BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF043G14

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          330   1e-106   Nicotiana tomentosiformis
gb|KEH38477.1|  cytochrome P450 family 72 protein                       324   2e-106   Medicago truncatula
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    326   7e-106   Solanum tuberosum [potatoes]
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      327   2e-105   Solanum tuberosum [potatoes]
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    327   3e-105   Solanum tuberosum [potatoes]
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          325   9e-105   Solanum lycopersicum
gb|KHN12943.1|  Secologanin synthase                                    320   1e-104   Glycine soja [wild soybean]
gb|KEH38476.1|  cytochrome P450 family 72 protein                       324   2e-104   Medicago truncatula
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          324   2e-104   Nicotiana tomentosiformis
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          324   3e-104   Medicago truncatula
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  324   3e-104   Medicago truncatula
gb|KHN47456.1|  Secologanin synthase                                    323   1e-103   Glycine soja [wild soybean]
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      323   1e-103   Glycine max [soybeans]
gb|ABC68405.1|  cytochrome P450 monooxygenase CYP72A68                  319   3e-103   Glycine max [soybeans]
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               321   3e-103   Cicer arietinum [garbanzo]
ref|XP_006348305.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    318   4e-103   Solanum tuberosum [potatoes]
ref|XP_006377681.1|  cytochrome P450 family protein                     317   8e-103   
gb|KHN44060.1|  Secologanin synthase                                    318   9e-103   Glycine soja [wild soybean]
emb|CDP14360.1|  unnamed protein product                                317   1e-102   Coffea canephora [robusta coffee]
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          320   1e-102   Nicotiana tomentosiformis
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               320   2e-102   Solanum lycopersicum
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          320   2e-102   Solanum lycopersicum
emb|CDP15978.1|  unnamed protein product                                319   2e-102   Coffea canephora [robusta coffee]
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    319   3e-102   
ref|XP_006377690.1|  cytochrome P450 family protein                     313   3e-102   
ref|XP_010092744.1|  Secologanin synthase                               320   4e-102   
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    318   6e-102   Solanum tuberosum [potatoes]
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      318   8e-102   Solanum tuberosum [potatoes]
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               318   9e-102   Solanum tuberosum [potatoes]
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    318   1e-101   Glycine max [soybeans]
gb|KHN44057.1|  Secologanin synthase                                    318   1e-101   Glycine soja [wild soybean]
gb|KEH38472.1|  cytochrome P450 family protein                          312   1e-101   Medicago truncatula
gb|ABC59099.1|  cytochrome P450 monooxygenase CYP72A66                  312   3e-101   Medicago truncatula
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          317   4e-101   Populus euphratica
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    316   5e-101   Nicotiana sylvestris
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    316   6e-101   Nicotiana sylvestris
ref|XP_006407057.1|  hypothetical protein EUTSA_v10020855mg             312   7e-101   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          315   8e-101   Amsonia hubrichtii
gb|KEH38469.1|  cytochrome P450 family 709 protein                      315   8e-101   Medicago truncatula
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               315   1e-100   Cicer arietinum [garbanzo]
gb|KEH38475.1|  cytochrome P450 family 72 protein                       315   1e-100   Medicago truncatula
emb|CDX82469.1|  BnaA03g33520D                                          303   2e-100   
emb|CDY70619.1|  BnaCnng69060D                                          309   2e-100   Brassica napus [oilseed rape]
gb|ABC69393.1|  CYP72A55v2                                              314   3e-100   Nicotiana tabacum [American tobacco]
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    315   3e-100   Populus euphratica
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    311   3e-100   
gb|ABC69392.1|  CYP72A55v1                                              313   4e-100   Nicotiana tabacum [American tobacco]
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               313   4e-100   Vitis vinifera
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          314   4e-100   Nicotiana tomentosiformis
ref|XP_006598138.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    310   6e-100   
ref|XP_009615909.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    310   7e-100   Nicotiana tomentosiformis
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          313   8e-100   Solanum lycopersicum
gb|KEH38470.1|  cytochrome P450 family monooxygenase                    312   8e-100   Medicago truncatula
ref|XP_009796906.1|  PREDICTED: cytochrome P450 CYP72A219-like          310   9e-100   Nicotiana sylvestris
