOC101027...  69.3    3e-10   
ref|XP_008655402.1|  PREDICTED: uncharacterized protein LOC101027...  69.3    3e-10   
ref|NP_001056347.1|  Os05g0566900                                     67.8    1e-09   
gb|EEC79711.1|  hypothetical protein OsI_21014                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001141689.1|  uncharacterized protein LOC100273818             67.4    1e-09   Zea mays [maize]
ref|XP_008647566.1|  PREDICTED: uncharacterized protein LOC100273...  67.4    1e-09   Zea mays [maize]
gb|ACF86865.1|  unknown                                               67.0    2e-09   Zea mays [maize]
ref|XP_006654843.1|  PREDICTED: dentin sialophosphoprotein-like       63.9    2e-08   Oryza brachyantha
gb|AFW81250.1|  putative DUF1296 domain containing family protein     63.2    2e-08   
ref|XP_008654854.1|  PREDICTED: uncharacterized protein LOC100280...  63.2    3e-08   Zea mays [maize]
ref|XP_008654853.1|  PREDICTED: uncharacterized protein LOC100280...  63.2    3e-08   Zea mays [maize]
ref|XP_008654851.1|  PREDICTED: uncharacterized protein LOC100280...  63.2    3e-08   Zea mays [maize]
ref|XP_008229421.1|  PREDICTED: cell wall protein AWA1-like           63.2    3e-08   Prunus mume [ume]
ref|NP_001146586.1|  uncharacterized protein LOC100280182             63.2    3e-08   Zea mays [maize]
ref|XP_008654852.1|  PREDICTED: uncharacterized protein LOC100280...  63.2    3e-08   Zea mays [maize]
gb|AFW81248.1|  putative DUF1296 domain containing family protein     63.2    3e-08   
gb|AFW81251.1|  putative DUF1296 domain containing family protein     63.2    3e-08   
ref|XP_004961107.1|  PREDICTED: uncharacterized protein LOC101764...  62.0    6e-08   Setaria italica
ref|XP_004961106.1|  PREDICTED: uncharacterized protein LOC101764...  62.0    6e-08   Setaria italica
ref|XP_010230981.1|  PREDICTED: uncharacterized protein LOC100825...  60.8    2e-07   
ref|XP_003567822.1|  PREDICTED: uncharacterized protein LOC100825...  60.5    2e-07   
ref|XP_007217053.1|  hypothetical protein PRUPE_ppa001198mg           58.5    9e-07   
ref|XP_011467573.1|  PREDICTED: uncharacterized protein LOC101307...  55.5    1e-05   Fragaria vesca subsp. vesca
ref|XP_011467574.1|  PREDICTED: uncharacterized protein LOC101307...  55.1    1e-05   Fragaria vesca subsp. vesca
ref|XP_002881327.1|  hypothetical protein ARALYDRAFT_321144           55.1    1e-05   Arabidopsis lyrata subsp. lyrata
gb|EEC79757.1|  hypothetical protein OsI_21141                        54.7    2e-05   Oryza sativa Indica Group [Indian rice]
emb|CDY61669.1|  BnaC01g40800D                                        51.6    2e-04   Brassica napus [oilseed rape]
ref|XP_009356619.1|  PREDICTED: uncharacterized protein LOC103947...  50.8    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_009356617.1|  PREDICTED: uncharacterized protein LOC103947...  50.8    4e-04   Pyrus x bretschneideri [bai li]
gb|AAT44198.1|  unknown protein                                       50.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056433.1|  Os05g0581800                                     50.8    4e-04   
ref|XP_010449499.1|  PREDICTED: uncharacterized protein LOC104731...  50.8    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_008380341.1|  PREDICTED: probable GPI-anchored adhesin-lik...  50.8    4e-04   
ref|XP_009356618.1|  PREDICTED: uncharacterized protein LOC103947...  50.8    4e-04   Pyrus x bretschneideri [bai li]
ref|XP_010449498.1|  PREDICTED: uncharacterized protein LOC104731...  50.8    4e-04   Camelina sativa [gold-of-pleasure]
gb|EEE64826.1|  hypothetical protein OsJ_19683                        50.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94362.1|  predicted protein                                    50.1    6e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03133.1|  predicted protein                                    50.1    6e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010439897.1|  PREDICTED: uncharacterized protein LOC104723...  50.1    7e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010439898.1|  PREDICTED: uncharacterized protein LOC104723...  49.7    8e-04   Camelina sativa [gold-of-pleasure]
gb|KJB75412.1|  hypothetical protein B456_012G040900                  49.7    0.001   Gossypium raimondii



>emb|CDP17325.1| unnamed protein product [Coffea canephora]
Length=877

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 106/130 (82%), Gaps = 9/130 (7%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+LG DD LS+QYKD++HL+SLQQ ++SGMWLHG GSRTMSA PA+TYY+ Q QNQ
Sbjct  756  APSGTNLGYDDVLSAQYKDSNHLISLQQSDSSGMWLHGPGSRTMSAVPASTYYSFQGQNQ  815

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            QP GFRQ QQP QNY SLGY PNFYHSQTG+SLD  HQQQNPRDG L    G +Q QPK 
Sbjct  816  QPGGFRQGQQPSQNYGSLGY-PNFYHSQTGMSLD--HQQQNPRDGSL----GGSQGQPK-  867

Query  282  SSQQLWQNSY  253
             SQQ+WQNSY
Sbjct  868  QSQQIWQNSY  877



>gb|KDO78075.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=250

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  132  TTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  191

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQ
Sbjct  192  FRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQ  244

Query  270  LWQNSY  253
            LWQNSY
Sbjct  245  LWQNSY  250



>gb|KDO78070.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78071.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78072.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
 gb|KDO78073.1| hypothetical protein CISIN_1g0026401mg, partial [Citrus sinensis]
Length=304

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  186  TTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  245

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQ
Sbjct  246  FRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQ  298

Query  270  LWQNSY  253
            LWQNSY
Sbjct  299  LWQNSY  304



>ref|XP_007025176.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
 gb|EOY27798.1| Uncharacterized protein TCM_029557 [Theobroma cacao]
Length=872

 Score =   161 bits (408),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 98/126 (78%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRTMSA PA+TYY+ Q QNQQ  G
Sbjct  754  TTIGYDDVLSSQYKDSNHLMSLQQNENSAMWIHGPGSRTMSAVPASTYYSFQGQNQQAGG  813

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+S+D  HQQQNPRDG L       Q QP   +QQ
Sbjct  814  FRQGQQPSQHFGALGY-PNFYHSQTGVSMD--HQQQNPRDGSL----SGTQGQPSKQTQQ  866

Query  270  LWQNSY  253
            LWQNSY
Sbjct  867  LWQNSY  872



>ref|XP_006467530.1| PREDICTED: uncharacterized protein LOC102630898 isoform X1 [Citrus 
sinensis]
Length=869

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  751  TTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  810

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQ
Sbjct  811  FRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQ  863

Query  270  LWQNSY  253
            LWQNSY
Sbjct  864  LWQNSY  869



>ref|XP_006449624.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62864.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=863

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  745  TTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  804

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQ
Sbjct  805  FRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQ  857

Query  270  LWQNSY  253
            LWQNSY
Sbjct  858  LWQNSY  863



>ref|XP_006449625.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
 gb|ESR62865.1| hypothetical protein CICLE_v10014224mg [Citrus clementina]
Length=878

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  760  TTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  819

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQ
Sbjct  820  FRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQ  872

Query  270  LWQNSY  253
            LWQNSY
Sbjct  873  LWQNSY  878



>ref|XP_006467531.1| PREDICTED: uncharacterized protein LOC102630898 isoform X2 [Citrus 
sinensis]
Length=854

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKDN+HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  736  TTMGYDDVLGSQYKDNNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  795

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+SL+  HQQQNPRD  L    G +Q QP   +QQ
Sbjct  796  FRQGQQPSQHFGALGY-PNFYHSQTGMSLE--HQQQNPRDATL----GGSQAQPSKQTQQ  848

Query  270  LWQNSY  253
            LWQNSY
Sbjct  849  LWQNSY  854



>ref|XP_006377248.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
 gb|ERP55045.1| hypothetical protein POPTR_0011s02850g [Populus trichocarpa]
Length=894

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKD  HLMSLQQ ENS MWLHG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  775  TTIGYDDILGSQYKDASHLMSLQQNENSAMWLHGPGSRTMSAVPASTYYSFQGQNQQPGG  834

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQ
Sbjct  835  FRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQ  888

Query  270  LWQNSY  253
            LWQNSY
Sbjct  889  LWQNSY  894



>ref|XP_002317304.2| kinase-related family protein [Populus trichocarpa]
 gb|EEE97916.2| kinase-related family protein [Populus trichocarpa]
Length=909

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD L SQYKD  HLMSLQQ ENS MWLHG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  790  TTIGYDDILGSQYKDASHLMSLQQNENSAMWLHGPGSRTMSAVPASTYYSFQGQNQQPGG  849

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQ
Sbjct  850  FRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQ  903

Query  270  LWQNSY  253
            LWQNSY
Sbjct  904  LWQNSY  909



>gb|KHF99174.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=869

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 11/129 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G +D LSSQYKDN+HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  G
Sbjct  749  TTIGYEDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGG  808

Query  450  FRQVQQPP-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS--  280
            FRQ QQPP Q++ SLGY PNFYHSQTG+SLD   QQQNPRDG L      +Q QP PS  
Sbjct  809  FRQGQQPPSQHFGSLGY-PNFYHSQTGVSLD--PQQQNPRDGSL----SGSQGQP-PSKQ  860

Query  279  SQQLWQNSY  253
            +QQLWQN+Y
Sbjct  861  TQQLWQNNY  869



>gb|KJB69765.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=867

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 11/129 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKDN+HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  G
Sbjct  747  TTIGYDDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGG  806

Query  450  FRQVQQPP-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS--  280
            FRQ QQPP Q++ SLGY PNFYHSQ G+SLD   QQQNPRDG L      +Q QP PS  
Sbjct  807  FRQGQQPPSQHFGSLGY-PNFYHSQMGVSLD--PQQQNPRDGSL----SGSQGQP-PSKQ  858

Query  279  SQQLWQNSY  253
            +QQLWQN+Y
Sbjct  859  TQQLWQNNY  867



>gb|KJB69763.1| hypothetical protein B456_011G041100 [Gossypium raimondii]
Length=869

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 101/129 (78%), Gaps = 11/129 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKDN+HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  G
Sbjct  749  TTIGYDDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGG  808

Query  450  FRQVQQPP-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS--  280
            FRQ QQPP Q++ SLGY PNFYHSQ G+SLD   QQQNPRDG L      +Q QP PS  
Sbjct  809  FRQGQQPPSQHFGSLGY-PNFYHSQMGVSLD--PQQQNPRDGSL----SGSQGQP-PSKQ  860

Query  279  SQQLWQNSY  253
            +QQLWQN+Y
Sbjct  861  TQQLWQNNY  869



>ref|XP_006355598.1| PREDICTED: signaling mucin HKR1-like [Solanum tuberosum]
Length=836

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 100/128 (78%), Gaps = 8/128 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  713  APSGTNLSYDDMLSSQYKDTNHLMSLQQSENSAMWLHGPGSRTMSAVPANTYYAFQGQNQ  772

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q SGFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRD   G  GG +Q QPKP
Sbjct  773  QSSGFRQAQQPLQNHGSLGY-PNFYHSQAGISLE--HQQQNPRD---GSLGGGSQGQPKP  826

Query  282  SSQQLWQN  259
             SQQLWQ+
Sbjct  827  -SQQLWQS  833



>ref|XP_009785957.1| PREDICTED: uncharacterized protein LOC104234138 isoform X2 [Nicotiana 
sylvestris]
Length=841

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  719  APSGTNLSYDDMLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  778

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG LG   G  +     
Sbjct  779  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSLGASQGQPKQS---  832

Query  282  SSQQLWQNSY  253
              QQLWQNSY
Sbjct  833  -QQQLWQNSY  841



>ref|XP_009785950.1| PREDICTED: uncharacterized protein LOC104234138 isoform X1 [Nicotiana 
sylvestris]
Length=843

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  721  APSGTNLSYDDMLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  780

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG LG   G  +     
Sbjct  781  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSLGASQGQPKQS---  834

Query  282  SSQQLWQNSY  253
              QQLWQNSY
Sbjct  835  -QQQLWQNSY  843



>ref|XP_009785963.1| PREDICTED: uncharacterized protein LOC104234138 isoform X3 [Nicotiana 
sylvestris]
Length=780

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 96/130 (74%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  658  APSGTNLSYDDMLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  717

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG LG   G  +     
Sbjct  718  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSLGASQGQPKQS---  771

Query  282  SSQQLWQNSY  253
              QQLWQNSY
Sbjct  772  -QQQLWQNSY  780



>ref|XP_009614040.1| PREDICTED: uncharacterized protein LOC104107048 isoform X1 [Nicotiana 
tomentosiformis]
Length=841

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 100/130 (77%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  719  APSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  778

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK 
Sbjct  779  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQ  831

Query  282  SSQQLWQNSY  253
            S QQLWQNSY
Sbjct  832  SQQQLWQNSY  841



>ref|XP_009614041.1| PREDICTED: uncharacterized protein LOC104107048 isoform X2 [Nicotiana 
tomentosiformis]
Length=839

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 100/130 (77%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  717  APSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  776

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK 
Sbjct  777  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQ  829

Query  282  SSQQLWQNSY  253
            S QQLWQNSY
Sbjct  830  SQQQLWQNSY  839



>ref|XP_009614044.1| PREDICTED: uncharacterized protein LOC104107048 isoform X4 [Nicotiana 
tomentosiformis]
Length=783

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 100/130 (77%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  661  APSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  720

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK 
Sbjct  721  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQ  773

Query  282  SSQQLWQNSY  253
            S QQLWQNSY
Sbjct  774  SQQQLWQNSY  783



>emb|CBI30819.3| unnamed protein product [Vitis vinifera]
Length=799

 Score =   153 bits (386),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 99/130 (76%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            A  T++G DD ++SQYKD +HL+SLQQ  ENS MW+HG GSRTMSA PANTYY+ Q QNQ
Sbjct  677  AAGTTIGYDDVINSQYKDGNHLISLQQQNENSAMWVHGPGSRTMSAVPANTYYSFQGQNQ  736

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            QP GFRQ QQP Q++ +LGY PNFYHSQ GISL+  HQQQNPRDG L G  G A  Q   
Sbjct  737  QPGGFRQGQQPSQHFGALGY-PNFYHSQAGISLE--HQQQNPRDGSLSGSQGQASKQ---  790

Query  282  SSQQLWQNSY  253
             SQQ+WQN+Y
Sbjct  791  -SQQIWQNNY  799



>ref|XP_009614043.1| PREDICTED: uncharacterized protein LOC104107048 isoform X3 [Nicotiana 
tomentosiformis]
Length=789

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 100/130 (77%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MWLHG GSRTMSA PANTYY  Q QNQ
Sbjct  667  APSGTNLSYDDVLSSQYKDTNHLMSLQQGENSAMWLHGPGSRTMSAVPANTYYGFQGQNQ  726

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRDG L    G +Q QPK 
Sbjct  727  QSGGFRQAQQPMQNHGSLGY-PNFYHSQAGISLE--HQQQNPRDGSL----GGSQGQPKQ  779

Query  282  SSQQLWQNSY  253
            S QQLWQNSY
Sbjct  780  SQQQLWQNSY  789



>ref|XP_010655630.1| PREDICTED: protein lingerer-like [Vitis vinifera]
Length=886

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 99/130 (76%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            A  T++G DD ++SQYKD +HL+SLQQ  ENS MW+HG GSRTMSA PANTYY+ Q QNQ
Sbjct  764  AAGTTIGYDDVINSQYKDGNHLISLQQQNENSAMWVHGPGSRTMSAVPANTYYSFQGQNQ  823

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            QP GFRQ QQP Q++ +LGY PNFYHSQ GISL+  HQQQNPRDG L G  G A  Q   
Sbjct  824  QPGGFRQGQQPSQHFGALGY-PNFYHSQAGISLE--HQQQNPRDGSLSGSQGQASKQ---  877

Query  282  SSQQLWQNSY  253
             SQQ+WQN+Y
Sbjct  878  -SQQIWQNNY  886



>gb|KHN48057.1| hypothetical protein glysoja_015527 [Glycine soja]
Length=817

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD ++SQYKDN+H++SLQQ ENS MW+HG  SRTMSA PANTYY+ Q QNQQP 
Sbjct  697  STTIGYDDVINSQYKDNNHMISLQQNENSPMWVHGPSSRTMSAIPANTYYSFQGQNQQPG  756

Query  453  GFRQVQQPPQ-NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            GFRQ QQP Q ++ SLGY PNFYHSQTGISL+  HQQQNPR+  L      +Q QP   S
Sbjct  757  GFRQNQQPSQQHFGSLGY-PNFYHSQTGISLE--HQQQNPREASL----AGSQTQPPKQS  809

Query  276  QQLWQNSY  253
             Q+WQNSY
Sbjct  810  PQIWQNSY  817



>ref|XP_011045309.1| PREDICTED: uncharacterized protein LOC105140253 isoform X2 [Populus 
euphratica]
Length=871

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T+LG DD L SQYKD  +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP G
Sbjct  752  TTLGYDDILGSQYKDASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGG  811

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQ
Sbjct  812  FRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQ  865

Query  270  LWQNSY  253
            LWQNSY
Sbjct  866  LWQNSY  871



>ref|XP_011045308.1| PREDICTED: uncharacterized protein LOC105140253 isoform X1 [Populus 
euphratica]
Length=872

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T+LG DD L SQYKD  +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP G
Sbjct  753  TTLGYDDILGSQYKDASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGG  812

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQ
Sbjct  813  FRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQ  866

Query  270  LWQNSY  253
            LWQNSY
Sbjct  867  LWQNSY  872



>ref|XP_011045310.1| PREDICTED: uncharacterized protein LOC105140253 isoform X3 [Populus 
euphratica]
Length=841

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T+LG DD L SQYKD  +L+SLQQ ENS MWLHG GSRTMSA P +TYY+ Q QNQQP G
Sbjct  722  TTLGYDDILGSQYKDASNLISLQQNENSAMWLHGPGSRTMSAVPGSTYYSFQGQNQQPGG  781

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PN+YHSQTG+SL+ H QQQN RDG L    G +Q QP   +QQ
Sbjct  782  FRQGQQPSQHFGALGY-PNYYHSQTGMSLE-HQQQQNSRDGSL----GGSQGQPSKQAQQ  835

Query  270  LWQNSY  253
            LWQNSY
Sbjct  836  LWQNSY  841



>gb|KDP21205.1| hypothetical protein JCGZ_21676 [Jatropha curcas]
Length=866

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T+LG DD LSSQYKD +HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQP G
Sbjct  748  TTLGYDDVLSSQYKDGNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQPGG  807

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQ  Q++ +LGY PN+YHSQTGISL+  HQQQN RD  L    G +Q QP   +QQ
Sbjct  808  FRQGQQLSQHFGALGY-PNYYHSQTGISLE--HQQQNSRDASL----GGSQGQPSKQTQQ  860

Query  270  LWQNSY  253
            LWQNSY
Sbjct  861  LWQNSY  866



>ref|XP_011005847.1| PREDICTED: uncharacterized protein LOC105112008 isoform X3 [Populus 
euphratica]
Length=869