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          312   1e-99    Vinca minor [common periwinkle]
emb|CDP11335.1|  unnamed protein product                                312   1e-99    Coffea canephora [robusta coffee]
emb|CDP15975.1|  unnamed protein product                                312   1e-99    Coffea canephora [robusta coffee]
emb|CDP19609.1|  unnamed protein product                                312   2e-99    Coffea canephora [robusta coffee]
gb|KEH38478.1|  cytochrome P450 family 72 protein                       312   2e-99    Medicago truncatula
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      312   2e-99    Glycine max [soybeans]
gb|KJB12898.1|  hypothetical protein B456_002G043200                    311   2e-99    Gossypium raimondii
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          311   2e-99    Glycyrrhiza uralensis [Chinese licorice]
gb|KJB12897.1|  hypothetical protein B456_002G043200                    311   3e-99    Gossypium raimondii
ref|XP_006377676.1|  hypothetical protein POPTR_0011s10150g             310   3e-99    
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              311   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             311   4e-99    
emb|CDX82472.1|  BnaA03g33490D                                          307   4e-99    
ref|XP_009116716.1|  PREDICTED: cytochrome P450 72A15-like isofor...    310   5e-99    Brassica rapa
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   310   5e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              310   6e-99    Brassica rapa
ref|XP_010092742.1|  Secologanin synthase                               310   6e-99    Morus notabilis
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             310   6e-99    Phaseolus vulgaris [French bean]
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    310   6e-99    Nicotiana tomentosiformis
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          310   6e-99    Nicotiana sylvestris
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          310   7e-99    Lonicera japonica [Japanese honeysuckle]
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             310   8e-99    Capsella rubella
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    310   8e-99    Solanum lycopersicum
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              310   1e-98    Eucalyptus grandis [rose gum]
gb|KHN44056.1|  Secologanin synthase                                    310   1e-98    Glycine soja [wild soybean]
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             310   1e-98    Phaseolus vulgaris [French bean]
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    310   1e-98    Glycine max [soybeans]
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          310   1e-98    Tabernaemontana elegans
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    309   2e-98    Brassica rapa
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               309   2e-98    Solanum tuberosum [potatoes]
emb|CDP19603.1|  unnamed protein product                                305   2e-98    Coffea canephora [robusta coffee]
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        309   2e-98    Camelina sativa [gold-of-pleasure]
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    309   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        309   2e-98    Camelina sativa [gold-of-pleasure]
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    308   2e-98    Arabis alpina [alpine rockcress]
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              308   3e-98    Camelina sativa [gold-of-pleasure]
gb|KHN14193.1|  Secologanin synthase                                    309   3e-98    Glycine soja [wild soybean]
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   308   3e-98    Brassica rapa
ref|XP_002882888.1|  CYP72A15                                           308   3e-98    
emb|CDX97591.1|  BnaA05g24880D                                          308   3e-98    
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          308   3e-98    Solanum lycopersicum
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              308   4e-98    Camelina sativa [gold-of-pleasure]
emb|CDY32349.1|  BnaC01g36680D                                          308   6e-98    Brassica napus [oilseed rape]
gb|KHN36820.1|  Secologanin synthase                                    307   6e-98    Glycine soja [wild soybean]
emb|CDY20076.1|  BnaA01g29260D                                          307   6e-98    Brassica napus [oilseed rape]
emb|CDX97592.1|  BnaA05g24870D                                          308   6e-98    
dbj|BAF98466.1|  cytochrome P450                                        308   6e-98    Coptis japonica var. dissecta
emb|CDP15976.1|  unnamed protein product                                308   7e-98    Coffea canephora [robusta coffee]
gb|ABC69422.1|  CYP72A58                                                308   7e-98    Nicotiana tabacum [American tobacco]
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              307   7e-98    Tarenaya hassleriana [spider flower]
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          308   7e-98    Nicotiana sylvestris
ref|XP_010248211.1|  PREDICTED: cytochrome P450 CYP72A219-like          305   9e-98    
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          307   9e-98    Vitis vinifera
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               307   1e-97    Solanum tuberosum [potatoes]
gb|ABC69419.1|  CYP72A56                                                307   1e-97    Nicotiana tabacum [American tobacco]
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          307   1e-97    Nicotiana tomentosiformis
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          307   1e-97    Cinchona calisaya [quinine]
emb|CDX98485.1|  BnaC05g38900D                                          306   1e-97    
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    306   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             306   2e-97    Eutrema salsugineum [saltwater cress]
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          306   2e-97    Solanum lycopersicum
emb|CDP14358.1|  unnamed protein product                                302   2e-97    Coffea canephora [robusta coffee]
emb|CDY65331.1|  BnaC03g73770D                                          304   2e-97    Brassica napus [oilseed rape]
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      306   2e-97    Glycine max [soybeans]
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              307   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_009135392.1|  PREDICTED: cytochrome P450 72A13-like              300   3e-97    
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             306   4e-97    Phaseolus vulgaris [French bean]
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             306   5e-97    Catharanthus roseus [chatas]
gb|KHG20903.1|  Secologanin synthase                                    299   5e-97    Gossypium arboreum [tree cotton]
ref|XP_010487265.1|  PREDICTED: cytochrome P450 72A13-like              303   6e-97    
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    305   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          305   8e-97    Nelumbo nucifera [Indian lotus]
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              305   8e-97    Eucalyptus grandis [rose gum]
emb|CDX98484.1|  BnaC05g38910D                                          305   8e-97    
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               305   9e-97    Vitis vinifera
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          305   9e-97    Rauvolfia serpentina [devilpepper]
emb|CBI39912.3|  unnamed protein product                                302   1e-96    Vitis vinifera
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               304   2e-96    Solanum lycopersicum
emb|CAN67740.1|  hypothetical protein VITISV_015554                     304   2e-96    Vitis vinifera
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    304   2e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDX75787.1|  BnaC03g38700D                                          300   2e-96    
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          304   2e-96    Solanum lycopersicum
emb|CBI39886.3|  unnamed protein product                                305   2e-96    Vitis vinifera
ref|XP_010487263.1|  PREDICTED: cytochrome P450 72A13-like              300   2e-96    
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               303   3e-96    Vitis vinifera
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          303   3e-96    Sesamum indicum [beniseed]
ref|XP_006348301.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      298   3e-96    
ref|XP_010644760.1|  PREDICTED: cytochrome P450 CYP72A219-like          300   3e-96    
emb|CAN71061.1|  hypothetical protein VITISV_032613                     295   4e-96    Vitis vinifera
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          303   4e-96    Solanum lycopersicum
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              303   4e-96    Eucalyptus grandis [rose gum]
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             303   5e-96    Capsella rubella
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          301   5e-96    Vitis vinifera
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              303   5e-96    
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    303   6e-96    Arabis alpina [alpine rockcress]
ref|XP_010502025.1|  PREDICTED: cytochrome P450 72A13-like isofor...    300   8e-96    
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             302   9e-96    Phaseolus vulgaris [French bean]
emb|CDX82468.1|  BnaA03g33530D                                          303   9e-96    
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      302   9e-96    Glycine max [soybeans]
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          302   1e-95    Nelumbo nucifera [Indian lotus]
emb|CDX97593.1|  BnaA05g24860D                                          302   1e-95    
ref|XP_009594692.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    298   1e-95    
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              301   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    301   1e-95    Eucalyptus grandis [rose gum]
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     302   1e-95    Eucalyptus grandis [rose gum]
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    301   1e-95    
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    301   1e-95    Vitis vinifera
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      301   2e-95    Solanum tuberosum [potatoes]
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    301   2e-95    Vitis vinifera
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             301   2e-95    Phaseolus vulgaris [French bean]
ref|XP_007133275.1|  hypothetical protein PHAVU_011G166000g             296   2e-95    Phaseolus vulgaris [French bean]