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  
Sbjct  751  TTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGV  810

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ + GY PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQ
Sbjct  811  FRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQ  863

Query  270  LWQNSY  253
            LWQNSY
Sbjct  864  LWQNSY  869



>ref|XP_011005848.1| PREDICTED: uncharacterized protein LOC105112008 isoform X4 [Populus 
euphratica]
Length=868

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  
Sbjct  750  TTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGV  809

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ + GY PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQ
Sbjct  810  FRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQ  862

Query  270  LWQNSY  253
            LWQNSY
Sbjct  863  LWQNSY  868



>ref|XP_011005846.1| PREDICTED: uncharacterized protein LOC105112008 isoform X2 [Populus 
euphratica]
Length=874

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  
Sbjct  756  TTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGV  815

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ + GY PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQ
Sbjct  816  FRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQ  868

Query  270  LWQNSY  253
            LWQNSY
Sbjct  869  LWQNSY  874



>ref|XP_011005845.1| PREDICTED: uncharacterized protein LOC105112008 isoform X1 [Populus 
euphratica]
Length=875

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  
Sbjct  757  TTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSRTMSALPASTYYNFQGQNQQPGV  816

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ + GY PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQ
Sbjct  817  FRQSQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQ  869

Query  270  LWQNSY  253
            LWQNSY
Sbjct  870  LWQNSY  875



>ref|XP_008225365.1| PREDICTED: dentin sialophosphoprotein isoform X1 [Prunus mume]
Length=861

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD ++SQYKDN HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +G
Sbjct  741  TTIGYDDVINSQYKDNSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAG  800

Query  450  FRQVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            FRQ QQP Q +A +LGY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQ
Sbjct  801  FRQAQQPSQQFAGALGYPPNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQ  854

Query  273  QLWQNSY  253
            QLWQN+Y
Sbjct  855  QLWQNTY  861



>ref|XP_008225366.1| PREDICTED: dentin sialophosphoprotein isoform X2 [Prunus mume]
Length=860

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 7/127 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD ++SQYKDN HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +G
Sbjct  740  TTIGYDDVINSQYKDNSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAG  799

Query  450  FRQVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            FRQ QQP Q +A +LGY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQ
Sbjct  800  FRQAQQPSQQFAGALGYPPNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQ  853

Query  273  QLWQNSY  253
            QLWQN+Y
Sbjct  854  QLWQNTY  860



>ref|XP_006369885.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
 gb|ERP66454.1| hypothetical protein POPTR_0001s34440g [Populus trichocarpa]
Length=867

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD  HL+SLQQ ENS MW+HG GSRTMSA PA+TYYN Q QNQQP  
Sbjct  749  TTIGYDDVLSSQYKDASHLISLQQNENSAMWMHGPGSRTMSAVPASTYYNFQGQNQQPGV  808

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ + GY PN+YHSQ+G+SL+  HQQQN RDG L    G +Q QP   +QQ
Sbjct  809  FRQGQQPSQHFGAPGY-PNYYHSQSGMSLE--HQQQNTRDGSL----GGSQGQPSKQAQQ  861

Query  270  LWQNSY  253
            LWQN Y
Sbjct  862  LWQNGY  867



>gb|KHF99173.1| hypothetical protein F383_17166 [Gossypium arboreum]
Length=891

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G +D LSSQYKDN+HLMSLQQ ENSGMW+HG GSRTMSA PA+TYY+ Q QNQQ  G
Sbjct  749  TTIGYEDVLSSQYKDNNHLMSLQQNENSGMWIHGPGSRTMSAVPASTYYSFQGQNQQAGG  808

Query  450  FRQVQQPP-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  322
            FRQ QQPP Q++ SLGY PNFYHSQTG+SLD   QQQNPRDG L
Sbjct  809  FRQGQQPPSQHFGSLGY-PNFYHSQTGVSLD--PQQQNPRDGSL  849



>ref|XP_007214618.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
 gb|EMJ15817.1| hypothetical protein PRUPE_ppa001304mg [Prunus persica]
Length=859

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 8/127 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD ++SQYKDN HL+SLQQ +NSGMW+HG GSR MSA PA+TYY+ Q QNQQ +G
Sbjct  740  TTIGYDDVINSQYKDNSHLISLQQNDNSGMWVHGPGSRAMSAVPASTYYSFQGQNQQHAG  799

Query  450  FRQVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            FRQ QQP Q +A +LGY PNFYHSQTG+SL+  HQQQ+ RD  L    G +Q QP   SQ
Sbjct  800  FRQAQQPSQQFAGALGY-PNFYHSQTGMSLE--HQQQSSRDTSL----GGSQGQPSKQSQ  852

Query  273  QLWQNSY  253
            QLWQN+Y
Sbjct  853  QLWQNTY  859



>ref|XP_002519742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42715.1| conserved hypothetical protein [Ricinus communis]
Length=849

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 8/130 (6%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            A  T++G DDGLSSQYKD +HL+SLQQ +NS MW+HG GSRTMSA PA+TYY+ Q QNQQ
Sbjct  727  AGGTTIGYDDGLSSQYKDGNHLISLQQNDNSAMWVHGPGSRTMSAVPASTYYSFQGQNQQ  786

Query  459  PSGFRQVQQPPQ-NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            P+G+RQ QQ  Q ++ +LGY PN+YHSQTGISL+   QQQN R+G L    G +Q QP  
Sbjct  787  PAGYRQGQQLSQQHFGALGY-PNYYHSQTGISLE--LQQQNSREGSL----GGSQGQPSK  839

Query  282  SSQQLWQNSY  253
             +QQLWQNSY
Sbjct  840  QTQQLWQNSY  849



>ref|XP_004232971.1| PREDICTED: uncharacterized protein LOC101252351 [Solanum lycopersicum]
Length=833

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 97/128 (76%), Gaps = 9/128 (7%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS MW HG GSRTMSA PANTYY  Q QNQ
Sbjct  711  APSGTNLSYDDVLSSQYKDTNHLMSLQQSENSAMW-HGPGSRTMSAVPANTYYGFQGQNQ  769

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q SGFRQ QQP QN+ SLGY PNFYHSQ GISL+  HQQQNPRD   G  GG +Q QPK 
Sbjct  770  QSSGFRQAQQPLQNHGSLGY-PNFYHSQAGISLE--HQQQNPRD---GSLGGGSQGQPK-  822

Query  282  SSQQLWQN  259
              QQLWQ+
Sbjct  823  QFQQLWQS  830



>ref|XP_011460396.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101310004 
[Fragaria vesca subsp. vesca]
Length=841

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 94/128 (73%), Gaps = 8/128 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G DD +SSQYKD++HLMSLQQ  +NSGMW+HG GSR M A PA+ YY+ Q QNQQ +
Sbjct  720  TTIGYDDVISSQYKDSNHLMSLQQQNDNSGMWVHGPGSRAMPAVPASNYYSFQGQNQQHA  779

Query  453  GFRQVQQPPQNYASLGYN-PNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            GFRQ QQP Q +A    N PNFYHSQTG+SLD  HQQQ+ RD  L    G +Q QP   S
Sbjct  780  GFRQTQQPSQQFAGAALNYPNFYHSQTGMSLD--HQQQSSRDASL----GGSQGQPSKQS  833

Query  276  QQLWQNSY  253
            QQLWQNSY
Sbjct  834  QQLWQNSY  841



>ref|XP_007159534.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
 gb|ESW31528.1| hypothetical protein PHAVU_002G245500g [Phaseolus vulgaris]
Length=847

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 8/128 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD ++SQYKDN+H++SLQQ ENS MW+HG  SRTMSA P +TYY+ Q QNQQ  
Sbjct  727  STTIGYDDVINSQYKDNNHMISLQQNENSPMWVHGPSSRTMSAVPPSTYYSFQGQNQQAG  786

Query  453  GFRQV-QQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            GFRQ  QQP Q++ SLGY PNFYHSQ+G+SL+  H QQNPR+  L    G +Q QP   +
Sbjct  787  GFRQSPQQPSQHFGSLGY-PNFYHSQSGVSLE--HPQQNPREATL----GGSQSQPPKQT  839

Query  276  QQLWQNSY  253
             Q+WQNSY
Sbjct  840  PQIWQNSY  847



>ref|XP_006356118.1| PREDICTED: cell wall protein AWA1-like [Solanum tuberosum]
Length=845

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 95/130 (73%), Gaps = 6/130 (5%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LS+Q+KD +HLMSLQQ ENS +WLHG GSRTMSA PANTYY  Q QNQ
Sbjct  721  APSGTNLSYDDVLSAQFKDTNHLMSLQQNENSALWLHGPGSRTMSAVPANTYYGFQGQNQ  780

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP Q+Y SLG  P+FY+SQ GISLD   QQQN RDG L      +Q QPK 
Sbjct  781  QTGGFRQGQQPSQSYGSLGGYPHFYNSQAGISLD-QQQQQNLRDGSL----SGSQGQPKQ  835

Query  282  SSQQLWQNSY  253
            S QQLWQN Y
Sbjct  836  SQQQLWQNGY  845



>ref|XP_010317412.1| PREDICTED: uncharacterized protein LOC101266097 isoform X2 [Solanum 
lycopersicum]
Length=822

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LS+Q+KD +HLMSLQQ ENS +WLHGHGSRTM   PANTYY  Q QNQ
Sbjct  698  APSGTNLSYDDVLSAQFKDTNHLMSLQQNENSALWLHGHGSRTMPTVPANTYYGFQGQNQ  757

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP Q+Y SLG  P+FY+SQ GISLD   QQ+N RDG L G  G  +     
Sbjct  758  QTGGFRQGQQPSQSYGSLGGYPHFYNSQAGISLD-QQQQENLRDGSLSGSQGQPKQS---  813

Query  282  SSQQLWQNSY  253
              QQLWQN Y
Sbjct  814  -QQQLWQNGY  822



>ref|XP_004234052.1| PREDICTED: uncharacterized protein LOC101266097 isoform X1 [Solanum 
lycopersicum]
Length=843

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 91/130 (70%), Gaps = 6/130 (5%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LS+Q+KD +HLMSLQQ ENS +WLHGHGSRTM   PANTYY  Q QNQ
Sbjct  719  APSGTNLSYDDVLSAQFKDTNHLMSLQQNENSALWLHGHGSRTMPTVPANTYYGFQGQNQ  778

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFRQ QQP Q+Y SLG  P+FY+SQ GISLD   QQ+N RDG L G  G  +     
Sbjct  779  QTGGFRQGQQPSQSYGSLGGYPHFYNSQAGISLD-QQQQENLRDGSLSGSQGQPKQS---  834

Query  282  SSQQLWQNSY  253
              QQLWQN Y
Sbjct  835  -QQQLWQNGY  843



>ref|XP_006580202.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Glycine 
max]
Length=845

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 96/128 (75%), Gaps = 8/128 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD ++SQ+K+N+H++SLQQ ENS MW+HG  SRTMSA P +TYY+ Q QNQQP 
Sbjct  725  STTIGYDDVINSQFKENNHIISLQQNENSPMWVHGPSSRTMSAVPPSTYYSFQGQNQQPG  784

Query  453  GFRQVQQPPQ-NYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            GFRQ QQP Q ++ SLGY PNFYHSQTGISL+  HQQQNPR+  L G       Q    S
Sbjct  785  GFRQSQQPSQQHFGSLGY-PNFYHSQTGISLE--HQQQNPREASLAGSQSQPPKQ----S  837

Query  276  QQLWQNSY  253
            QQ+WQNSY
Sbjct  838  QQIWQNSY  845



>ref|XP_008439672.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Cucumis melo]
Length=847

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SG
Sbjct  729  SSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSG  788

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q Y +LGY PNFYHSQ GISLD   QQQ  RD  LGG  G    Q    SQQ
Sbjct  789  FRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTLRDASLGGSQGQQPKQ----SQQ  841

Query  270  LWQNSY  253
            +WQNSY
Sbjct  842  IWQNSY  847



>ref|XP_008439673.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=846

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SG
Sbjct  728  SSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSG  787

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q Y +LGY PNFYHSQ GISLD   QQQ  RD  LGG  G    Q    SQQ
Sbjct  788  FRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTLRDASLGGSQGQQPKQ----SQQ  840

Query  270  LWQNSY  253
            +WQNSY
Sbjct  841  IWQNSY  846



>ref|XP_004134562.1| PREDICTED: uncharacterized protein LOC101211388 [Cucumis sativus]
Length=845

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SG
Sbjct  727  SSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSG  786

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q Y +LGY PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ
Sbjct  787  FRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQ  839

Query  270  LWQNSY  253
            +WQNSY
Sbjct  840  IWQNSY  845



>ref|XP_004162612.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224560 
[Cucumis sativus]
Length=844

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SG
Sbjct  726  SSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSG  785

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q Y +LGY PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ
Sbjct  786  FRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQ  838

Query  270  LWQNSY  253
            +WQNSY
Sbjct  839  IWQNSY  844



>gb|KGN49366.1| hypothetical protein Csa_6G522110 [Cucumis sativus]
Length=905

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            +S+G +D +SSQYKD++HL+SLQQ +N  MW+HG GSRTMSA PA+ YY +Q QNQQ SG
Sbjct  787  SSIGYEDAISSQYKDSNHLLSLQQNDNPAMWIHGPGSRTMSAVPASAYYGLQGQNQQSSG  846

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q Y +LGY PNFYHSQ GISLD   QQQ  RD  L    G +Q Q    SQQ
Sbjct  847  FRQAQQPSQQYGALGY-PNFYHSQAGISLD--GQQQTLRDASL----GGSQGQQPKQSQQ  899

Query  270  LWQNSY  253
            +WQNSY
Sbjct  900  IWQNSY  905



>ref|XP_011096498.1| PREDICTED: uncharacterized protein LOC105175670 isoform X2 [Sesamum 
indicum]
Length=842

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 90/127 (71%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPS  454
            T+L  DD L+SQYKD+ HL+SLQQ EN  +WLHG  SRTMSA PA+TYYN      Q   
Sbjct  726  TTLSYDDVLNSQYKDSSHLVSLQQNENPALWLHGANSRTMSAVPASTYYNYQGQNQQTGG  785

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ QQP QNY SLGY PNFYHSQTGI+LD   QQQNPRD PL    G +Q QPK S  
Sbjct  786  GMRQAQQPSQNYGSLGY-PNFYHSQTGIALD---QQQNPRDAPL----GGSQGQPKQS--  835

Query  273  QLWQNSY  253
            Q+WQNSY
Sbjct  836  QIWQNSY  842



>ref|XP_011096496.1| PREDICTED: uncharacterized protein LOC105175670 isoform X1 [Sesamum 
indicum]
Length=843

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 90/127 (71%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPS  454
            T+L  DD L+SQYKD+ HL+SLQQ EN  +WLHG  SRTMSA PA+TYYN      Q   
Sbjct  727  TTLSYDDVLNSQYKDSSHLVSLQQNENPALWLHGANSRTMSAVPASTYYNYQGQNQQTGG  786

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ QQP QNY SLGY PNFYHSQTGI+LD   QQQNPRD PL    G +Q QPK S  
Sbjct  787  GMRQAQQPSQNYGSLGY-PNFYHSQTGIALD---QQQNPRDAPL----GGSQGQPKQS--  836

Query  273  QLWQNSY  253
            Q+WQNSY
Sbjct  837  QIWQNSY  843



>ref|XP_010275810.1| PREDICTED: uncharacterized protein LOC104610735 isoform X2 [Nelumbo 
nucifera]
Length=889

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 7/127 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD +SSQYKD +  + LQQ ENSGMW+HG GSRTMSA P +TYY+ Q Q+QQ  
Sbjct  770  STTIGYDDVISSQYKDGNQFIPLQQNENSGMWVHGLGSRTMSALPGSTYYSFQGQSQQHG  829

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q+Y +LGY PNFY SQTG+S    H QQNP DG LGG  G +  Q    S 
Sbjct  830  GFRQGQQPSQHYGALGY-PNFYQSQTGVS--QEHPQQNPNDGTLGGSQGASAKQ----SH  882

Query  273  QLWQNSY  253
            Q+WQ++Y
Sbjct  883  QIWQHNY  889



>ref|XP_010275801.1| PREDICTED: uncharacterized protein LOC104610735 isoform X1 [Nelumbo 
nucifera]
Length=907

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 7/127 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD +SSQYKD +  + LQQ ENSGMW+HG GSRTMSA P +TYY+ Q Q+QQ  
Sbjct  788  STTIGYDDVISSQYKDGNQFIPLQQNENSGMWVHGLGSRTMSALPGSTYYSFQGQSQQHG  847

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q+Y +LGY PNFY SQTG+S    H QQNP DG LGG  G +  Q    S 
Sbjct  848  GFRQGQQPSQHYGALGY-PNFYQSQTGVS--QEHPQQNPNDGTLGGSQGASAKQ----SH  900

Query  273  QLWQNSY  253
            Q+WQ++Y
Sbjct  901  QIWQHNY  907



>ref|XP_010243690.1| PREDICTED: uncharacterized protein LOC104587685 isoform X2 [Nelumbo 
nucifera]
Length=855

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 88/127 (69%), Gaps = 7/127 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD +SSQYKD +H + LQQ +NS MW+HG GSRTMSA PA+TYY+ Q Q+QQ  
Sbjct  736  STTIGYDDVISSQYKDGNHFIPLQQNDNSAMWVHGPGSRTMSALPASTYYSFQGQSQQHG  795

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q+Y +LGY PNFY SQ  +S    H QQNP DG L      +Q  P   S 
Sbjct  796  GFRQAQQPSQHYGALGY-PNFYQSQPRVS--QEHPQQNPNDGTL----AGSQGVPTKQSH  848

Query  273  QLWQNSY  253
            Q+WQ++Y
Sbjct  849  QIWQHNY  855



>ref|XP_010243689.1| PREDICTED: uncharacterized protein LOC104587685 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 88/127 (69%), Gaps = 7/127 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD +SSQYKD +H + LQQ +NS MW+HG GSRTMSA PA+TYY+ Q Q+QQ  
Sbjct  756  STTIGYDDVISSQYKDGNHFIPLQQNDNSAMWVHGPGSRTMSALPASTYYSFQGQSQQHG  815

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q+Y +LGY PNFY SQ  +S    H QQNP DG L      +Q  P   S 
Sbjct  816  GFRQAQQPSQHYGALGY-PNFYQSQPRVS--QEHPQQNPNDGTL----AGSQGVPTKQSH  868

Query  273  QLWQNSY  253
            Q+WQ++Y
Sbjct  869  QIWQHNY  875



>ref|XP_009790935.1| PREDICTED: uncharacterized protein LOC104238306 [Nicotiana sylvestris]
Length=852

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 92/131 (70%), Gaps = 6/131 (5%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS +W HG GSRTMSA PANTYY  Q QNQ
Sbjct  726  APSGTNLSYDDVLSSQYKDTNHLMSLQQSENSALWHHGLGSRTMSAVPANTYYGFQGQNQ  785

Query  462  QPS-GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            Q + GFRQ QQP Q+Y SL   P+FY+SQ GISLD   QQQN RD         +Q QPK
Sbjct  786  QTAGGFRQGQQPSQSYGSLAGYPHFYNSQAGISLD-QQQQQNLRDA---ASLAGSQGQPK  841