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              301   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              301   2e-95    
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             301   2e-95    Phaseolus vulgaris [French bean]
ref|XP_006362153.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      297   2e-95    
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              301   2e-95    Eucalyptus grandis [rose gum]
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              301   2e-95    
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               301   2e-95    Solanum tuberosum [potatoes]
emb|CBI39923.3|  unnamed protein product                                299   2e-95    Vitis vinifera
gb|AIA82924.1|  SLS1                                                    301   3e-95    Gentiana rigescens
emb|CDX75785.1|  BnaC03g38680D                                          296   3e-95    
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          301   3e-95    Vitis vinifera
gb|KHN44049.1|  Secologanin synthase                                    290   4e-95    Glycine soja [wild soybean]
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               301   4e-95    Solanum tuberosum [potatoes]
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              300   4e-95    Eucalyptus grandis [rose gum]
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          301   4e-95    Solanum lycopersicum
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              300   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          300   5e-95    
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             301   6e-95    Capsella rubella
dbj|BAB02395.1|  cytochrome P450-like protein                           300   6e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDY51036.1|  BnaA06g02990D                                          300   7e-95    Brassica napus [oilseed rape]
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              300   7e-95    Phoenix dactylifera
emb|CDP15983.1|  unnamed protein product                                300   7e-95    Coffea canephora [robusta coffee]
ref|XP_007211745.1|  hypothetical protein PRUPE_ppa006307mg             297   7e-95    
emb|CDX98486.1|  BnaC05g38890D                                          300   8e-95    
gb|KCW67647.1|  hypothetical protein EUGRSUZ_F01394                     296   8e-95    Eucalyptus grandis [rose gum]
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    300   9e-95    Panax ginseng [Asiatic ginseng]
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          300   1e-94    
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          300   1e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    299   1e-94    
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               299   1e-94    Vitis vinifera
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              299   1e-94    Brassica rapa
ref|XP_006348300.1|  PREDICTED: secologanin synthase-like               293   2e-94    
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               299   2e-94    
emb|CDY51038.1|  BnaA06g03010D                                          299   2e-94    Brassica napus [oilseed rape]
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               299   2e-94    Vitis vinifera
emb|CBI22134.3|  unnamed protein product                                299   2e-94    Vitis vinifera
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    298   2e-94    
ref|XP_006407056.1|  hypothetical protein EUTSA_v10022214mg             298   2e-94    
gb|KJB12904.1|  hypothetical protein B456_002G043600                    298   3e-94    Gossypium raimondii
gb|ABC69417.1|  CYP72A54                                                298   3e-94    Nicotiana tabacum [American tobacco]
emb|CDP19599.1|  unnamed protein product                                298   3e-94    Coffea canephora [robusta coffee]
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          298   3e-94    Nicotiana sylvestris
emb|CBI39937.3|  unnamed protein product                                296   4e-94    Vitis vinifera
emb|CDY28093.1|  BnaC06g02740D                                          298   4e-94    Brassica napus [oilseed rape]
gb|KHG20902.1|  Secologanin synthase                                    297   4e-94    Gossypium arboreum [tree cotton]
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             298   4e-94    Medicago truncatula
ref|XP_011460847.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    298   4e-94    Fragaria vesca subsp. vesca
emb|CDX75784.1|  BnaC03g38670D                                          298   5e-94    
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    298   5e-94    
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          298   5e-94    Cucumis melo [Oriental melon]
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    298   5e-94    
gb|KCW67651.1|  hypothetical protein EUGRSUZ_F01398                     292   6e-94    Eucalyptus grandis [rose gum]
ref|XP_009135391.1|  PREDICTED: cytochrome P450 72A15-like              297   6e-94    Brassica rapa
emb|CDP15988.1|  unnamed protein product                                297   7e-94    Coffea canephora [robusta coffee]
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     297   7e-94    Eucalyptus grandis [rose gum]
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              297   7e-94    Eucalyptus grandis [rose gum]
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    297   7e-94    Nicotiana tomentosiformis