Query  285  PSSQQLWQNSY  253
             S QQ+WQN Y
Sbjct  842  QSQQQIWQNGY  852



>emb|CBI20348.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 8/111 (7%)
 Frame = -1

Query  594  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPPQNY  418
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q QNQQP GFRQ  QP Q++
Sbjct  74   YKNGNHLISFQQQNENSTMWNHGPGSQTMSAVPANTYYSFQGQNQQPGGFRQGHQPSQHF  133

Query  417  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  265
              LGY PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  134  GVLGY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  177



>gb|KJB57294.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=722

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  G
Sbjct  604  TTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGG  663

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQ
Sbjct  664  FRQGQQPSQHFGALGY-PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQ  716

Query  270  LWQNSY  253
            LWQN+Y
Sbjct  717  LWQNNY  722



>gb|KJB57297.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57298.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=761

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  G
Sbjct  643  TTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGG  702

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQ
Sbjct  703  FRQGQQPSQHFGALGY-PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQ  755

Query  270  LWQNSY  253
            LWQN+Y
Sbjct  756  LWQNNY  761



>gb|KJB57295.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
 gb|KJB57300.1| hypothetical protein B456_009G157400 [Gossypium raimondii]
Length=869

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  G
Sbjct  751  TTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGG  810

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q++ +LGY PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQ
Sbjct  811  FRQGQQPSQHFGALGY-PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQ  863

Query  270  LWQNSY  253
            LWQN+Y
Sbjct  864  LWQNNY  869



>gb|KHG18569.1| Protein translocase subunit SecA [Gossypium arboreum]
Length=851

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 93/126 (74%), Gaps = 7/126 (6%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T++G DD LSSQYKD++HLMSLQQ ENS MW+HG GSRTMSA P + YY+ Q QNQQ  G
Sbjct  733  TTIGYDDILSSQYKDSNHLMSLQQTENSAMWVHGPGSRTMSAVPGSNYYSFQGQNQQGGG  792

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
            FRQ QQP Q + +LGY PNFYHSQTG+  D  HQQQNP DG L      +Q QP   +QQ
Sbjct  793  FRQGQQPSQQFGALGY-PNFYHSQTGVLGD--HQQQNPMDGSL----SGSQGQPSKQTQQ  845

Query  270  LWQNSY  253
            LWQN+Y
Sbjct  846  LWQNNY  851



>ref|XP_008349816.1| PREDICTED: serine/threonine-protein kinase CBK1-like [Malus domestica]
Length=208

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQYKDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  82   TTMGYDDVVNSQYKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  141

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-  289
            +GFR  Q   P Q YA +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP 
Sbjct  142  AGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPS  196

Query  288  KPSSQQLWQNSY  253
            K S QQLWQNSY
Sbjct  197  KQSQQQLWQNSY  208



>ref|XP_010926244.1| PREDICTED: uncharacterized protein LOC105048593 [Elaeis guineensis]
Length=886

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 89/127 (70%), Gaps = 10/127 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+Y+ Q Q+Q  S
Sbjct  770  STTIGFDESLSSQYKEANHYMPLQQNDNPAMWVHGAGSRTMSALPASTFYSFQGQSQH-S  828

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q + +LGY PNFYHSQ GIS +H   QQNP +G L      +Q  P   S 
Sbjct  829  GFRQSQQPSQ-FGALGY-PNFYHSQAGISQEH---QQNPGEGNL----NGSQATPSQPSH  879

Query  273  QLWQNSY  253
            Q+WQ+SY
Sbjct  880  QIWQHSY  886



>ref|XP_008797517.1| PREDICTED: uncharacterized protein LOC103712704 isoform X2 [Phoenix 
dactylifera]
Length=733

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 88/127 (69%), Gaps = 10/127 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+YN Q Q+Q  S
Sbjct  617  STTIGFDESLSSQYKEANHYMPLQQTDNPAMWVHGAGSRTMSALPASTFYNFQGQSQH-S  675

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q + + GY PNFYHSQ G+S +H   QQNP +G L      +Q  P   S 
Sbjct  676  GFRQGQQPSQ-FGAPGY-PNFYHSQAGVSQEH---QQNPGEGNL----NGSQATPSQPSH  726

Query  273  QLWQNSY  253
            Q+WQ+SY
Sbjct  727  QIWQHSY  733



>ref|XP_008797516.1| PREDICTED: uncharacterized protein LOC103712704 isoform X1 [Phoenix 
dactylifera]
Length=893

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 88/127 (69%), Gaps = 10/127 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+YN Q Q+Q  S
Sbjct  777  STTIGFDESLSSQYKEANHYMPLQQTDNPAMWVHGAGSRTMSALPASTFYNFQGQSQH-S  835

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q + + GY PNFYHSQ G+S +H   QQNP +G L      +Q  P   S 
Sbjct  836  GFRQGQQPSQ-FGAPGY-PNFYHSQAGVSQEH---QQNPGEGNL----NGSQATPSQPSH  886

Query  273  QLWQNSY  253
            Q+WQ+SY
Sbjct  887  QIWQHSY  893



>ref|XP_003629905.1| hypothetical protein MTR_8g088190 [Medicago truncatula]
 gb|AET04381.1| plant/F15D2-27 protein [Medicago truncatula]
Length=865

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 92/129 (71%), Gaps = 8/129 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQN-QQP  457
            ST++G DD ++SQYKDN+H++SLQQ EN+ MW+ G GSRTMS  P+ TYY+ Q QN QQP
Sbjct  743  STTIGYDDVINSQYKDNNHMISLQQNENNPMWVQGPGSRTMSVPPS-TYYSFQGQNQQQP  801

Query  456  SGFRQVQQPP-QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
              FRQ QQP  Q++A  GY  NFYHSQ+GISL+  HQQQNPRD  L G       Q   S
Sbjct  802  GAFRQSQQPSQQHFAPHGYPNNFYHSQSGISLE--HQQQNPRDASLAGSQSQPPKQ---S  856

Query  279  SQQLWQNSY  253
             QQLWQNSY
Sbjct  857  QQQLWQNSY  865



>ref|XP_008364176.1| PREDICTED: uncharacterized protein LOC103427870 isoform X3 [Malus 
domestica]
Length=856

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 95/131 (73%), Gaps = 10/131 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G DD ++SQYKDN HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +
Sbjct  731  TTMGYDDVVNSQYKDNSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHA  790

Query  453  GFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-K  286
            GFR  Q   P Q YA +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K
Sbjct  791  GFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSK  845

Query  285  PSSQQLWQNSY  253
             S QQLWQNSY
Sbjct  846  QSQQQLWQNSY  856



>ref|XP_008364175.1| PREDICTED: uncharacterized protein LOC103427870 isoform X2 [Malus 
domestica]
Length=857

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 95/131 (73%), Gaps = 10/131 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G DD ++SQYKDN HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +
Sbjct  732  TTMGYDDVVNSQYKDNSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHA  791

Query  453  GFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-K  286
            GFR  Q   P Q YA +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP K
Sbjct  792  GFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPSK  846

Query  285  PSSQQLWQNSY  253
             S QQLWQNSY
Sbjct  847  QSQQQLWQNSY  857



>ref|XP_010538220.1| PREDICTED: uncharacterized protein LOC104812645 isoform X1 [Tarenaya 
hassleriana]
Length=818

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 87/130 (67%), Gaps = 19/130 (15%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQ--VENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQ  460
            TSLG ++ LSSQYK+++H++SLQQ   ENS MWLH GHGSRTMS  P N YYN+Q Q Q 
Sbjct  701  TSLGYEEALSSQYKESNHMLSLQQHQQENSPMWLHNGHGSRTMSTVPTNGYYNLQPQQQG  760

Query  459  PSGFRQVQ-QPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            P  FR  Q Q  Q+Y SLGY PNFYH QTGIS++ HH  QNPRDG              P
Sbjct  761  PE-FRHSQPQASQHYGSLGY-PNFYHPQTGISIE-HHPPQNPRDG------------GPP  805

Query  282  SSQQLWQNSY  253
            S QQ+WQN Y
Sbjct  806  SKQQIWQNPY  815



>ref|XP_008364174.1| PREDICTED: uncharacterized protein LOC103427870 isoform X1 [Malus 
domestica]
Length=857

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQYKDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  731  TTMGYDDVVNSQYKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  790

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP-  289
            +GFR  Q   P Q YA +LGY PNFYHSQTG+SL+ H QQQ+ RD  LG   G    QP 
Sbjct  791  AGFRQAQQPPPSQQYAGTLGY-PNFYHSQTGMSLE-HQQQQSSRDASLGXSQGG---QPS  845

Query  288  KPSSQQLWQNSY  253
            K S QQLWQNSY
Sbjct  846  KQSQQQLWQNSY  857



>ref|XP_010924304.1| PREDICTED: signaling mucin HKR1-like [Elaeis guineensis]
Length=887

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 88/127 (69%), Gaps = 10/127 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G+++ LSSQYK+ +H M LQQ +N  MW+HG GSRTMSA PA+T+Y+ Q QNQ  S
Sbjct  771  STTIGLEEALSSQYKEANHYMPLQQADNPAMWVHGAGSRTMSALPASTFYSFQGQNQH-S  829

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q + +LGY PNFY SQ G+S +H   QQNP +G L      +Q  P   S 
Sbjct  830  GFRQGQQPSQ-FGALGY-PNFYPSQGGVSQEH---QQNPSEGNLSV----SQAAPSQPSH  880

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  881  QMWQHGY  887



>ref|XP_010538221.1| PREDICTED: uncharacterized protein LOC104812645 isoform X2 [Tarenaya 
hassleriana]
Length=817

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 87/129 (67%), Gaps = 18/129 (14%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQ-VENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQP  457
            TSLG ++ LSSQYK+++H++SLQQ  +NS MWLH GHGSRTMS  P N YYN+Q Q Q P
Sbjct  701  TSLGYEEALSSQYKESNHMLSLQQHQQNSPMWLHNGHGSRTMSTVPTNGYYNLQPQQQGP  760

Query  456  SGFRQVQ-QPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
              FR  Q Q  Q+Y SLGY PNFYH QTGIS++ HH  QNPRDG              PS
Sbjct  761  E-FRHSQPQASQHYGSLGY-PNFYHPQTGISIE-HHPPQNPRDG------------GPPS  805

Query  279  SQQLWQNSY  253
             QQ+WQN Y
Sbjct  806  KQQIWQNPY  814



>emb|CAN79286.1| hypothetical protein VITISV_039797 [Vitis vinifera]
Length=298

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 79/111 (71%), Gaps = 8/111 (7%)
 Frame = -1

Query  594  YKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPPQNY  418
            YK+ +HL+S QQ  ENS MW HG GS+TMSA PANTYY+ Q+QNQQP  FRQ  QP Q++
Sbjct  191  YKNGNHLISFQQQNENSAMWNHGPGSQTMSAVPANTYYSFQSQNQQPGRFRQGHQPSQHF  250

Query  417  ASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLW  265
             +L Y PNF+HSQ GISL+  HQQQNPRDG L      +Q Q    SQQ+W
Sbjct  251  GALEY-PNFHHSQAGISLE--HQQQNPRDGSL----SGSQGQACKQSQQIW  294



>gb|EYU28172.1| hypothetical protein MIMGU_mgv1a001362mg [Erythranthe guttata]
Length=833

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 94/134 (70%), Gaps = 16/134 (12%)
 Frame = -1

Query  627  SLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGF  448
            +L  DD LSSQYKDN HL+SLQQ ENS MWLHG  SRTMSA PA+TYYN Q Q+QQ  GF
Sbjct  707  TLSYDDVLSSQYKDNSHLVSLQQNENSAMWLHGPNSRTMSAVPASTYYNYQGQSQQGGGF  766

Query  447  RQVQQPPQNYASLGYNPNFYHSQTGISLD---------HHHQQQNPRDGPLggggGNAQV  295
            RQ QQP QNY +LGY PNFYHSQTG+SLD            QQQN RDG L    G AQ 
Sbjct  767  RQGQQPSQNYGALGY-PNFYHSQTGMSLDQQQQQQQQQQQQQQQNARDGSL----GGAQG  821

Query  294  QPKPSSQQLWQNSY  253
            QPK S  Q+WQN+Y
Sbjct  822  QPKQS--QIWQNNY  833



>ref|XP_009618326.1| PREDICTED: uncharacterized protein LOC104110515 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS +W HG GSRT+SA PANTYY  Q QNQ
Sbjct  726  APSGTNLSYDDVLSSQYKDTNHLMSLQQSENSALWHHGLGSRTISAVPANTYYGFQGQNQ  785

Query  462  QPS-GFRQVQQPPQNYASLGYNPNFYHSQTGIS  367
            Q + GFRQ QQP Q+Y SLG  P+FY+SQ GIS
Sbjct  786  QTAGGFRQGQQPSQSYGSLGGYPHFYNSQAGIS  818



>ref|XP_008358625.1| PREDICTED: cell wall protein RBR3-like [Malus domestica]
Length=312

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 96/132 (73%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  186  TTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  245

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            +GFR  Q  QP Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP 
Sbjct  246  TGFRQAQQPQPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPS  300

Query  285  PSSQQ-LWQNSY  253
              SQQ LWQN+Y
Sbjct  301  KQSQQHLWQNNY  312



>ref|XP_009618328.1| PREDICTED: uncharacterized protein LOC104110515 isoform X2 [Nicotiana 
tomentosiformis]
Length=845

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD +HLMSLQQ ENS +W HG GSRT+SA PANTYY  Q QNQ
Sbjct  719  APSGTNLSYDDVLSSQYKDTNHLMSLQQSENSALWHHGLGSRTISAVPANTYYGFQGQNQ  778

Query  462  QPS-GFRQVQQPPQNYASLGYNPNFYHSQTGIS  367
            Q + GFRQ QQP Q+Y SLG  P+FY+SQ GIS
Sbjct  779  QTAGGFRQGQQPSQSYGSLGGYPHFYNSQAGIS  811



>ref|XP_009353841.1| PREDICTED: uncharacterized protein LOC103945058 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009360834.1| PREDICTED: uncharacterized protein LOC103951238 isoform X3 [Pyrus 
x bretschneideri]
Length=856

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 95/131 (73%), Gaps = 10/131 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G DD ++SQ+KDN HL+SLQQ  +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ +
Sbjct  731  TTIGYDDVVNSQFKDNSHLISLQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQHT  790

Query  453  GFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            GFR  Q   P Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP  
Sbjct  791  GFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPSK  845

Query  282  SSQQ-LWQNSY  253
             SQQ LWQNSY
Sbjct  846  QSQQHLWQNSY  856



>ref|XP_009353840.1| PREDICTED: uncharacterized protein LOC103945058 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009360833.1| PREDICTED: uncharacterized protein LOC103951238 isoform X2 [Pyrus 
x bretschneideri]
Length=856

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  730  TTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  789

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            +GFR  Q   P Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP 
Sbjct  790  TGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPS  844

Query  285  PSSQQ-LWQNSY  253
              SQQ LWQNSY
Sbjct  845  KQSQQHLWQNSY  856



>ref|XP_009353842.1| PREDICTED: uncharacterized protein LOC103945058 isoform X5 [Pyrus 
x bretschneideri]
 ref|XP_009360836.1| PREDICTED: uncharacterized protein LOC103951238 isoform X4 [Pyrus 
x bretschneideri]
Length=855

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  729  TTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  788

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            +GFR  Q   P Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP 
Sbjct  789  TGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPS  843

Query  285  PSSQQ-LWQNSY  253
              SQQ LWQNSY
Sbjct  844  KQSQQHLWQNSY  855



>ref|XP_009353838.1| PREDICTED: uncharacterized protein LOC103945058 isoform X1 [Pyrus 
x bretschneideri]
Length=857

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  731  TTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  790

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            +GFR  Q   P Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP 
Sbjct  791  TGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPS  845

Query  285  PSSQQ-LWQNSY  253
              SQQ LWQNSY
Sbjct  846  KQSQQHLWQNSY  857



>ref|XP_009353839.1| PREDICTED: uncharacterized protein LOC103945058 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009360832.1| PREDICTED: uncharacterized protein LOC103951238 isoform X1 [Pyrus 
x bretschneideri]
Length=856

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  730  TTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  789

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            +GFR  Q   P Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP 
Sbjct  790  TGFRQAQQPPPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPS  844

Query  285  PSSQQ-LWQNSY  253
              SQQ LWQNSY
Sbjct  845  KQSQQHLWQNSY  856



>ref|XP_004486425.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=831

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            A  T++G ++ ++SQ KDN H++SLQQ ENS +WL G GSRTM A P + YY++Q QNQQ
Sbjct  710  ATGTTIGYENVINSQLKDNSHMISLQQNENSPIWLQGPGSRTMPAVPPSAYYSLQGQNQQ  769

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQ  349
            PSGF+Q QQP Q++ SLG+ PNFY SQ+GISL+H HQ
Sbjct  770  PSGFQQRQQPTQHFGSLGH-PNFYQSQSGISLEHQHQ  805



>ref|XP_008800693.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103714980 
[Phoenix dactylifera]
Length=885

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 10/127 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G+++ LSSQYK+ +H M LQQ +N+ MW+HG GSRTMSA PA+T+Y+ Q QNQ  S
Sbjct  769  STTIGLEEALSSQYKEANHYMPLQQADNTAMWVHGAGSRTMSALPASTFYSFQGQNQH-S  827

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q +   GY PNFY SQ G+       QQNP +G L      +Q  P  +S 
Sbjct  828  GFRQGQQPSQ-FGPPGY-PNFYPSQAGVP---QELQQNPSEGNLNV----SQAAPSQASH  878

Query  273  QLWQNSY  253
            Q+WQ+SY
Sbjct  879  QMWQHSY  885



>ref|XP_008366008.1| PREDICTED: protein lingerer-like [Malus domestica]
Length=856

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 96/132 (73%), Gaps = 11/132 (8%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV--ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            T++G DD ++SQ+KDN HL+SLQQ   +NSGMW+HG GSR MSA PA+ YY+ Q QNQQ 
Sbjct  730  TTIGYDDVVNSQFKDNSHLISLQQQQNDNSGMWVHGPGSRAMSAVPASNYYSFQGQNQQH  789

Query  456  SGFR--QVQQPPQNYA-SLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            +GFR  Q  QP Q YA +LGY PNFYHSQ+G+SL+ H QQQ+ RD  LGG  G    QP 
Sbjct  790  TGFRQAQQPQPSQQYAGALGY-PNFYHSQSGMSLE-HQQQQSSRDASLGGSQGG---QPS  844

Query  285  PSSQQ-LWQNSY  253
              SQQ LWQN+Y
Sbjct  845  KQSQQHLWQNNY  856



>ref|XP_011085623.1| PREDICTED: uncharacterized protein LOC105167549 [Sesamum indicum]
Length=848

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 93/130 (72%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            APS T+L  DD LSSQYKD+  L+SLQQ ENS MWLHG  SRTM A PA+TYYN Q QNQ
Sbjct  729  APSGTTLSYDDVLSSQYKDSSQLLSLQQNENSAMWLHGPNSRTMPAVPASTYYNYQGQNQ  788

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            QP GFRQ QQ  Q+Y S GY PNFYHSQTGI LD   QQQNPRDG +      +Q QPK 
Sbjct  789  QPGGFRQGQQQSQSYGSPGY-PNFYHSQTGILLD---QQQNPRDGSI----AGSQGQPKQ  840