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               298   8e-94    Citrus sinensis [apfelsine]
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               297   8e-94    
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              297   8e-94    Camelina sativa [gold-of-pleasure]
gb|KHG18227.1|  Secologanin synthase                                    297   8e-94    Gossypium arboreum [tree cotton]
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    299   9e-94    
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               297   1e-93    Citrus sinensis [apfelsine]
ref|XP_010064521.1|  PREDICTED: cytochrome P450 72A14-like              293   1e-93    
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              296   1e-93    Tarenaya hassleriana [spider flower]
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    295   1e-93    Nicotiana sylvestris
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               296   2e-93    
emb|CBI39929.3|  unnamed protein product                                294   2e-93    Vitis vinifera
emb|CBI39938.3|  unnamed protein product                                294   3e-93    Vitis vinifera
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               296   3e-93    
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    296   3e-93    
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              295   3e-93    Brassica rapa
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          295   4e-93    Nicotiana tomentosiformis
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              295   4e-93    Eucalyptus grandis [rose gum]
gb|KHG14489.1|  Secologanin synthase                                    295   5e-93    Gossypium arboreum [tree cotton]
gb|EYU44092.1|  hypothetical protein MIMGU_mgv1a0044501mg               291   6e-93    Erythranthe guttata [common monkey flower]
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          295   6e-93    Solanum lycopersicum
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          295   6e-93    Nelumbo nucifera [Indian lotus]
emb|CDX82471.1|  BnaA03g33500D                                          295   7e-93    
emb|CBI39917.3|  unnamed protein product                                293   8e-93    Vitis vinifera
emb|CDP15981.1|  unnamed protein product                                294   9e-93    Coffea canephora [robusta coffee]
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               295   9e-93    Solanum tuberosum [potatoes]
gb|KJB26994.1|  hypothetical protein B456_004G270700                    295   9e-93    Gossypium raimondii
gb|AJD25172.1|  cytochrome P450 CYP72A331                               294   1e-92    Salvia miltiorrhiza [Chinese salvia]
ref|XP_008345110.1|  PREDICTED: cytochrome P450 CYP72A219-like          287   1e-92    
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          294   1e-92    Vitis vinifera
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    294   1e-92    Nicotiana sylvestris
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          294   1e-92    Vitis vinifera
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               294   1e-92    Solanum tuberosum [potatoes]
emb|CDY32348.1|  BnaC01g36670D                                          294   1e-92    Brassica napus [oilseed rape]
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              293   2e-92    Tarenaya hassleriana [spider flower]
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          294   2e-92    Nelumbo nucifera [Indian lotus]
ref|XP_006442303.1|  hypothetical protein CICLE_v10023520mg             288   2e-92    
ref|XP_006407059.1|  hypothetical protein EUTSA_v10021962mg             293   2e-92    Eutrema salsugineum [saltwater cress]
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               293   2e-92    Solanum tuberosum [potatoes]
ref|XP_010415070.1|  PREDICTED: cytochrome P450 72A13-like              290   2e-92    
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              293   2e-92    Elaeis guineensis
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               293   2e-92    Solanum tuberosum [potatoes]
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               293   2e-92    Solanum tuberosum [potatoes]
emb|CDY20078.1|  BnaA01g29240D                                          293   3e-92    Brassica napus [oilseed rape]
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    292   3e-92    
ref|XP_004295683.1|  PREDICTED: cytochrome P450 CYP72A219-like          293   4e-92    Fragaria vesca subsp. vesca
gb|AFK37510.1|  unknown                                                 282   4e-92    Lotus japonicus
emb|CDP19600.1|  unnamed protein product                                293   4e-92    Coffea canephora [robusta coffee]
ref|XP_004294187.1|  PREDICTED: cytochrome P450 CYP72A219-like          293   4e-92    Fragaria vesca subsp. vesca
ref|XP_006407061.1|  hypothetical protein EUTSA_v10020533mg             293   4e-92    
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          293   5e-92    Vitis vinifera
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          292   6e-92    Solanum lycopersicum
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          292   6e-92    
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              292   6e-92    Elaeis guineensis
ref|XP_002266550.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   7e-92    
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    292   8e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    292   9e-92    Prunus mume [ume]