Query  282  SSQQLWQNSY  253
            S  Q+W NSY
Sbjct  841  S--QIWPNSY  848



>ref|XP_010666704.1| PREDICTED: uncharacterized protein LOC104883839 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=858

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 83/127 (65%), Gaps = 15/127 (12%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPS  454
            TS+  DD LSSQYKD  HL+SLQQ         G GSRT+S  P +TYYN  Q QNQQP+
Sbjct  746  TSVNYDDLLSSQYKDASHLLSLQQ---------GAGSRTLSGVPGSTYYNSFQGQNQQPA  796

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q+Y  L   PNFYHSQ+G+SLD H QQQ  RDG L      +Q Q    +Q
Sbjct  797  GFRQSQQPSQHYGQLSGYPNFYHSQSGLSLD-HQQQQMSRDGSL----SGSQGQQPKQTQ  851

Query  273  QLWQNSY  253
            QLWQNSY
Sbjct  852  QLWQNSY  858



>ref|XP_010666705.1| PREDICTED: uncharacterized protein LOC104883839 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=847

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 83/127 (65%), Gaps = 15/127 (12%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYN-IQAQNQQPS  454
            TS+  DD LSSQYKD  HL+SLQQ         G GSRT+S  P +TYYN  Q QNQQP+
Sbjct  735  TSVNYDDLLSSQYKDASHLLSLQQ---------GAGSRTLSGVPGSTYYNSFQGQNQQPA  785

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q+Y  L   PNFYHSQ+G+SLD H QQQ  RDG L      +Q Q    +Q
Sbjct  786  GFRQSQQPSQHYGQLSGYPNFYHSQSGLSLD-HQQQQMSRDGSL----SGSQGQQPKQTQ  840

Query  273  QLWQNSY  253
            QLWQNSY
Sbjct  841  QLWQNSY  847



>emb|CDX94662.1| BnaC07g09960D [Brassica napus]
Length=805

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 92/138 (67%), Gaps = 18/138 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMSLQQV----ENSGMWLHGHGSRTMSAAPANTYYNIQAQ  469
            P T++G +D LSSQYK++ HL++LQQ     ENS MW HGHGSRTMS  PANTYYN+QAQ
Sbjct  676  PGTTMGYEDVLSSQYKESSHLLALQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQ  735

Query  468  NQQPS------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggG  307
             Q         G+RQ QQ  Q+Y S GY PN+Y SQT +S+D   QQQNPRDG     G 
Sbjct  736  QQLQQAQQAAGGYRQAQQ-QQHYGSQGY-PNYYQSQTEMSVD--RQQQNPRDG----AGA  787

Query  306  NAQVQPKPSSQQLWQNSY  253
             A  QP   +QQLWQNSY
Sbjct  788  QAGSQPSNQTQQLWQNSY  805



>ref|XP_010056862.1| PREDICTED: uncharacterized protein LOC104444809 isoform X3 [Eucalyptus 
grandis]
Length=833

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +T+LG DD LSSQYKD + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+
Sbjct  713  TTTLGYDDALSSQYKDANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPT  772

Query  453  GFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
            G R  Q QQP Q++ SL Y PNFY S  GISL+  HQQQ  RD  LGG            
Sbjct  773  GIRQGQGQQPSQHFGSLNY-PNFYQS-AGISLE--HQQQIARDSSLGGSQSQQAK----Q  824

Query  279  SQQLWQNSY  253
            S Q+WQN+Y
Sbjct  825  SAQIWQNTY  833



>ref|XP_010056861.1| PREDICTED: uncharacterized protein LOC104444809 isoform X2 [Eucalyptus 
grandis]
 gb|KCW73756.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=857

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +T+LG DD LSSQYKD + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+
Sbjct  737  TTTLGYDDALSSQYKDANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPT  796

Query  453  GFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
            G R  Q QQP Q++ SL Y PNFY S  GISL+  HQQQ  RD  LGG            
Sbjct  797  GIRQGQGQQPSQHFGSLNY-PNFYQS-AGISLE--HQQQIARDSSLGGSQSQQAK----Q  848

Query  279  SQQLWQNSY  253
            S Q+WQN+Y
Sbjct  849  SAQIWQNTY  857



>ref|XP_010056860.1| PREDICTED: uncharacterized protein LOC104444809 isoform X1 [Eucalyptus 
grandis]
 gb|KCW73755.1| hypothetical protein EUGRSUZ_E02361 [Eucalyptus grandis]
Length=859

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +T+LG DD LSSQYKD + L+SLQQ ENS +WL G G RTM    ANTYYN Q Q QQP+
Sbjct  739  TTTLGYDDALSSQYKDANSLLSLQQNENSALWLQGPGGRTMPTVAANTYYNFQGQTQQPT  798

Query  453  GFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
            G R  Q QQP Q++ SL Y PNFY S  GISL+  HQQQ  RD  LGG            
Sbjct  799  GIRQGQGQQPSQHFGSLNY-PNFYQS-AGISLE--HQQQIARDSSLGGSQSQQAK----Q  850

Query  279  SQQLWQNSY  253
            S Q+WQN+Y
Sbjct  851  SAQIWQNTY  859



>ref|XP_010549430.1| PREDICTED: uncharacterized protein LOC104820614 [Tarenaya hassleriana]
Length=826

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 91/137 (66%), Gaps = 24/137 (18%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV---ENSGMWLHGHGSRTMSAAPANTYYNIQAQ--N  466
            T+LG  D LSSQYK+ +HL+SLQQ    ENS MW+HGHG++TM A P NTYYN+QA   N
Sbjct  703  TTLGYGDVLSSQYKEINHLLSLQQQQQNENSAMWVHGHGAQTMPAIPTNTYYNLQAAHHN  762

Query  465  QQP-----SGF-RQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGN  304
            QQ      SG+ R   QP  +Y SLGY PNFY SQTG+SL+   QQQNPRDG        
Sbjct  763  QQASSSSSSGYHRHAHQP--DYGSLGY-PNFYQSQTGMSLE-QQQQQNPRDG--------  810

Query  303  AQVQPKPSSQQLWQNSY  253
               Q +P S+Q+WQNSY
Sbjct  811  -GSQGQPPSKQIWQNSY  826



>ref|XP_004504230.1| PREDICTED: serine/threonine-protein kinase pakD-like [Cicer arietinum]
Length=861

 Score =   110 bits (275),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 87/127 (69%), Gaps = 7/127 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G DD +SSQYK+N+H++SLQQ ENS MW+ G GSRTMS  P+  Y       QQ  
Sbjct  742  STAIGYDDVISSQYKENNHMISLQQNENSPMWVQGPGSRTMSVPPSTYYSFQGQNQQQAG  801

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q++   GY PN+YHSQ+GISL+  HQQQNPRD  L      +Q Q    SQ
Sbjct  802  GFRQNQQPSQHFGPHGY-PNYYHSQSGISLE--HQQQNPRDASL----AGSQQQNPKQSQ  854

Query  273  QLWQNSY  253
            QLWQNSY
Sbjct  855  QLWQNSY  861



>emb|CDJ26391.1| unnamed protein product [Triticum aestivum]
Length=845

 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQ  463
            +P+T++GID+ LSSQ K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q+ 
Sbjct  726  SPATTMGIDEALSSQLKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSA  785

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
            Q  GFR+VQQP Q Y  LGY P+FY SQ G+  +H    QNP +G L     ++Q  P  
Sbjct  786  Q-GGFREVQQPSQ-YGGLGY-PSFYQSQNGMQQEH---PQNPAEGSL----NSSQTAPSQ  835

Query  282  SSQQLWQNSY  253
             S Q+WQ+SY
Sbjct  836  PSHQMWQHSY  845



>gb|EMT31975.1| Retrovirus-related Pol polyprotein LINE-1 [Aegilops tauschii]
Length=1186

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 86/130 (66%), Gaps = 11/130 (8%)
 Frame = -1

Query  639   APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQ  463
             +P+T++GID+ LSSQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q+ 
Sbjct  1067  SPATTMGIDEALSSQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSA  1126

Query  462   QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
             Q  GFR+VQQP Q Y  LG+ P+FY SQ G+  +H    QNP +G L     ++Q  P  
Sbjct  1127  Q-GGFREVQQPSQ-YGGLGH-PSFYQSQNGMQQEH---PQNPAEGSL----NSSQTAPSQ  1176

Query  282   SSQQLWQNSY  253
              S Q+WQ+SY
Sbjct  1177  PSHQMWQHSY  1186



>ref|XP_009410964.1| PREDICTED: uncharacterized protein LOC103992822 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=878

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 11/127 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  S
Sbjct  763  STTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-S  821

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G R  QQ  Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + 
Sbjct  822  GIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPAN  871

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  872  QIWQHGY  878



>ref|XP_009410965.1| PREDICTED: uncharacterized protein LOC103992822 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=872

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 11/127 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  S
Sbjct  757  STTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-S  815

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G R  QQ  Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + 
Sbjct  816  GIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPAN  865

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  866  QIWQHGY  872



>ref|XP_009410962.1| PREDICTED: uncharacterized protein LOC103992822 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 11/127 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  S
Sbjct  768  STTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-S  826

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G R  QQ  Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + 
Sbjct  827  GIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPAN  876

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  877  QIWQHGY  883



>ref|XP_009410966.1| PREDICTED: uncharacterized protein LOC103992822 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=830

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 78/127 (61%), Gaps = 11/127 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST++G D+ LS QYK+  H + LQQ EN  MW+HG GSRTMSA PA+T+YN   QNQ  S
Sbjct  715  STTIGFDEALSLQYKEGSHYLPLQQSENPAMWIHGAGSRTMSALPASTFYNYPGQNQH-S  773

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G R  QQ  Q   +LGY PN YHSQ G S +H   QQNP +G L     N    P   + 
Sbjct  774  GIRPSQQTSQ-LGALGY-PNLYHSQAGPSREH---QQNPGEGNL-----NGSQTPSQPAN  823

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  824  QIWQHGY  830



>emb|CAE00871.1| TA9 protein [Oryza sativa Japonica Group]
Length=140

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP 
Sbjct  24   TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPG  82

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S 
Sbjct  83   GFRQGQQPSQ-YGGLGY-PSFYQSQAGLPHEH---PQNLTEGTL----NSSQTTPSQPSH  133

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  134  QIWQHIY  140



>ref|XP_006306765.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39663.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=832

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 91/151 (60%), Gaps = 33/151 (22%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQN  466
            T+LG +D LSSQYK+++HL++LQQ      ENS MW HGHGSRTMS  PANTYYN+QAQ 
Sbjct  690  TTLGYEDVLSSQYKESNHLLALQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQ  749

Query  465  QQPS--------------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQ  346
            Q                       G+RQ QQ   +Y S GY PNFY SQT +SL+   QQ
Sbjct  750  QLHQQQLQQQQLQQQQQQTQQAAGGYRQAQQQQHHYGSHGY-PNFYQSQTEMSLE--RQQ  806

Query  345  QNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
            QNPRDG     GG+   Q    +QQLWQNSY
Sbjct  807  QNPRDG-----GGSQAGQQSNQTQQLWQNSY  832



>ref|XP_006306766.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
 gb|EOA39664.1| hypothetical protein CARUB_v10008305mg [Capsella rubella]
Length=840

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 94/155 (61%), Gaps = 34/155 (22%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNI  478
            AP+ T+LG +D LSSQYK+++HL++LQQ      ENS MW HGHGSRTMS  PANTYYN+
Sbjct  694  APTGTTLGYEDVLSSQYKESNHLLALQQQQQQQNENSAMWHHGHGSRTMSGVPANTYYNL  753

Query  477  QAQNQQPS--------------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDH  358
            QAQ Q                       G+RQ QQ   +Y S GY PNFY SQT +SL+ 
Sbjct  754  QAQQQLHQQQLQQQQLQQQQQQTQQAAGGYRQAQQQQHHYGSHGY-PNFYQSQTEMSLE-  811

Query  357  HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
              QQQNPRDG     GG+   Q    +QQLWQNSY
Sbjct  812  -RQQQNPRDG-----GGSQAGQQSNQTQQLWQNSY  840



>ref|XP_006646178.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like, partial 
[Oryza brachyantha]
Length=780

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 80/128 (63%), Gaps = 11/128 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQP  457
            +TS+G D+ LS+Q+KDN H ++LQQ +NS MWL G  GSR +SA P   +Y  Q QN QP
Sbjct  663  ATSMGFDEALSAQFKDNSHYIALQQSDNSAMWLQGAAGSRAVSAVPPGNFYGFQGQN-QP  721

Query  456  SGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
             GFRQ QQP Q Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S
Sbjct  722  GGFRQGQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLPEGTL----NSSQTAPSQPS  772

Query  276  QQLWQNSY  253
             QLWQ+ Y
Sbjct  773  HQLWQHIY  780



>ref|XP_006415582.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33935.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=836

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 92/150 (61%), Gaps = 33/150 (22%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV----------------ENSGMWLHGHGSRTMSAA  502
            S   G +D LSSQYK+++HL++LQQ                 ENS MW HGHGSRTMS  
Sbjct  697  SAPTGYEDVLSSQYKESNHLLALQQQQQQQQQQQLLLQQQQNENSAMWHHGHGSRTMSGI  756

Query  501  PANTYYNIQAQNQQPS------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQN  340
            PANTYYN+QAQ QQ        G+RQ QQ  Q+Y S GY PNFY SQT +SLD   QQQN
Sbjct  757  PANTYYNLQAQQQQQQPQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLD--RQQQN  812

Query  339  PRDGPLggggGNAQV-QPKPSSQQLWQNSY  253
            PRDG        AQV QP   +QQLWQNSY
Sbjct  813  PRDG------AGAQVGQPSNQTQQLWQNSY  836



>ref|XP_006415581.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
 gb|ESQ33934.1| hypothetical protein EUTSA_v10006794mg [Eutrema salsugineum]
Length=838

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 92/150 (61%), Gaps = 33/150 (22%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV----------------ENSGMWLHGHGSRTMSAA  502
            S   G +D LSSQYK+++HL++LQQ                 ENS MW HGHGSRTMS  
Sbjct  699  SAPTGYEDVLSSQYKESNHLLALQQQQQQQQQQQLLLQQQQNENSAMWHHGHGSRTMSGI  758

Query  501  PANTYYNIQAQNQQPS------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQN  340
            PANTYYN+QAQ QQ        G+RQ QQ  Q+Y S GY PNFY SQT +SLD   QQQN
Sbjct  759  PANTYYNLQAQQQQQQPQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLD--RQQQN  814

Query  339  PRDGPLggggGNAQV-QPKPSSQQLWQNSY  253
            PRDG        AQV QP   +QQLWQNSY
Sbjct  815  PRDG------AGAQVGQPSNQTQQLWQNSY  838



>ref|XP_003569505.1| PREDICTED: uncharacterized protein LOC100846506 isoform X1 [Brachypodium 
distachyon]
Length=834

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 12/129 (9%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            +P T++G+D+ LS+Q+K+ +H M+LQQ +NS MWLHG  +    A P + +Y  Q QN Q
Sbjct  718  SPGTTMGLDEALSTQFKEANHYMALQQSDNSAMWLHGAAAS--RAVPPSNFYGFQGQNTQ  775

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
              GFRQ QQP Q Y  LGY P+FY SQTG+      + QNP +G L     ++Q  P   
Sbjct  776  -GGFRQAQQPSQ-YGGLGY-PSFYQSQTGMP---QERLQNPTEGSL----NSSQTTPSQP  825

Query  279  SQQLWQNSY  253
            S Q+WQ+SY
Sbjct  826  SHQIWQHSY  834



>ref|XP_010232108.1| PREDICTED: uncharacterized protein LOC100846506 isoform X2 [Brachypodium 
distachyon]
Length=824

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 12/129 (9%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            +P T++G+D+ LS+Q+K+ +H M+LQQ +NS MWLHG  +    A P + +Y  Q QN Q
Sbjct  708  SPGTTMGLDEALSTQFKEANHYMALQQSDNSAMWLHGAAAS--RAVPPSNFYGFQGQNTQ  765

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
              GFRQ QQP Q Y  LGY P+FY SQTG+      + QNP +G L     ++Q  P   
Sbjct  766  -GGFRQAQQPSQ-YGGLGY-PSFYQSQTGMP---QERLQNPTEGSL----NSSQTTPSQP  815

Query  279  SQQLWQNSY  253
            S Q+WQ+SY
Sbjct  816  SHQIWQHSY  824



>gb|EYU43283.1| hypothetical protein MIMGU_mgv1a002920mg [Erythranthe guttata]
Length=625

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 86/137 (63%), Gaps = 26/137 (19%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQ-VENSGMWLHGHGSRTMSAAPANTYYNIQAQ--NQQ  460
            ++L  DD L++QYK+  HL+SLQQ  ENS +WL GH SRTMS  PA+T YN+QAQ  NQQ
Sbjct  504  SALSYDDVLNAQYKERSHLLSLQQQSENSPVWLQGHNSRTMSGVPASTLYNLQAQQTNQQ  563

Query  459  PSGFR--------QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGN  304
              GFR        Q QQ  QNY     NPN+YHSQTG+SLD   Q QNPRD         
Sbjct  564  LGGFRQGQAPHQQQQQQQSQNYG----NPNYYHSQTGMSLD---QLQNPRD------VSG  610

Query  303  AQVQPKPSSQQLWQNSY  253
            +Q QPK S  Q+W N+Y
Sbjct  611  SQGQPKQS--QMWPNNY  625



>dbj|BAD72339.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72382.1| TA9 protein-like [Oryza sativa Japonica Group]
Length=371

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP 
Sbjct  255  TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPG  313

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S 
Sbjct  314  GFRQGQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSH  364

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  365  QIWQHIY  371



>ref|XP_006597650.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=800

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 12/131 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ---  460
            T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ   
Sbjct  677  TTIGYEDLINSQFKDNNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPG  736

Query  459  --PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
                  +Q QQP Q++  LGY PNFY SQTGISL+  HQ QNPR+  LGG       Q  
Sbjct  737  GFRQRQQQQQQPSQHFGPLGY-PNFYQSQTGISLE--HQPQNPREASLGGPQSQPSKQ--  791

Query  285  PSSQQLWQNSY  253
              SQQ+WQNSY
Sbjct  792  --SQQIWQNSY  800



>ref|XP_006597649.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=832

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 12/131 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ---  460
            T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ   
Sbjct  709  TTIGYEDLINSQFKDNNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPG  768

Query  459  --PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
                  +Q QQP Q++  LGY PNFY SQTGISL+  HQ QNPR+  LGG       Q  
Sbjct  769  GFRQRQQQQQQPSQHFGPLGY-PNFYQSQTGISLE--HQPQNPREASLGGPQSQPSKQ--  823

Query  285  PSSQQLWQNSY  253
              SQQ+WQNSY
Sbjct  824  --SQQIWQNSY  832



>gb|KHN14369.1| hypothetical protein glysoja_012407 [Glycine soja]
Length=831

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 12/131 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ---  460
            T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q QNQQ   
Sbjct  708  TTIGYEDLINSQFKDNNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPG  767

Query  459  --PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
                  +Q QQP Q++  LGY PNFY SQTGISL+  HQ QNPR+  LGG       Q  
Sbjct  768  GFRQRQQQQQQPSQHFGPLGY-PNFYQSQTGISLE--HQPQNPREASLGGPQSQPSKQ--  822