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              292   9e-92    Tarenaya hassleriana [spider flower]
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    292   1e-91    
ref|XP_006598146.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      290   1e-91    
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          291   1e-91    
emb|CBI39903.3|  unnamed protein product                                281   1e-91    
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               292   1e-91    
sp|H1A981.1|C7263_MEDTR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    291   2e-91    
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              291   2e-91    
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              291   2e-91    
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          291   2e-91    
ref|XP_002526971.1|  cytochrome P450, putative                          288   2e-91    
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    291   2e-91    
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              291   2e-91    
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                291   2e-91    
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    291   2e-91    
emb|CDP15982.1|  unnamed protein product                                291   2e-91    
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              290   3e-91    
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               291   3e-91    
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          290   3e-91    
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          290   3e-91    
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              290   4e-91    
dbj|BAL45201.1|  cytochrome P450 monooxygenase                          290   4e-91    
ref|XP_004307203.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    291   6e-91    
ref|XP_003628063.1|  Cytochrome P450 monooxygenase CYP72A65             290   6e-91    
emb|CDX97590.1|  BnaA05g24890D                                          289   7e-91    
gb|KFK38820.1|  hypothetical protein AALP_AA3G164700                    287   7e-91    
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          290   8e-91    
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      298   8e-91    
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   9e-91    
emb|CDP15980.1|  unnamed protein product                                289   9e-91    
ref|XP_003628068.1|  Cytochrome P450 monooxygenase CYP72A65             288   1e-90    
ref|XP_003543170.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase           289   1e-90    
emb|CBI39884.3|  unnamed protein product                                288   1e-90    
ref|XP_006442300.1|  hypothetical protein CICLE_v100199321mg            281   1e-90    
gb|KHN47459.1|  Secologanin synthase                                    289   1e-90    
emb|CAN72865.1|  hypothetical protein VITISV_029731                     288   1e-90    
gb|KJB12901.1|  hypothetical protein B456_002G043400                    289   2e-90    
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               288   2e-90    
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  289   2e-90    
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          289   2e-90    
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   2e-90    
ref|XP_004300362.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   2e-90    
ref|XP_009146336.1|  PREDICTED: cytochrome P450 72A15                   288   2e-90    
ref|XP_008784485.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   2e-90    
dbj|BAJ99490.1|  predicted protein                                      278   3e-90    
ref|XP_008784422.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   3e-90    
ref|XP_003628067.1|  Cytochrome P450 monooxygenase CYP72A65             288   3e-90    
emb|CDP15979.1|  unnamed protein product                                288   3e-90    
ref|XP_007149356.1|  hypothetical protein PHAVU_005G063500g             283   3e-90    
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               288   3e-90    
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              288   4e-90    
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              287   4e-90    
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               288   4e-90    
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   4e-90    
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          288   5e-90    
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    288   5e-90    
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    287   5e-90    
ref|XP_006442302.1|  hypothetical protein CICLE_v100197311mg            284   6e-90    
ref|XP_010916789.1|  PREDICTED: cytochrome P450 CYP72A219-like          284   6e-90    
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    288   6e-90    
gb|KEH37983.1|  cytochrome P450 family 72 protein                       287   6e-90    
gb|KHN44046.1|  Secologanin synthase                                    287   6e-90    
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          287   7e-90    
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    287   7e-90    
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          287   7e-90    
gb|ABC69390.1|  CYP72A53v1                                              287   7e-90    
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    287   8e-90    
dbj|BAB02396.1|  cytochrome P450                                        286   8e-90    