Query  285  PSSQQLWQNSY  253
              SQQ+WQNSY
Sbjct  823  --SQQIWQNSY  831



>ref|XP_010539204.1| PREDICTED: putative uncharacterized protein DDB_G0277255 [Tarenaya 
hassleriana]
Length=790

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 80/129 (62%), Gaps = 14/129 (11%)
 Frame = -1

Query  630  TSLGID--DGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ-  460
            T++G D  D LSSQ+KD++H  S+QQ E+S  WL G  SR +S  P +TYY+   QNQQ 
Sbjct  673  TTMGYDNNDVLSSQFKDSNHFASIQQNESSQAWLQGQNSRVVSVVPGSTYYSFPGQNQQP  732

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
            P GFR  QQP Q +   GY   +Y SQ G+S++H+H  QNPRD  +      AQ      
Sbjct  733  PGGFR--QQPSQQH--FGYMSPYY-SQAGMSMEHNHHHQNPRDTSV------AQTHASKQ  781

Query  279  SQQLWQNSY  253
            +QQLWQNSY
Sbjct  782  AQQLWQNSY  790



>ref|NP_001130067.1| uncharacterized protein LOC100191159 [Zea mays]
 gb|ACF78188.1| unknown [Zea mays]
Length=255

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 77/130 (59%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQ  463
            A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q
Sbjct  136  AAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQ  195

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
               GFRQ  QP Q Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P  
Sbjct  196  H-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQ  245

Query  282  SSQQLWQNSY  253
             S QLWQ+ Y
Sbjct  246  PSHQLWQHIY  255



>ref|XP_008648655.1| PREDICTED: uncharacterized protein LOC103629266 [Zea mays]
Length=281

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 78/130 (60%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQ  463
            A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y+ Q Q+Q
Sbjct  162  AAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYDFQGQSQ  221

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
               GFRQ  QP Q Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P  
Sbjct  222  H-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQ  271

Query  282  SSQQLWQNSY  253
             S QLWQ+ Y
Sbjct  272  PSHQLWQHIY  281



>ref|NP_001043788.1| Os01g0663800 [Oryza sativa Japonica Group]
 dbj|BAD72338.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAD72381.1| TA9 protein-like [Oryza sativa Japonica Group]
 dbj|BAF05702.1| Os01g0663800 [Oryza sativa Japonica Group]
 gb|EEE55130.1| hypothetical protein OsJ_02914 [Oryza sativa Japonica Group]
Length=851

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G ++ LS+Q+KDN   ++LQQ +NS MWLHG  GSR +SA P   +Y  Q QN QP 
Sbjct  735  TTMGFEEALSTQFKDNSQYIALQQNDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPG  793

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q Y  LGY P+FY SQ G+  +H    QN  +G L     ++Q  P   S 
Sbjct  794  GFRQGQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSH  844

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  845  QIWQHIY  851



>ref|XP_009395691.1| PREDICTED: mucin-17-like [Musa acuminata subsp. malaccensis]
Length=910

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 79/127 (62%), Gaps = 12/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T+ G+ + LS QYK+  H M LQQ EN  MW+ G GSRTMSA PANT+YN Q  NQQ SG
Sbjct  795  TTTGLGEALSLQYKEGSHYMPLQQNENPAMWVQGAGSRTMSALPANTFYNYQGHNQQ-SG  853

Query  450  FRQ-VQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            FRQ +Q  P    +LGY PN Y SQ G S +H   QQ+P DG L G     Q QP   + 
Sbjct  854  FRQNLQASP--LGALGY-PNLYLSQGGPSREH---QQSPSDGNLNGSQAT-QSQP---AN  903

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  904  QIWQHGY  910



>ref|XP_002893558.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69817.1| hypothetical protein ARALYDRAFT_473146 [Arabidopsis lyrata subsp. 
lyrata]
Length=841

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 92/155 (59%), Gaps = 34/155 (22%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAP  499
            AP+ T+LG +D LSSQYK+NH L++LQQ             ENS MW HGHGSRTMS  P
Sbjct  695  APTGTTLGYEDVLSSQYKENH-LLALQQQQQQQQQQQQQQNENSAMWHHGHGSRTMSGVP  753

Query  498  ANTYYNIQAQNQQPS-------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDH  358
             NTYYN+QAQ Q                G+RQ QQ  Q+Y S GY PN+Y SQT +SLD 
Sbjct  754  TNTYYNLQAQQQLQLQQQQQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLD-  810

Query  357  HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
              QQQNPRDG  G   G    Q   + QQLWQNSY
Sbjct  811  -RQQQNPRDGGTGSQAGQPSNQ---TQQQLWQNSY  841



>ref|XP_009102863.1| PREDICTED: uncharacterized protein LOC103828968 isoform X3 [Brassica 
rapa]
Length=639

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ
Sbjct  525  PGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ  581

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKP  283
                 Q Q   Q+Y S GY PN+Y SQT +S  H  QQQNPRDG        AQ  QP  
Sbjct  582  QLRQAQQQ---QHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSN  629

Query  282  SSQQLWQNSY  253
             +QQLWQNSY
Sbjct  630  QTQQLWQNSY  639



>emb|CDY15632.1| BnaA07g08030D [Brassica napus]
Length=786

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ
Sbjct  672  PGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ  728

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKP  283
                 Q Q   Q+Y S GY PN+Y SQT +S  H  QQQNPRDG        AQ  QP  
Sbjct  729  QLRQAQQQ---QHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSN  776

Query  282  SSQQLWQNSY  253
             +QQLWQNSY
Sbjct  777  QTQQLWQNSY  786



>ref|XP_009102861.1| PREDICTED: uncharacterized protein LOC103828968 isoform X1 [Brassica 
rapa]
Length=783

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ
Sbjct  669  PGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ  725

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKP  283
                 Q Q   Q+Y S GY PN+Y SQT +S  H  QQQNPRDG        AQ  QP  
Sbjct  726  QLRQAQQQ---QHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSN  773

Query  282  SSQQLWQNSY  253
             +QQLWQNSY
Sbjct  774  QTQQLWQNSY  783



>ref|XP_009102862.1| PREDICTED: uncharacterized protein LOC103828968 isoform X2 [Brassica 
rapa]
Length=782

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 17/130 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMS-LQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            P T++G +D   +QYK+++HL++  QQ ENS MW HGHGSRTMS  PANTYYN+QAQ QQ
Sbjct  668  PGTTMGYED---AQYKESNHLLAPQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQQQ  724

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV-QPKP  283
                 Q Q   Q+Y S GY PN+Y SQT +S  H  QQQNPRDG        AQ  QP  
Sbjct  725  QLRQAQQQ---QHYGSHGY-PNYYQSQTEVS--HERQQQNPRDG------AGAQAGQPSN  772

Query  282  SSQQLWQNSY  253
             +QQLWQNSY
Sbjct  773  QTQQLWQNSY  782



>ref|XP_010499452.1| PREDICTED: RNA polymerase II degradation factor 1-like [Camelina 
sativa]
Length=842

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 91/155 (59%), Gaps = 37/155 (24%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTY  487
            T+LG +D LSSQYK+++HL++LQQ             ENS MW HGHGSRTMS  PANTY
Sbjct  696  TTLGYEDVLSSQYKESNHLLALQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPANTY  755

Query  486  YNIQAQNQQPS-----------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDH  358
            YN+QAQ Q                    G+RQ QQ  Q+Y S GY PNFY SQT +SL+ 
Sbjct  756  YNLQAQQQLQLHQQLQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE-  812

Query  357  HHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
              QQQ+PRDG     G  A  Q   + QQLWQNSY
Sbjct  813  -RQQQSPRDG----AGSQAGQQSNQTQQQLWQNSY  842



>ref|XP_006827353.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
 gb|ERM94590.1| hypothetical protein AMTR_s00011p00072820 [Amborella trichopoda]
Length=904

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 79/129 (61%), Gaps = 21/129 (16%)
 Frame = -1

Query  624  LGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR  445
            +G DD +SSQYKD  H + +QQ E+S +W+HG GSR +SA PANTYY++Q  NQ    FR
Sbjct  792  MGYDDIVSSQYKDGSHYVPIQQNESSAVWVHGPGSRNVSAIPANTYYSLQGHNQL-GEFR  850

Query  444  QVQQPPQNYASLGYNPNFYHSQTGI-----SLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
            Q QQ   +Y +LGY PNFYH+Q G+     +L+H   QQ+P DG              PS
Sbjct  851  QPQQ-ASHYNTLGY-PNFYHAQMGVAPPAAALEH---QQSPSDGGSR----------APS  895

Query  279  SQQLWQNSY  253
            S Q+W + Y
Sbjct  896  SHQIWAHGY  904



>ref|NP_174230.2| Kinase-related protein [Arabidopsis thaliana]
 gb|AAL36210.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20314.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31077.1| Kinase-related protein [Arabidopsis thaliana]
Length=831

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 87/150 (58%), Gaps = 33/150 (22%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYN  481
            T+LG DD LSSQYK+NH L++LQQ           ENS MW  GHGSRTMS  P NTYYN
Sbjct  691  TTLGYDDVLSSQYKENH-LLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYN  749

Query  480  IQAQNQQPS--------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQ  343
            +QAQ Q                 G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQ
Sbjct  750  LQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQ  805

Query  342  NPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
            NPRDG     G  A      S QQLWQNSY
Sbjct  806  NPRDG----AGSQAGQPSNQSQQQLWQNSY  831



>gb|AAG51735.1|AC068667_14 unknown protein; 25451-20507 [Arabidopsis thaliana]
Length=858

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 87/150 (58%), Gaps = 33/150 (22%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYN  481
            T+LG DD LSSQYK+NH L++LQQ           ENS MW  GHGSRTMS  P NTYYN
Sbjct  718  TTLGYDDVLSSQYKENH-LLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYN  776

Query  480  IQAQNQQPS--------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQ  343
            +QAQ Q                 G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQ
Sbjct  777  LQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQ  832

Query  342  NPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
            NPRDG     G  A      S QQLWQNSY
Sbjct  833  NPRDG----AGSQAGQPSNQSQQQLWQNSY  858



>ref|XP_010478296.1| PREDICTED: probable serine/threonine-protein kinase yakA [Camelina 
sativa]
Length=845

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 91/157 (58%), Gaps = 38/157 (24%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV------------ENSGMWLHGHGSRTMSAAPANTY  487
            T+LG +D LSSQYK+++HL++LQQ             ENS MW HGHGSRTMS  PANTY
Sbjct  696  TALGYEDVLSSQYKESNHLLALQQQQQQQQQQQQQQNENSAMWHHGHGSRTMSGVPANTY  755

Query  486  YNIQAQNQQPS-------------------GFRQVQQPPQNYASLGYNPNFYHSQTGISL  364
            YN+QAQ Q                      G+RQ QQ  Q+Y S GY PNFY SQT +SL
Sbjct  756  YNLQAQQQLQLHQQLQQQQQQQQQNQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSL  813

Query  363  DHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
            +   QQQNPRDG     GG    Q   + QQLWQNSY
Sbjct  814  E--RQQQNPRDGAGSQAGGQQSNQ---TQQQLWQNSY  845



>tpg|DAA58234.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=821

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 77/130 (59%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQ  463
            A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q
Sbjct  702  AAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQ  761

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
               GFRQ  QP Q Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P  
Sbjct  762  H-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQ  811

Query  282  SSQQLWQNSY  253
             S QLWQ+ Y
Sbjct  812  PSHQLWQHIY  821



>gb|EMS47817.1| hypothetical protein TRIUR3_20557 [Triticum urartu]
Length=1165

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQ  463
            +P+T++GID+ LSSQ+K+ +H M+LQQ +NS MWLHG  GSR +SA P   +Y  Q Q++
Sbjct  819  SPATTMGIDEALSSQFKEANHYMALQQSDNSAMWLHGAAGSRAVSAVPPGNFYGFQGQSE  878

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQ  379
            Q  GFR+VQQP Q Y  LGY P+FY SQ
Sbjct  879  Q-GGFREVQQPSQ-YGGLGY-PSFYQSQ  903



>ref|XP_008671999.1| PREDICTED: uncharacterized protein LOC100191159 isoform X1 [Zea 
mays]
 tpg|DAA58235.1| TPA: putative DUF1296 domain containing family protein [Zea mays]
Length=842

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 77/130 (59%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQ  463
            A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q+Q
Sbjct  723  AAPTTLGFDEALGTQFKHPNHYAALQQSDNSTMWLHGGAGSRTISAVPPGNFYGFQGQSQ  782

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
               GFRQ  QP Q Y  LGY P+FY SQT +  +H    QNP +G L     N Q  P  
Sbjct  783  H-GGFRQAHQPSQ-YGGLGY-PSFYQSQTSLPQEH---PQNPTEGSL----NNPQGVPSQ  832

Query  282  SSQQLWQNSY  253
             S QLWQ+ Y
Sbjct  833  PSHQLWQHIY  842



>ref|XP_010460714.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X1 [Camelina sativa]
Length=843

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 90/156 (58%), Gaps = 38/156 (24%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV---------------ENSGMWLHGHGSRTMSAAPA  496
            T+L  +D LSSQYK+++HL++LQQ                ENS MW HGHGSRTMS  PA
Sbjct  696  TTLDYEDVLSSQYKESNHLLALQQQQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPA  755

Query  495  NTYYNIQAQNQQPS---------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLD  361
            NTYYN+QAQ Q                  G+RQ QQ  Q+Y S GY PNFY SQT +SL+
Sbjct  756  NTYYNLQAQQQLQLHQQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE  813

Query  360  HHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
               QQQNPRDG     G  A  Q   + QQLWQNSY
Sbjct  814  --RQQQNPRDG----AGSQAGQQSNQTQQQLWQNSY  843



>ref|XP_010460715.1| PREDICTED: putative uncharacterized protein DDB_G0271606 isoform 
X2 [Camelina sativa]
Length=842

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 90/156 (58%), Gaps = 38/156 (24%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV---------------ENSGMWLHGHGSRTMSAAPA  496
            T+L  +D LSSQYK+++HL++LQQ                ENS MW HGHGSRTMS  PA
Sbjct  695  TTLDYEDVLSSQYKESNHLLALQQQQQQQQQQQHQQQQQNENSAMWHHGHGSRTMSGVPA  754

Query  495  NTYYNIQAQNQQPS---------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLD  361
            NTYYN+QAQ Q                  G+RQ QQ  Q+Y S GY PNFY SQT +SL+
Sbjct  755  NTYYNLQAQQQLQLHQQQQQQQQTQQAAGGYRQAQQ-QQHYGSHGY-PNFYQSQTEMSLE  812

Query  360  HHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
               QQQNPRDG     G  A  Q   + QQLWQNSY
Sbjct  813  --RQQQNPRDG----AGSQAGQQSNQTQQQLWQNSY  842



>gb|EEC71225.1| hypothetical protein OsI_03160 [Oryza sativa Indica Group]
Length=732

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 79/127 (62%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHG-HGSRTMSAAPANTYYNIQAQNQQPS  454
            T++G ++ LS+Q+KDN   ++LQQ ++S MWLHG  GSR +SA P   +Y  Q QN QP 
Sbjct  616  TTMGFEEALSTQFKDNSQYIALQQNDSSAMWLHGAAGSRAVSAVPPGNFYGFQGQN-QPG  674

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            GFRQ QQP Q Y  LGY+ +FY SQ G+  +H    QN  +G L     ++Q  P   S 
Sbjct  675  GFRQGQQPSQ-YGGLGYS-SFYQSQAGLPQEH---PQNLTEGTL----NSSQTTPSQPSH  725

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  726  QIWQHIY  732



>ref|NP_174229.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE31075.1| uncharacterized protein AT1G29350 [Arabidopsis thaliana]
Length=831

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 87/150 (58%), Gaps = 33/150 (22%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYN  481
            T+LG +D LSSQYK+NH L++LQQ           ENS MW  GHGSRTMS  P NTYYN
Sbjct  691  TTLGYEDVLSSQYKENH-LLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYN  749

Query  480  IQAQNQQPS--------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQ  343
            +QAQ Q                 G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQ
Sbjct  750  LQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQ  805

Query  342  NPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
            NPRDG     G  A      S QQLWQNSY
Sbjct  806  NPRDG----AGSQAGQPSNQSQQQLWQNSY  831



>gb|AAG51729.1|AC068667_8 unknown protein; 16040-11188 [Arabidopsis thaliana]
Length=858

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 87/150 (58%), Gaps = 33/150 (22%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYN  481
            T+LG +D LSSQYK+NH L++LQQ           ENS MW  GHGSRTMS  P NTYYN
Sbjct  718  TTLGYEDVLSSQYKENH-LLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYN  776

Query  480  IQAQNQQPS--------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQ  343
            +QAQ Q                 G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQ
Sbjct  777  LQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQ  832

Query  342  NPRDGPLggggGNAQVQPKPSSQQLWQNSY  253
            NPRDG     G  A      S QQLWQNSY
Sbjct  833  NPRDG----AGSQAGQPSNQSQQQLWQNSY  858



>emb|CDX99817.1| BnaC05g22390D [Brassica napus]
Length=620

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 79/137 (58%), Gaps = 27/137 (20%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV---------ENSGMWLHGHGSRTMSAAPANTYYN  481
            S   G +D LSSQYK+N HL++LQQ          +NS MW HGHGSRTMS  PAN YYN
Sbjct  501  SAPTGYEDVLSSQYKENSHLLALQQQQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYYN  560

Query  480  IQAQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  301
            +Q Q Q     +Q       Y S GY PNFY SQT +S  H  QQQNPRDG        A
Sbjct  561  LQQQQQLQQAQQQQ------YGSHGY-PNFYQSQTEMS--HERQQQNPRDG--------A  603

Query  300  QVQPK-PSSQQLWQNSY  253
              QP   + QQLWQNSY
Sbjct  604  GAQPSNQTQQQLWQNSY  620



>emb|CDY48333.1| BnaA09g26880D [Brassica napus]
Length=823

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 83/140 (59%), Gaps = 25/140 (18%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV------ENSGMWLHGHGSRTMSAAPANTYYNIQA  472
            S   G +D LSSQYK+N HL++LQQ       +NS MW HGHGSRTMS  PAN YYN+Q 
Sbjct  696  SAPTGYEDVLSSQYKENSHLLALQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYYNLQQ  755

Query  471  QNQQPS------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggg  310
            Q Q         G+RQ QQ  Q Y S GY PNFY SQT +S  H  QQQNPRD       
Sbjct  756  QQQLQQAQQAAGGYRQAQQ-QQQYGSHGY-PNFYQSQTEMS--HERQQQNPRDA------  805

Query  309  GNAQVQPK-PSSQQLWQNSY  253
              A  QP   + QQLWQNSY
Sbjct  806  --AGAQPSNQTQQQLWQNSY  823



>ref|XP_008645740.1| PREDICTED: uncharacterized protein LOC103627229 [Zea mays]
Length=281

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 75/130 (58%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQ  463
            A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q++
Sbjct  162  AAPTTLGFDEALGTQFKHPNHYAALQQSDNSAMWLHGGAGSRTISAVPPGNFYGFQGQSK  221

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
               GFRQ   P Q Y  LGY P+FY SQT +  +H    Q+P +G L     N    P  
Sbjct  222  H-GGFRQAHHPSQ-YGGLGY-PSFYQSQTSLPQEH---PQSPTEGSL----NNPYGVPSQ  271

Query  282  SSQQLWQNSY  253
             S QLWQ+ Y
Sbjct  272  PSHQLWQHIY  281



>ref|XP_007147529.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
 gb|ESW19523.1| hypothetical protein PHAVU_006G132200g [Phaseolus vulgaris]
Length=843

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 14/134 (10%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQ------  469
            T++G +D ++SQ+KD++H++SLQQ +NS MW+ G G RTMSA P + YY++Q Q      
Sbjct  716  TTIGYEDLINSQFKDSNHMISLQQNDNSPMWVQGPGPRTMSAVPPSNYYSMQGQSQQQAG  775

Query  468  --NQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV  295
               Q+    +Q QQP Q++ SLGY PNFY SQ+GISL+  HQ QNPR+  LGG       
Sbjct  776  GFRQRQQQQQQQQQPSQHFGSLGY-PNFYQSQSGISLE--HQPQNPREASLGGPQSQPSK  832

Query  294  QPKPSSQQLWQNSY  253
            Q   S QQLWQNSY
Sbjct  833  Q---SQQQLWQNSY  843



>ref|XP_002440264.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
 gb|EES18694.1| hypothetical protein SORBIDRAFT_09g028730 [Sorghum bicolor]
Length=856

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 71/125 (57%), Gaps = 10/125 (8%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +++LG D+ LS QYKD    M+LQQ +NSGMWLHG GSR  S  P N +Y  Q Q+Q   
Sbjct  736  ASTLGFDEALSRQYKDTSQYMALQQGDNSGMWLHGSGSRATSTLPPNHFYGYQGQSQL-G  794

Query  453  GFRQVQQP-PQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            GFRQ QQP P  +   GY P FY SQ G++ +H    QN  +G L       QV P   S
Sbjct  795  GFRQAQQPQPSQFGGHGY-PTFYQSQGGLTQEH---PQNLAEGSL----NGFQVAPSQPS  846

Query  276  QQLWQ  262
               WQ
Sbjct  847  HPNWQ  851



>ref|XP_006586817.1| PREDICTED: cell wall protein AWA1-like isoform X2 [Glycine max]
Length=837

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 86/136 (63%), Gaps = 17/136 (13%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQ--------  475
            T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q        
Sbjct  709  TTIGYEDVINSQFKDNNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPG  768

Query  474  --AQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  301
               Q  Q    +Q Q P Q++  LGY PNFY SQTGISL+   Q QNPR+  LGG     
Sbjct  769  GFRQRHQQQQQQQQQPPLQHFGPLGY-PNFYQSQTGISLE--QQPQNPREASLGGPQSQP  825

Query  300  QVQPKPSSQQLWQNSY  253
              Q    SQQ+WQNSY
Sbjct  826  SKQ----SQQIWQNSY  837



>ref|XP_003534759.1| PREDICTED: cell wall protein AWA1-like isoform X1 [Glycine max]
Length=838

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 86/136 (63%), Gaps = 17/136 (13%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQ--------  475
            T++G +D ++SQ+KDN+H+MSLQQ ENS MW+ G GSRTMSA P + YYN+Q        
Sbjct  710  TTIGYEDVINSQFKDNNHMMSLQQNENSPMWVQGPGSRTMSAVPPSNYYNLQGQNQQQPG  769

Query  474  --AQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNA  301
               Q  Q    +Q Q P Q++  LGY PNFY SQTGISL+   Q QNPR+  LGG     
Sbjct  770  GFRQRHQQQQQQQQQPPLQHFGPLGY-PNFYQSQTGISLE--QQPQNPREASLGGPQSQP  826

Query  300  QVQPKPSSQQLWQNSY  253
              Q    SQQ+WQNSY
Sbjct  827  SKQ----SQQIWQNSY  838



>gb|AFW71654.1| hypothetical protein ZEAMMB73_647126 [Zea mays]
Length=432

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 75/130 (58%), Gaps = 11/130 (8%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQ  463
            A  T+LG D+ L +Q+K  +H  +LQQ +NS MWLH G GSRT+SA P   +Y  Q Q++
Sbjct  313  AAPTTLGFDEALGTQFKHPNHYAALQQSDNSAMWLHGGAGSRTISAVPPGNFYGFQGQSK  372

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
               GFRQ   P Q Y  LGY P+FY SQT +  +H    Q+P +G L     N    P  
Sbjct  373  H-GGFRQAHHPSQ-YGGLGY-PSFYQSQTSLPQEH---PQSPTEGSL----NNPYGVPSQ  422

Query  282  SSQQLWQNSY  253
             S QLWQ+ Y
Sbjct  423  PSHQLWQHIY  432



>ref|XP_009141365.1| PREDICTED: RNA polymerase II degradation factor 1-like [Brassica 
rapa]
Length=819

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (61%), Gaps = 21/137 (15%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV---------ENSGMWLHGHGSRTMSAAPANTYYNI  478
            T+L  +D +S QYK N HL+SLQQ          ENS +WLHG GS+TMS   +N YYN+
Sbjct  693  TTLSYEDVMSLQYKQNSHLLSLQQQQQQQQQQQNENSPVWLHGPGSQTMSGVQSNAYYNL  752

Query  477  QAQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQ  298
            QAQ Q     +  QQ    Y SLGY PN+Y SQTG+S++  HQQ+NPR+G        +Q
Sbjct  753  QAQQQAQQLRQAQQQAQHQYGSLGY-PNYYQSQTGMSME--HQQRNPREG-------GSQ  802

Query  297  VQPKPSS--QQLWQNSY  253
             QP   +  Q LWQNSY
Sbjct  803  GQPSKQTPQQHLWQNSY  819



>ref|XP_009394232.1| PREDICTED: uncharacterized protein LOC103979756 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            T +G+D+ L+ Q+++  H + LQQ EN  MW+HG GSRTMSA P +T+YN   QNQ  SG
Sbjct  768  TMIGLDEALNLQHREASHHVPLQQSENPAMWIHGGGSRTMSALPTSTFYNYPGQNQH-SG  826

Query  450  FRQVQQPPQNYASLGYNPNFYH-SQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            FRQ QQ   +  +LGY PN +H +Q G S +H   QQN  DG + G      VQ +P++ 
Sbjct  827  FRQTQQ-SSHLGALGY-PNLHHDAQAGPSQEH---QQNLSDGNMSGSQT---VQSQPAN-  877

Query  273  QLWQNSY  253
            Q+WQ+ Y
Sbjct  878  QIWQHGY  884



>ref|XP_009115248.1| PREDICTED: putative uncharacterized protein DDB_G0271606 [Brassica 
rapa]
Length=859

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 82/140 (59%), Gaps = 25/140 (18%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV------ENSGMWLHGHGSRTMSAAPANTYYNIQA  472
            S   G +D LSSQYK+N +L++LQQ       +NS MW HGHGSRTMS  PAN Y+N+Q 
Sbjct  732  SAPTGYEDVLSSQYKENSNLLALQQQQQQQQNDNSAMWHHGHGSRTMSGVPANAYFNLQQ  791

Query  471  QNQQPS------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgggg  310
            Q Q         G+RQ QQ  Q Y S GY PNFY SQT   + H  QQQNPRD       
Sbjct  792  QQQLQQAQQAAGGYRQAQQ-QQQYGSHGY-PNFYQSQT--EMPHERQQQNPRDA------  841

Query  309  GNAQVQPK-PSSQQLWQNSY  253
              A  QP   + QQLWQNSY
Sbjct  842  --AGAQPSNQTQQQLWQNSY  859



>emb|CDY61562.1| BnaCnng37970D [Brassica napus]
Length=762

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 17/132 (13%)
 Frame = -1

Query  627  SLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            +L  +D +S QYK N+HL+SLQQ      +NS +W+HG GS+TMS   +N YY++QAQ Q
Sbjct  641  TLSYEDIMSLQYKQNNHLLSLQQQQQQQNDNSPLWVHGPGSQTMSGVQSNAYYSLQAQQQ  700

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKP  283
                 +  Q+  Q Y SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q QP  
Sbjct  701  AQQLRQAQQEAQQQYGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQPSK  750

Query  282  SSQQ--LWQNSY  253
             +QQ  LWQNSY
Sbjct  751  QTQQQHLWQNSY  762



>ref|XP_008656717.1| PREDICTED: uncharacterized protein LOC103636139 [Zea mays]
 gb|AFW83479.1| putative DUF1296 domain containing family protein [Zea mays]
Length=840

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = -1

Query  639  APS--TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQ  469
            APS  T+LG D+ L +Q+KD +H  +LQQ +NS MWLH G GSRT+SA P   +Y +Q Q
Sbjct  717  APSAPTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGGAGSRTVSAVPPGNFYGLQGQ  776

Query  468  NQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQP  289
            +QQ  GFRQ  QP Q Y  LGY P+FY SQ+  SL   H  QN  +G L     N+Q  P
Sbjct  777  SQQ-GGFRQAHQPSQ-YGGLGY-PSFYQSQSQASLPQEH-PQNLTEGSL----NNSQGVP  828

Query  288  KPSSQQLWQNSY  253
               S  LWQ+SY
Sbjct  829  SQPSHHLWQHSY  840



>emb|CDY11787.1| BnaC03g57910D [Brassica napus]
Length=737

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 83/134 (62%), Gaps = 25/134 (19%)
 Frame = -1

Query  606  LSSQYKDNHHLMSLQ----QVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS-----  454
            LSS++  ++H+++LQ    Q ENS MW HGHGSRTMS  PANT+YN+QAQ QQ       
Sbjct  613  LSSKHTRSNHVLALQHQQQQNENSAMWHHGHGSRTMSGVPANTHYNLQAQQQQQLQQTQQ  672

Query  453  ----GFR-QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQV--  295
                G+R   QQ  Q Y S GY+ NFY  QT +SL+   QQQNPRDG        AQV  
Sbjct  673  AAAVGYRQAQQQQQQRYGSYGYS-NFYQFQTEMSLE--RQQQNPRDG------AGAQVGQ  723

Query  294  QPKPSSQQLWQNSY  253
            QP   +QQLWQNSY
Sbjct  724  QPSDQTQQLWQNSY  737



>ref|XP_004969440.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X2 [Setaria italica]
Length=837

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 71/131 (54%), Gaps = 11/131 (8%)
 Frame = -1

Query  639  APS--TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQN  466
            APS  T+LG D+ L +Q+KD +H  +LQQ +NS MWLHG      +  P N Y       
Sbjct  716  APSAPTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGAAGSRAAVPPGNFYGFQGQSQ  775

Query  465  QQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            Q      QVQQP Q Y  LGY P+FY SQ G+  +H    QNP +G L     N Q  P 
Sbjct  776  QGGFRQAQVQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNPTEGSL----NNPQAAPS  826

Query  285  PSSQQLWQNSY  253
              S QLWQ+SY
Sbjct  827  QPSHQLWQHSY  837



>ref|XP_004969439.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform 
X1 [Setaria italica]
Length=839

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 71/131 (54%), Gaps = 11/131 (8%)
 Frame = -1

Query  639  APS--TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQN  466
            APS  T+LG D+ L +Q+KD +H  +LQQ +NS MWLHG      +  P N Y       
Sbjct  718  APSAPTTLGFDEALGTQFKDPNHYAALQQSDNSAMWLHGAAGSRAAVPPGNFYGFQGQSQ  777

Query  465  QQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPK  286
            Q      QVQQP Q Y  LGY P+FY SQ G+  +H    QNP +G L     N Q  P 
Sbjct  778  QGGFRQAQVQQPSQ-YGGLGY-PSFYQSQAGLPQEH---PQNPTEGSL----NNPQAAPS  828

Query  285  PSSQQLWQNSY  253
              S QLWQ+SY
Sbjct  829  QPSHQLWQHSY  839



>ref|XP_010540528.1| PREDICTED: uncharacterized protein LOC104814266 [Tarenaya hassleriana]
Length=832

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 87/142 (61%), Gaps = 25/142 (18%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWL-HGHGSRTMSAAPANTYYN  481
            APS T+LG +D LSSQYK+++HL+SLQQ      ENSGMW+ HG  SRTM A P+NTYYN
Sbjct  703  APSGTTLGYEDVLSSQYKESNHLLSLQQQQQQQNENSGMWIHHGSASRTMPAVPSNTYYN  762

Query  480  ---IQAQNQQPSGFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  316
                Q   Q  SG+R    QQ   +Y SLGY PNFY SQTG+      +QQN   GP   
Sbjct  763  HLQAQQNQQASSGYRQAASQQQQHHYGSLGY-PNFYQSQTGMMA---MEQQNRDGGP---  815

Query  315  ggGNAQVQP-KPSSQQLWQNSY  253
                 Q QP K + QQ+W NSY
Sbjct  816  -----QGQPSKQNQQQMWPNSY  832



>ref|XP_009396491.1| PREDICTED: uncharacterized protein LOC103981474 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=885

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQP  457
            ST+ G D+ LS Q K+  H M  QQ EN  +WLH   GSR M A PA+T+YN Q Q+QQ 
Sbjct  768  STTTGFDESLSLQNKEESHYMPPQQSENPNLWLHSAAGSRAMPALPASTFYNYQGQSQQ-  826

Query  456  SGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            SGFRQ  Q   +  +LGY PN YHS  G+S +H   QQN  +G L  G    Q  P   +
Sbjct  827  SGFRQSPQ-ASHLGALGY-PNLYHSPAGLSREH---QQNTGEGNL-NGPPTTQAHP---A  877

Query  276  QQLWQNSY  253
             Q+WQ+ Y
Sbjct  878  NQIWQHGY  885



>ref|XP_009396490.1| PREDICTED: uncharacterized protein LOC103981474 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 75/128 (59%), Gaps = 11/128 (9%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLH-GHGSRTMSAAPANTYYNIQAQNQQP  457
            ST+ G D+ LS Q K+  H M  QQ EN  +WLH   GSR M A PA+T+YN Q Q+QQ 
Sbjct  769  STTTGFDESLSLQNKEESHYMPPQQSENPNLWLHSAAGSRAMPALPASTFYNYQGQSQQ-  827

Query  456  SGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
            SGFRQ  Q   +  +LGY PN YHS  G+S +H   QQN  +G L  G    Q  P   +
Sbjct  828  SGFRQSPQ-ASHLGALGY-PNLYHSPAGLSREH---QQNTGEGNL-NGPPTTQAHP---A  878

Query  276  QQLWQNSY  253
             Q+WQ+ Y
Sbjct  879  NQIWQHGY  886



>emb|CDY43685.1| BnaA04g20060D [Brassica napus]
Length=830

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 83/135 (61%), Gaps = 20/135 (15%)
 Frame = -1

Query  627  SLGIDDGLSSQYKDNHHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQA  472
            +L  +D +S QYK N HL+SLQQ         ENS +WLHG GS+TMS   +N YYN+QA
Sbjct  706  TLSYEDVMSLQYKQNSHLLSLQQQQQQQQQQNENSPVWLHGPGSQTMSGVQSNAYYNLQA  765

Query  471  QNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ  292
            Q Q     +  QQ  Q Y SLGY PN+Y SQTG+S++  +QQ+NPR+G        +Q Q
Sbjct  766  QQQAQQLRQAQQQAQQQYGSLGY-PNYYQSQTGMSME--YQQRNPREG-------GSQGQ  815

Query  291  PKPSS--QQLWQNSY  253
            P   +  Q LWQNSY
Sbjct  816  PSKQTPQQHLWQNSY  830



>ref|XP_004961192.1| PREDICTED: flocculation protein FLO11-like isoform X2 [Setaria 
italica]
Length=846

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR  SA P   +Y  Q Q+Q   
Sbjct  726  ASTLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSRATSALPQGHFYGFQGQSQL-G  784

Query  453  GFRQVQQP-PQNYASLGYNPNFYHSQTGIS  367
            GFRQ QQP P  +   GY P FY SQ G++
Sbjct  785  GFRQAQQPQPSQFGGHGY-PTFYQSQGGLT  813



>ref|XP_004961191.1| PREDICTED: flocculation protein FLO11-like isoform X1 [Setaria 
italica]
Length=847

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +++LG D+ LS QYKD    M+ QQ +NS MWLHG GSR  SA P   +Y  Q Q+Q   
Sbjct  727  ASTLGFDEALSRQYKDTSQYMAPQQGDNSAMWLHGSGSRATSALPQGHFYGFQGQSQL-G  785

Query  453  GFRQVQQP-PQNYASLGYNPNFYHSQTGIS  367
            GFRQ QQP P  +   GY P FY SQ G++
Sbjct  786  GFRQAQQPQPSQFGGHGY-PTFYQSQGGLT  814



>gb|AAL58943.1|AF462857_1 At1g29350/F15D2_27 [Arabidopsis thaliana]
Length=832

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 74/123 (60%), Gaps = 29/123 (24%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQV----------ENSGMWLHGHGSRTMSAAPANTYYN  481
            T+LG +D LSSQYK+NH L++LQQ           ENS MW  GHGSRTMS  P NTYYN
Sbjct  691  TTLGYEDVLSSQYKENH-LLALQQQQQQQQHQQQNENSAMWHQGHGSRTMSGVPTNTYYN  749

Query  480  IQAQNQQPS--------------GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQ  343
            +QAQ Q                 G+RQ QQ  Q+Y S GY PN+Y SQT +SL+   QQQ
Sbjct  750  LQAQQQLQLQHQQQQQQAQQAAGGYRQAQQ-QQHYGSHGY-PNYYQSQTEMSLE--RQQQ  805

Query  342  NPR  334
            NPR
Sbjct  806  NPR  808



>emb|CDY43334.1| BnaC03g59060D [Brassica napus]
Length=822

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 87/143 (61%), Gaps = 25/143 (17%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV----ENSGMWLHGHGSRTMSAAPANTYYNIQAQN  466
            S   G +D LSSQYK+++HL++LQ      ENS MW HGHGSRTMS  PANTYYN+QAQ 
Sbjct  689  SAPTGYEDVLSSQYKESNHLLALQHQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQQ  748

Query  465  QQPS--------GFR-QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggg  313
            QQ          G+R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG     
Sbjct  749  QQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG-----  800

Query  312  gGNAQV---QPKPSSQQLWQNSY  253
               AQV       + QQLWQNSY
Sbjct  801  -AGAQVGQQTSDQTQQQLWQNSY  822



>emb|CDX90188.1| BnaA08g17960D [Brassica napus]
Length=822

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQ  469
            S   G +D LSSQYK+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ
Sbjct  688  SAPTGYEDVLSSQYKESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQ  747

Query  468  NQQPS--------GFR-QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  316
             QQ          G+R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG    
Sbjct  748  QQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG----  800

Query  315  ggGNAQV---QPKPSSQQLWQNSY  253
                AQV       + QQLWQNSY
Sbjct  801  --AGAQVGQQPSDQTQQQLWQNSY  822



>ref|XP_009109669.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Brassica rapa]
Length=822

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQ  469
            S   G +D LSSQYK+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ
Sbjct  688  SAPTGYEDVLSSQYKESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQ  747

Query  468  NQQPS--------GFR-QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  316
             QQ          G+R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG    
Sbjct  748  QQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG----  800

Query  315  ggGNAQV---QPKPSSQQLWQNSY  253
                AQV       + QQLWQNSY
Sbjct  801  --AGAQVGQQPSDQTQQQLWQNSY  822



>ref|XP_009109668.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Brassica rapa]
Length=823

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 87/144 (60%), Gaps = 26/144 (18%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV-----ENSGMWLHGHGSRTMSAAPANTYYNIQAQ  469
            S   G +D LSSQYK+++HL++LQ       ENS MW HGHGSRTMS  PANTYYN+QAQ
Sbjct  689  SAPTGYEDVLSSQYKESNHLLALQHQQQQQNENSAMWHHGHGSRTMSGVPANTYYNLQAQ  748

Query  468  NQQPS--------GFR-QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLgg  316
             QQ          G+R   QQ  Q Y S GY PNFY SQT +SL+   QQQNPRDG    
Sbjct  749  QQQLQQTQQAAAGGYRQAQQQQQQRYGSHGY-PNFYQSQTEMSLE--RQQQNPRDG----  801

Query  315  ggGNAQV---QPKPSSQQLWQNSY  253
                AQV       + QQLWQNSY
Sbjct  802  --AGAQVGQQPSDQTQQQLWQNSY  823



>gb|KFK36320.1| hypothetical protein AALP_AA4G107400 [Arabis alpina]
Length=834

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 8/105 (8%)
 Frame = -1

Query  627  SLGIDDGLSSQYKDNHHLMSLQQVE-----NSGMWLHGHGSRTMSAAPANTYYNIQAQNQ  463
            +L  +D L+ QYK N+HL+SLQQ +     N  +WLHG GS+TMS   +NTYYN+QAQ Q
Sbjct  710  TLSYEDVLNLQYKQNNHLLSLQQQQQHQQQNEPVWLHGPGSQTMSGVTSNTYYNLQAQQQ  769

Query  462  QPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  328
                 +  QQ  Q Y SLGY PN+Y  QTG+S++  HQQQNPRDG
Sbjct  770  AQQLRQAQQQAQQQYGSLGY-PNYYQPQTGMSME--HQQQNPRDG  811



>gb|EMS63247.1| hypothetical protein TRIUR3_29233 [Triticum urartu]
Length=823

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            PS +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+QQ
Sbjct  717  PSANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQQ  776

Query  459  PSGFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  322
               FR  Q  Q P  Y   GY P FYHSQ G++ +HH   QNP DG L
Sbjct  777  QGAFRQAQQPQQPSQYGGHGY-PAFYHSQGGMAQEHH--PQNPADGAL  821



>ref|XP_006654800.1| PREDICTED: uncharacterized protein LOC102700994 [Oryza brachyantha]
Length=815

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 74/125 (59%), Gaps = 8/125 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST+LG D+ LS+ YKD +  M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ  
Sbjct  693  STNLGFDEALSTPYKDPNQYMALQQGDNSAMWLHGAGSRATSAVPPSHFYGFQGQSQQGG  752

Query  453  G-FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
                Q  Q    +   GY P FYHSQ+G++ +HH   QNP +G    G  +AQ QP   S
Sbjct  753  FRQAQQPQQHSQFGGHGY-PAFYHSQSGLTQEHH---QNPAEGGGLNGFQSAQSQP---S  805

Query  276  QQLWQ  262
             Q WQ
Sbjct  806  HQGWQ  810



>ref|XP_008650021.1| PREDICTED: cell wall protein AWA1-like [Zea mays]
 gb|AFW79202.1| putative DUF1296 domain containing family protein [Zea mays]
Length=851

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +++LG D+ LS QYK+    M+LQQ +NSGMW+HG GSR  S  P N +Y  Q Q+Q   
Sbjct  734  ASALGFDEALSRQYKNTSQYMALQQGDNSGMWVHGSGSRAASTLPPNHFYGYQGQSQL-G  792

Query  453  GFRQVQQP-PQNYASLGYNPNFYHSQ  379
            GF + QQP P  +   GY P  Y SQ
Sbjct  793  GFARAQQPQPSQFGGHGY-PTVYQSQ  817



>dbj|BAJ92311.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQ-VENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+QQ 
Sbjct  740  SANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQQQ  799

Query  456  SGFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  322
              FR  Q  Q P  Y   GY P FYH+Q G++ +HH   QNP DG L
Sbjct  800  GAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQEHH--PQNPADGTL  843



>ref|XP_010413764.1| PREDICTED: probable serine/threonine-protein kinase yakA isoform 
X2 [Camelina sativa]
Length=843

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 73/135 (54%), Gaps = 34/135 (25%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV------------------------------E  553
            APS  +L  +D LS QYK N++L+SLQQ                               E
Sbjct  691  APSGATLSYEDVLSLQYKQNNYLLSLQQQQQQQLQQQQQQQQQQQQQQQQQQQQHQQQNE  750

Query  552  NSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTG  373
            N  MWLHG GS+TMS    NTYYN+QAQ Q     +  QQ  Q Y  LGY PN+Y SQTG
Sbjct  751  NLPMWLHGPGSQTMSGVAGNTYYNLQAQQQSQQVRQAQQQEQQQYGLLGY-PNYYQSQTG  809

Query  372  ISLDHHHQQQNPRDG  328
            IS++  HQQQNPR+G
Sbjct  810  ISIE--HQQQNPREG  822



>ref|XP_010413763.1| PREDICTED: alpha-protein kinase 1-like isoform X1 [Camelina sativa]
Length=864

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 73/135 (54%), Gaps = 34/135 (25%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV------------------------------E  553
            APS  +L  +D LS QYK N++L+SLQQ                               E
Sbjct  712  APSGATLSYEDVLSLQYKQNNYLLSLQQQQQQQLQQQQQQQQQQQQQQQQQQQQHQQQNE  771

Query  552  NSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTG  373
            N  MWLHG GS+TMS    NTYYN+QAQ Q     +  QQ  Q Y  LGY PN+Y SQTG
Sbjct  772  NLPMWLHGPGSQTMSGVAGNTYYNLQAQQQSQQVRQAQQQEQQQYGLLGY-PNYYQSQTG  830

Query  372  ISLDHHHQQQNPRDG  328
            IS++  HQQQNPR+G
Sbjct  831  ISIE--HQQQNPREG  843



>ref|XP_003567874.1| PREDICTED: uncharacterized protein LOC100840916 [Brachypodium 
distachyon]
Length=859

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 7/108 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKD-NHHLMSLQQ-VENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            ST+ G D+ L +QYKD N ++ +LQQ  +NS MWLHG GSRT +A P   +Y  Q Q+QQ
Sbjct  734  STNAGFDEALGAQYKDANQYMAALQQQGDNSAMWLHGAGSRTAAALPPTQFYGYQGQSQQ  793

Query  459  PSGFRQVQQPPQNYASLGYN--PNFYHSQTGISLDHHHQQQNPRDGPL  322
                RQ QQ PQ  +  G +  P FYHSQ+G++ +HH   QNP +  L
Sbjct  794  -GALRQAQQQPQQPSQFGGHGYPAFYHSQSGMTQEHH--PQNPSEASL  838



>dbj|BAJ85689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=869

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQ-VENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            S +LG D+ LS+QYK+ +  M+LQQ  +NS MWLHG GSRT SA P   +Y  Q Q+QQ 
Sbjct  740  SANLGFDEALSAQYKEANQYMALQQQGDNSAMWLHGAGSRTASALPPTQFYGYQGQSQQQ  799

Query  456  SGFR--QVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  322
              FR  Q  Q P  Y   GY P FYH+Q G++  HH   QNP DG L
Sbjct  800  GAFRQAQQPQQPSQYGGHGY-PAFYHNQGGLAQGHH--PQNPADGTL  843



>emb|CDX84653.1| BnaA03g15770D [Brassica napus]
Length=813

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 84/135 (62%), Gaps = 20/135 (15%)
 Frame = -1

Query  627  SLGIDDGLSSQYKDNHHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQA  472
            +L  +D +S QYK N HL+SLQQ         +NS +W+HG GS+TMS   +N YYN+QA
Sbjct  689  TLSYEDIMSLQYKHNSHLLSLQQQQQQQQHQNDNSPLWVHGPGSQTMSGVQSNAYYNLQA  748

Query  471  QNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ  292
            Q Q     +  QQ  Q + SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q Q
Sbjct  749  QQQAQQLRQAQQQAQQQHGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQ  798

Query  291  PKPSSQQ--LWQNSY  253
            P   +QQ  LWQNSY
Sbjct  799  PSKQTQQQHLWQNSY  813



>ref|XP_009132981.1| PREDICTED: uncharacterized protein LOC103857526 [Brassica rapa]
Length=808

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 84/135 (62%), Gaps = 20/135 (15%)
 Frame = -1

Query  627  SLGIDDGLSSQYKDNHHLMSLQQV--------ENSGMWLHGHGSRTMSAAPANTYYNIQA  472
            +L  +D +S QYK N HL+SLQQ         +NS +W+HG GS+TMS   +N YYN+QA
Sbjct  684  TLSYEDIMSLQYKHNSHLLSLQQQQQQQQHQNDNSPLWVHGPGSQTMSGVQSNAYYNLQA  743

Query  471  QNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQ  292
            Q Q     +  QQ  Q + SLGY PN+Y SQTG+S++  HQQQNPR+G        +Q Q
Sbjct  744  QQQAQQLRQAQQQAQQQHGSLGY-PNYYQSQTGMSME--HQQQNPREG-------GSQGQ  793

Query  291  PKPSSQQ--LWQNSY  253
            P   +QQ  LWQNSY
Sbjct  794  PSKQTQQQHLWQNSY  808



>ref|XP_007048866.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
 gb|EOX93023.1| Uncharacterized protein TCM_001879 [Theobroma cacao]
Length=873

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 73/132 (55%), Gaps = 18/132 (14%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKD---NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            + +G DD L SQY+D   N +L  LQQ + S +W + HGSRT S  P + YY++Q QN Q
Sbjct  754  SKVGYDDFLRSQYRDGGANFNL--LQQNDGSAVWDYVHGSRTTSTIPHSAYYSLQGQNHQ  811

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
             +G+ Q Q+  Q +  LGY P  Y+SQ GI+     QQQN  D  L G          PS
Sbjct  812  LAGYHQGQRHSQLHGFLGY-PGVYNSQAGIT--REQQQQNLGDVILNGSQ-------SPS  861

Query  279  SQQL---WQNSY  253
            S+QL   WQ  Y
Sbjct  862  SKQLPQNWQRRY  873



>ref|XP_006410567.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52020.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=842

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 69/119 (58%), Gaps = 21/119 (18%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV-------------ENSGMWLHGHGSRTMSAA  502
            APS  SL  +D LS QYK N+HL+SLQQ              ENS MWLHG GS+TMS  
Sbjct  710  APSGASLSYEDALSLQYKQNNHLLSLQQQQQLQQQQLQQQQNENSPMWLHGPGSQTMSGV  769

Query  501  PANTYYNI-QAQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  328
            P+NTYYN+   Q  Q     Q Q   Q Y SLGY PN+Y SQT       HQQQNPRDG
Sbjct  770  PSNTYYNLQAQQQAQQVRQAQQQAQQQQYGSLGY-PNYYQSQT-----MEHQQQNPRDG  822



>ref|XP_006410569.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
 gb|ESQ52022.1| hypothetical protein EUTSA_v10016218mg [Eutrema salsugineum]
Length=840

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 69/119 (58%), Gaps = 21/119 (18%)
 Frame = -1

Query  639  APS-TSLGIDDGLSSQYKDNHHLMSLQQV-------------ENSGMWLHGHGSRTMSAA  502
            APS  SL  +D LS QYK N+HL+SLQQ              ENS MWLHG GS+TMS  
Sbjct  708  APSGASLSYEDALSLQYKQNNHLLSLQQQQQLQQQQLQQQQNENSPMWLHGPGSQTMSGV  767

Query  501  PANTYYNI-QAQNQQPSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDG  328
            P+NTYYN+   Q  Q     Q Q   Q Y SLGY PN+Y SQT       HQQQNPRDG
Sbjct  768  PSNTYYNLQAQQQAQQVRQAQQQAQQQQYGSLGY-PNYYQSQT-----MEHQQQNPRDG  820



>ref|XP_010102151.1| hypothetical protein L484_021385 [Morus notabilis]
 gb|EXB92401.1| hypothetical protein L484_021385 [Morus notabilis]
Length=826

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 51/88 (58%), Gaps = 3/88 (3%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  442
            G DD    QYKD  H   LQQ  NS  W  G GSR + +A    YYN+  QNQQ SG+RQ
Sbjct  714  GYDDLFHRQYKDRDHFTPLQQ--NSSSWNQGPGSRKLPSAEEIAYYNLHGQNQQYSGYRQ  771

Query  441  VQQPPQNYASLGYNPNFYHSQTGISLDH  358
              QP Q Y  L Y+ N Y SQTG++ +H
Sbjct  772  DHQPSQYYGGLEYS-NPYRSQTGMAREH  798



>ref|NP_001266740.1| uncharacterized protein LOC101027201 [Zea mays]
 gb|ACN30616.1| unknown [Zea mays]
Length=390

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 66/123 (54%), Gaps = 8/123 (7%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q    
Sbjct  271  STLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLGGF  329

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
             +  QQ P  +   GY P FY SQ G++ +HH   QN  +G L       QV P   S  
Sbjct  330  GQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSL----NGFQVAPSQPSHP  382

Query  270  LWQ  262
             WQ
Sbjct  383  SWQ  385



>ref|XP_002440322.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
 gb|EES18752.1| hypothetical protein SORBIDRAFT_09g029670 [Sorghum bicolor]
Length=649

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 66/127 (52%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            +T+LG D  + S +KD +  +SLQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  543  TTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-A  601

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  602  GLRQGQLPSQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  642

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  643  QMWPNSY  649



>ref|XP_008655403.1| PREDICTED: uncharacterized protein LOC101027201 isoform X2 [Zea 
mays]
Length=836

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 66/123 (54%), Gaps = 8/123 (7%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q    
Sbjct  717  STLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLGGF  775

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
             +  QQ P  +   GY P FY SQ G++ +HH   QN  +G L       QV P   S  
Sbjct  776  GQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSL----NGFQVAPSQPSHP  828

Query  270  LWQ  262
             WQ
Sbjct  829  SWQ  831



>ref|XP_008655402.1| PREDICTED: uncharacterized protein LOC101027201 isoform X1 [Zea 
mays]
 gb|AFW81159.1| putative DUF1296 domain containing family protein [Zea mays]
Length=856

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 66/123 (54%), Gaps = 8/123 (7%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSG  451
            ++L  DD L  QYKD    ++LQQ +NSGMWLHG GSR  +A P N +Y  Q Q+Q    
Sbjct  737  STLVFDDALGRQYKDTSQHIALQQPDNSGMWLHGSGSRA-AALPPNHFYGYQGQSQLGGF  795

Query  450  FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
             +  QQ P  +   GY P FY SQ G++ +HH   QN  +G L       QV P   S  
Sbjct  796  GQAQQQQPSQFGGHGY-PTFYQSQGGLTQEHH--PQNLAEGSL----NGFQVAPSQPSHP  848

Query  270  LWQ  262
             WQ
Sbjct  849  SWQ  851



>ref|NP_001056347.1| Os05g0566900 [Oryza sativa Japonica Group]
 gb|AAU10662.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18261.1| Os05g0566900 [Oryza sativa Japonica Group]
 dbj|BAG89781.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00089.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64717.1| hypothetical protein OsJ_19573 [Oryza sativa Japonica Group]
Length=852

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 71/125 (57%), Gaps = 12/125 (10%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST+LG D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ  
Sbjct  734  STNLGFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPPSHFYGFQGQSQQGG  793

Query  453  G-FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
                Q  Q    +   GY P FYHSQ   S +HH   QNP +G L  G  NAQ QP   S
Sbjct  794  FRQAQQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-NGFQNAQSQP---S  842

Query  276  QQLWQ  262
             Q WQ
Sbjct  843  HQGWQ  847



>gb|EEC79711.1| hypothetical protein OsI_21014 [Oryza sativa Indica Group]
Length=852

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 71/125 (57%), Gaps = 12/125 (10%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            ST+LG D+ LS+ YKD    M+LQQ +NS MWLHG GSR  SA P + +Y  Q Q+QQ  
Sbjct  734  STNLGFDEALSTPYKDPSQYMALQQGDNSAMWLHGAGSRATSALPPSHFYGFQGQSQQGG  793

Query  453  G-FRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSS  277
                Q  Q    +   GY P FYHSQ   S +HH   QNP +G L  G  NAQ QP   S
Sbjct  794  FRQAQQPQQHSQFGGHGY-PAFYHSQ---SQEHH---QNPAEGGL-NGFQNAQSQP---S  842

Query  276  QQLWQ  262
             Q WQ
Sbjct  843  HQGWQ  847



>ref|NP_001141689.1| uncharacterized protein LOC100273818 [Zea mays]
 gb|ACN27855.1| unknown [Zea mays]
 gb|ACN28046.1| unknown [Zea mays]
 gb|AFW79333.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 20/129 (16%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            A +T+LG D  + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q
Sbjct  719  AATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ  778

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
             +G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            
Sbjct  779  -AGLRQGQLPSQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------  818

Query  279  SQQLWQNSY  253
            + Q+W N+Y
Sbjct  819  ANQMWPNTY  827



>ref|XP_008647566.1| PREDICTED: uncharacterized protein LOC100273818 isoform X1 [Zea 
mays]
Length=828

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 20/129 (16%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            A +T+LG D  + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q
Sbjct  720  AATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ  779

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
             +G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            
Sbjct  780  -AGLRQGQLPSQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------  819

Query  279  SQQLWQNSY  253
            + Q+W N+Y
Sbjct  820  ANQMWPNTY  828



>gb|ACF86865.1| unknown [Zea mays]
Length=564

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 20/129 (16%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            A +T+LG D  + S +KD +  +SLQQ EN  MW+HG  SR M    A+T Y  Q Q+ Q
Sbjct  456  AATTTLGFDGTVPSHFKDGNQFISLQQNENPAMWMHGASSRGMPPLAASTMYGYQGQSHQ  515

Query  459  PSGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPS  280
             +G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            
Sbjct  516  -AGLRQGQLPSQFGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------  555

Query  279  SQQLWQNSY  253
            + Q+W N+Y
Sbjct  556  ANQMWPNTY  564



>ref|XP_006654843.1| PREDICTED: dentin sialophosphoprotein-like [Oryza brachyantha]
Length=807

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 61/123 (50%), Gaps = 17/123 (14%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  442
            G D  + +QYK+ +H +SLQQ EN  MW+HG GSRTM    AN  Y  Q Q     G RQ
Sbjct  702  GFDGTVPAQYKEGNHFVSLQQSENPAMWMHGAGSRTMPPLAANALYGYQGQQGHQGGLRQ  761

Query  441  VQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  262
             Q P Q  A+LG       SQ G+     H+ +NP DG       N        + Q+W 
Sbjct  762  GQLPSQFGAALG------QSQPGLG----HEHRNPSDG-------NLSAAAAAQANQMWP  804

Query  261  NSY  253
            NSY
Sbjct  805  NSY  807



>gb|AFW81250.1| putative DUF1296 domain containing family protein [Zea mays]
Length=787

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  681  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  739

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  740  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  780

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  781  QMWPNSY  787



>ref|XP_008654854.1| PREDICTED: uncharacterized protein LOC100280182 isoform X4 [Zea 
mays]
Length=791

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  685  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  743

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  744  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  784

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  785  QMWPNSY  791



>ref|XP_008654853.1| PREDICTED: uncharacterized protein LOC100280182 isoform X3 [Zea 
mays]
Length=792

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  686  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  744

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  745  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  785

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  786  QMWPNSY  792



>ref|XP_008654851.1| PREDICTED: uncharacterized protein LOC100280182 isoform X1 [Zea 
mays]
 gb|AFW81249.1| putative DUF1296 domain containing family protein [Zea mays]
Length=826

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  720  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  778

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  779  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  819

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  820  QMWPNSY  826



>ref|XP_008229421.1| PREDICTED: cell wall protein AWA1-like [Prunus mume]
Length=840

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 58/105 (55%), Gaps = 17/105 (16%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            AP +    DD L ++YKD  HL  L Q            SRT+S+ P + Y N+  QNQQ
Sbjct  725  APISMSDYDDALRARYKDGSHLTPLHQ-----------SSRTLSSVPDSVYDNLLRQNQQ  773

Query  459  PSGFRQVQ--QPP---QNYASLGYNPNFYHSQTGISLDHHHQQQN  340
             +G+RQ Q  Q P   Q+Y S GY P+FY SQ GI+ +HH Q  N
Sbjct  774  NAGYRQGQAGQMPSQLQHYGSPGY-PDFYPSQMGITQEHHRQSLN  817



>ref|NP_001146586.1| uncharacterized protein LOC100280182 [Zea mays]
 gb|ACL54332.1| unknown [Zea mays]
Length=827

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  721  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  779

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  780  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  820

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  821  QMWPNSY  827



>ref|XP_008654852.1| PREDICTED: uncharacterized protein LOC100280182 isoform X2 [Zea 
mays]
Length=823

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  717  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  775

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  776  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  816

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  817  QMWPNSY  823



>gb|AFW81248.1| putative DUF1296 domain containing family protein [Zea mays]
Length=827

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  721  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  779

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  780  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  820

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  821  QMWPNSY  827



>gb|AFW81251.1| putative DUF1296 domain containing family protein [Zea mays]
Length=847

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 63/127 (50%), Gaps = 20/127 (16%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPS  454
            + +LG D  + S  +D +  + LQQ EN  MW+HG GSR M    A+T Y  Q Q+ Q +
Sbjct  741  TATLGFDGTVPSHLEDGNQFVCLQQNENPAMWMHGAGSRGMPPLAASTMYGYQGQSHQ-T  799

Query  453  GFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQ  274
            G RQ Q P Q  ++LG       SQ G+  +H    +NP D  L G            + 
Sbjct  800  GLRQGQLPSQYGSALG------QSQPGLGPEH----RNPSDSNLSGAAQ---------AN  840

Query  273  QLWQNSY  253
            Q+W NSY
Sbjct  841  QMWPNSY  847



>ref|XP_004961107.1| PREDICTED: uncharacterized protein LOC101764022 isoform X2 [Setaria 
italica]
Length=793

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 12/105 (11%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            +T+LG D  +   YK+ +  +SLQQ  EN  MW+HG GSR M    A+T Y  Q Q+ Q 
Sbjct  687  TTTLGFDGSVPPHYKEGNQFISLQQQNENPAMWMHGAGSRGMPPLAASTLYGYQGQSHQ-  745

Query  456  SGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  322
            +G RQ Q P Q   +LG       SQ G+  +H    +NP DG L
Sbjct  746  AGLRQGQLPSQFGTALG------QSQPGLGPEH----RNPSDGNL  780



>ref|XP_004961106.1| PREDICTED: uncharacterized protein LOC101764022 isoform X1 [Setaria 
italica]
Length=794

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 12/105 (11%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQV-ENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            +T+LG D  +   YK+ +  +SLQQ  EN  MW+HG GSR M    A+T Y  Q Q+ Q 
Sbjct  688  TTTLGFDGSVPPHYKEGNQFISLQQQNENPAMWMHGAGSRGMPPLAASTLYGYQGQSHQ-  746

Query  456  SGFRQVQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPL  322
            +G RQ Q P Q   +LG       SQ G+  +H    +NP DG L
Sbjct  747  AGLRQGQLPSQFGTALG------QSQPGLGPEH----RNPSDGNL  781



>ref|XP_010230981.1| PREDICTED: uncharacterized protein LOC100825596 isoform X1 [Brachypodium 
distachyon]
Length=850

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 61/123 (50%), Gaps = 19/123 (15%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  442
            G D  + SQYKD +H +SLQQ EN  MW+HG GSR M    ANT Y  Q Q     G RQ
Sbjct  747  GFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGSRGMPPLAANTLYGYQGQQGHQGGLRQ  806

Query  441  VQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  262
             Q P Q  A+LG       SQ G+  +H    +NP D  L   G          + Q+W 
Sbjct  807  GQLPSQFGAALG------QSQQGLGQEH----RNPSDSNLSAAGQ---------ANQMWP  847

Query  261  NSY  253
            NSY
Sbjct  848  NSY  850



>ref|XP_003567822.1| PREDICTED: uncharacterized protein LOC100825596 isoform X2 [Brachypodium 
distachyon]
Length=849

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 61/123 (50%), Gaps = 19/123 (15%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  442
            G D  + SQYKD +H +SLQQ EN  MW+HG GSR M    ANT Y  Q Q     G RQ
Sbjct  746  GFDGTMPSQYKDGNHYISLQQNENPAMWMHGAGSRGMPPLAANTLYGYQGQQGHQGGLRQ  805

Query  441  VQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  262
             Q P Q  A+LG       SQ G+  +H    +NP D  L   G          + Q+W 
Sbjct  806  GQLPSQFGAALG------QSQQGLGQEH----RNPSDSNLSAAGQ---------ANQMWP  846

Query  261  NSY  253
            NSY
Sbjct  847  NSY  849



>ref|XP_007217053.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
 gb|EMJ18252.1| hypothetical protein PRUPE_ppa001198mg [Prunus persica]
Length=883

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 17/105 (16%)
 Frame = -1

Query  639  APSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            AP +    DD L ++YKD  HL  L Q            SRT+S+ P + Y  +  QNQQ
Sbjct  768  APISMSDYDDALRARYKDGSHLTPLHQ-----------SSRTLSSIPDSVYNTLLRQNQQ  816

Query  459  PSGFRQVQ--QPP---QNYASLGYNPNFYHSQTGISLDHHHQQQN  340
             +G++Q Q  Q P   Q+Y S GY P+FY SQ GI+ +HH Q  N
Sbjct  817  NAGYQQGQAGQMPSQLQHYGSPGY-PDFYPSQMGITQEHHRQSVN  860



>ref|XP_011467573.1| PREDICTED: uncharacterized protein LOC101307606 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=803

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 22/126 (17%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  436
            DD   SQYKD +HL  L Q             RT+S+   + Y N+  QNQQ +G+RQ Q
Sbjct  695  DDVFRSQYKDGNHLTPLHQ-----------SPRTLSSVQDSAYNNLLGQNQQYAGYRQEQ  743

Query  435  --QPP---QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
              Q P   Q+Y S+GY P++Y+SQ GI+     Q+Q+  + P   G  +   Q     QQ
Sbjct  744  AGQVPSQLQHYGSMGY-PDYYNSQMGIT--QERQRQSLNESPFAPGIPDLSPQQL---QQ  797

Query  270  LWQNSY  253
            +WQ +Y
Sbjct  798  IWQRTY  803



>ref|XP_011467574.1| PREDICTED: uncharacterized protein LOC101307606 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=731

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 22/126 (17%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQVQ  436
            DD   SQYKD +HL  L Q             RT+S+   + Y N+  QNQQ +G+RQ Q
Sbjct  623  DDVFRSQYKDGNHLTPLHQ-----------SPRTLSSVQDSAYNNLLGQNQQYAGYRQEQ  671

Query  435  --QPP---QNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQ  271
              Q P   Q+Y S+GY P++Y+SQ GI+     Q+Q+  + P   G  +   Q     QQ
Sbjct  672  AGQVPSQLQHYGSMGY-PDYYNSQMGIT--QERQRQSLNESPFAPGIPDLSPQQL---QQ  725

Query  270  LWQNSY  253
            +WQ +Y
Sbjct  726  IWQRTY  731



>ref|XP_002881327.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57586.1| hypothetical protein ARALYDRAFT_321144 [Arabidopsis lyrata subsp. 
lyrata]
Length=865

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 6/78 (8%)
 Frame = -1

Query  555  ENSGMWLHGHGSRTMSAAPANTYYNIQ---AQNQQPSGFRQVQQPPQNYASLGYNPNFYH  385
            EN  MWL+G GS+TMS  P+NTYYN++      Q     +Q QQ  Q     GY PN+Y 
Sbjct  769  ENFPMWLNGPGSQTMSGVPSNTYYNLEAQQQSQQVRQAQQQAQQAQQAQQQYGY-PNYYQ  827

Query  384  SQTGISLDHHHQQQNPRD  331
            SQTG+S++   QQQNPRD
Sbjct  828  SQTGMSME--QQQQNPRD  843



>gb|EEC79757.1| hypothetical protein OsI_21141 [Oryza sativa Indica Group]
Length=798

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 60/123 (49%), Gaps = 14/123 (11%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFRQ  442
            G D  + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y  Q Q     G RQ
Sbjct  690  GFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALYGYQGQQGHQGGLRQ  749

Query  441  VQQPPQNYASLGYNPNFYHSQTGISLDHHHQQQNPRDGPLggggGNAQVQPKPSSQQLWQ  262
             Q P Q  A L        +Q G+     H+ +NP DG L      A  Q    + Q+W 
Sbjct  750  GQLPSQFGAPLA------PTQPGLG----HEHRNPSDGNLSSAAAAAAAQ----ANQMWP  795

Query  261  NSY  253
            NSY
Sbjct  796  NSY  798



>emb|CDY61669.1| BnaC01g40800D [Brassica napus]
Length=740

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 67/133 (50%), Gaps = 28/133 (21%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSL--QQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQPSGFR-  445
            +D LSSQ++D++HL S   QQ E+   W  G  S +    P + YY+   QNQQP GFR 
Sbjct  624  EDVLSSQFRDSNHLASSLQQQNEHLAAWHQGQQSNSR-VVPGSGYYS--HQNQQPPGFRQ  680

Query  444  -------QVQQPPQNYASLGYNPNFYHSQTGISLD--HHHQQQNPRDGPLggggGNAQVQ  292
                     QQ  Q++    Y  + YHSQ  +SLD  HH QQQN RD             
Sbjct  681  AQLLQQPSQQQQQQHFGGHSYG-SHYHSQASMSLDHLHHQQQQNARDA------------  727

Query  291  PKPSSQQLWQNSY  253
             K + QQLW N+Y
Sbjct  728  SKQTHQQLWPNNY  740



>ref|XP_009356619.1| PREDICTED: uncharacterized protein LOC103947437 isoform X3 [Pyrus 
x bretschneideri]
Length=804

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 13/101 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            P +    DD    QYKD +HL +L Q            SRT+ + P + + N+  QNQQ 
Sbjct  692  PGSIADYDDVFRPQYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQH  740

Query  456  SGFRQVQ--QPPQNYASLGYNPNFYHSQTGISLDHHHQQQN  340
            +G+RQ Q  Q P    S   +P+FYHSQ  ++ +   Q+ N
Sbjct  741  AGYRQGQAGQLPSQLQSYRGHPDFYHSQVDVTQELQRQRLN  781



>ref|XP_009356617.1| PREDICTED: uncharacterized protein LOC103947437 isoform X1 [Pyrus 
x bretschneideri]
Length=827

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 13/101 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            P +    DD    QYKD +HL +L Q            SRT+ + P + + N+  QNQQ 
Sbjct  715  PGSIADYDDVFRPQYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQH  763

Query  456  SGFRQVQ--QPPQNYASLGYNPNFYHSQTGISLDHHHQQQN  340
            +G+RQ Q  Q P    S   +P+FYHSQ  ++ +   Q+ N
Sbjct  764  AGYRQGQAGQLPSQLQSYRGHPDFYHSQVDVTQELQRQRLN  804



>gb|AAT44198.1| unknown protein [Oryza sativa Japonica Group]
Length=860

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYY  484
            G D  + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y
Sbjct  755  GFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY  800



>ref|NP_001056433.1| Os05g0581800 [Oryza sativa Japonica Group]
 gb|AAU10711.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18347.1| Os05g0581800 [Oryza sativa Japonica Group]
Length=852

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYY  484
            G D  + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y
Sbjct  747  GFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY  792



>ref|XP_010449499.1| PREDICTED: uncharacterized protein LOC104731723 isoform X2 [Camelina 
sativa]
Length=794

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 68/134 (51%), Gaps = 24/134 (18%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSG  451
            +D LSSQ+KD++HL+S   QQ +NS  W  G    SR +   P + YY+    QNQQP G
Sbjct  672  EDVLSSQFKDSNHLVSSLQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPG  728

Query  450  FRQVQQPPQNYASLGYNPNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQV  295
            FRQ QQ  Q   S     +F        YHSQ  +SLDH H Q             NA+ 
Sbjct  729  FRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARD  780

Query  294  QPKPSSQQLWQNSY  253
              K + QQLW N+Y
Sbjct  781  ASKQTQQQLWPNNY  794



>ref|XP_008380341.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=799

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 13/101 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            P +    DD    QYKD +HL +L Q            SRT+ + P + + N+  QNQQ 
Sbjct  687  PGSIADYDDVFRPQYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQH  735

Query  456  SGFRQVQ--QPPQNYASLGYNPNFYHSQTGISLDHHHQQQN  340
            +G+RQ Q  Q P    S   +P+FYHSQ  ++ +   Q+ N
Sbjct  736  AGYRQGQAGQLPSQLQSYRGHPDFYHSQVDVTQELQRQRLN  776



>ref|XP_009356618.1| PREDICTED: uncharacterized protein LOC103947437 isoform X2 [Pyrus 
x bretschneideri]
Length=809

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 13/101 (13%)
 Frame = -1

Query  636  PSTSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQP  457
            P +    DD    QYKD +HL +L Q            SRT+ + P + + N+  QNQQ 
Sbjct  697  PGSIADYDDVFRPQYKDGNHLTALYQ-----------SSRTLPSVPDSAFNNLLGQNQQH  745

Query  456  SGFRQVQ--QPPQNYASLGYNPNFYHSQTGISLDHHHQQQN  340
            +G+RQ Q  Q P    S   +P+FYHSQ  ++ +   Q+ N
Sbjct  746  AGYRQGQAGQLPSQLQSYRGHPDFYHSQVDVTQELQRQRLN  786



>ref|XP_010449498.1| PREDICTED: uncharacterized protein LOC104731723 isoform X1 [Camelina 
sativa]
Length=795

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 68/134 (51%), Gaps = 24/134 (18%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSG  451
            +D LSSQ+KD++HL+S   QQ +NS  W  G    SR +   P + YY+    QNQQP G
Sbjct  673  EDVLSSQFKDSNHLVSSLQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPG  729

Query  450  FRQVQQPPQNYASLGYNPNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQV  295
            FRQ QQ  Q   S     +F        YHSQ  +SLDH H Q             NA+ 
Sbjct  730  FRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARD  781

Query  294  QPKPSSQQLWQNSY  253
              K + QQLW N+Y
Sbjct  782  ASKQTQQQLWPNNY  795



>gb|EEE64826.1| hypothetical protein OsJ_19683 [Oryza sativa Japonica Group]
Length=853

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  621  GIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYY  484
            G D  + +QYK+ +  +SLQQ EN+ MW+HG  SRTM    AN  Y
Sbjct  748  GFDGTVPAQYKEGNQFVSLQQSENAAMWMHGASSRTMPPLAANALY  793



>dbj|BAJ94362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=845

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  493
            +T+ G D  + SQYKD +  +SLQQ EN  MW+HG GSR M    AN
Sbjct  728  TTAPGFDGTMPSQYKDGNPYISLQQGENPAMWMHGAGSRGMPPLAAN  774



>dbj|BAK03133.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  STSLGIDDGLSSQYKDNHHLMSLQQVENSGMWLHGHGSRTMSAAPAN  493
            +T+ G D  + SQYKD +  +SLQQ EN  MW+HG GSR M    AN
Sbjct  421  TTAPGFDGTMPSQYKDGNPYISLQQGENPAMWMHGAGSRGMPPLAAN  467



>ref|XP_010439897.1| PREDICTED: uncharacterized protein LOC104723267 isoform X1 [Camelina 
sativa]
Length=799

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 68/134 (51%), Gaps = 24/134 (18%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSG  451
            +D L+SQ+KD++HL+S   QQ +NS  W  G    SR +   P + YY+    QNQQP G
Sbjct  677  EDVLTSQFKDSNHLVSSLQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPG  733

Query  450  FRQVQQPPQNYASLGYNPNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQV  295
            FRQ QQ  Q   S     +F        YHSQ  +SLDH H Q             NA+ 
Sbjct  734  FRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARD  785

Query  294  QPKPSSQQLWQNSY  253
              K + QQLW N+Y
Sbjct  786  ASKQTQQQLWPNNY  799



>ref|XP_010439898.1| PREDICTED: uncharacterized protein LOC104723267 isoform X2 [Camelina 
sativa]
Length=798

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 68/134 (51%), Gaps = 24/134 (18%)
 Frame = -1

Query  615  DDGLSSQYKDNHHLMSL--QQVENSGMWLHGH--GSRTMSAAPANTYYNIQA-QNQQPSG  451
            +D L+SQ+KD++HL+S   QQ +NS  W  G    SR +   P + YY+    QNQQP G
Sbjct  676  EDVLTSQFKDSNHLVSSLQQQNDNSAAWHQGQQPNSRVV---PGSGYYSFPGHQNQQPPG  732

Query  450  FRQVQQPPQNYASLGYNPNF--------YHSQTGISLDHHHQQQNPRDGPLggggGNAQV  295
            FRQ QQ  Q   S     +F        YHSQ  +SLDH H Q             NA+ 
Sbjct  733  FRQAQQLQQQQPSQQQQQHFGGHGYVSPYHSQGAMSLDHLHHQH--------QQQQNARD  784

Query  294  QPKPSSQQLWQNSY  253
              K + QQLW N+Y
Sbjct  785  ASKQTQQQLWPNNY  798



>gb|KJB75412.1| hypothetical protein B456_012G040900 [Gossypium raimondii]
Length=860

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 7/94 (7%)
 Frame = -1

Query  630  TSLGIDDGLSSQYKD---NHHLMSLQQVENSGMWLHGHGSRTMSAAPANTYYNIQAQNQQ  460
            + +  DD L SQY +   N +L  LQQ + S  W + HGSRT S  P N YY++  QN Q
Sbjct  737  SKVAYDDFLCSQYSNGGANFNL--LQQNDGSATWDYRHGSRTTSTIPDNAYYSLNGQNPQ  794

Query  459  PSGF-RQVQQPPQNYASLGYNPNFYHSQTGISLD  361
             +G+ +  Q   Q + +LGY P+ Y+S   ++++
Sbjct  795  HAGYQQAQQLAQQLHEALGY-PSIYNSHAAMAIE  827



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750