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              286   8e-90    
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      287   9e-90    
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    286   1e-89    
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          286   1e-89    
ref|XP_002455994.1|  hypothetical protein SORBIDRAFT_03g028650          286   1e-89    
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             286   1e-89    
gb|ABC69389.1|  CYP72A52v1                                              286   1e-89    
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              286   1e-89    
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  286   1e-89    
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          286   2e-89    
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    286   2e-89    
ref|XP_004159643.1|  PREDICTED: secologanin synthase-like               278   2e-89    
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          286   3e-89    
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          285   3e-89    
ref|XP_010926847.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    283   3e-89    
ref|XP_004511114.1|  PREDICTED: secologanin synthase-like               286   3e-89    
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    285   3e-89    
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    285   5e-89    
ref|XP_003569401.1|  PREDICTED: cytochrome P450 72A13-like              285   5e-89    
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              285   6e-89    
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          285   6e-89    
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          285   6e-89    
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             285   7e-89    
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          285   7e-89    
ref|XP_006477950.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    281   8e-89    
gb|EMS67451.1|  Secologanin synthase                                    281   8e-89    
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          284   1e-88    
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    284   1e-88    
emb|CDX97588.1|  BnaA05g24910D                                          284   1e-88    
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               284   1e-88    
gb|AGV54594.1|  secologanin synthase-like isoform 1                     284   1e-88    
ref|XP_009628929.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   1e-88    
emb|CDP15984.1|  unnamed protein product                                281   1e-88    
ref|XP_007133222.1|  hypothetical protein PHAVU_011G161700g             283   1e-88    
ref|XP_007043676.1|  Cytochrome P450, putative                          283   2e-88    
gb|AGX93044.1|  secologanin synthase-like protein                       283   2e-88    
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          283   2e-88    
gb|EAZ12777.1|  hypothetical protein OsJ_02694                          281   2e-88    
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          284   2e-88    
ref|XP_007149357.1|  hypothetical protein PHAVU_005G063500g             283   2e-88    
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    283   2e-88    
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    283   2e-88    
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      283   3e-88    
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          283   3e-88    
ref|XP_008364401.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    280   3e-88    
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          283   4e-88    
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               283   4e-88    
ref|XP_004301212.1|  PREDICTED: cytochrome P450 CYP72A219-like          282   4e-88    
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    283   5e-88    
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    282   5e-88    
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          282   5e-88    
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          282   6e-88    
dbj|BAO73901.1|  cytochrome P450                                        277   6e-88    
ref|XP_009394609.1|  PREDICTED: cytochrome P450 72A15-like              282   8e-88    
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    281   9e-88    
ref|XP_004294189.1|  PREDICTED: cytochrome P450 72A15-like              281   9e-88    
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               281   1e-87    
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   1e-87    
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   1e-87    
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          282   1e-87    
ref|XP_007133213.1|  hypothetical protein PHAVU_011G161100g             278   1e-87    
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   1e-87    
gb|AJD25168.1|  cytochrome P450 CYP72A327                               281   1e-87    
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             280   1e-87    
ref|XP_003527236.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    281   1e-87    
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    281   2e-87    
gb|KHN18291.1|  Secologanin synthase                                    281   2e-87    
gb|KJB12906.1|  hypothetical protein B456_002G043600                    282   2e-87    
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              281   2e-87    
gb|EPS70870.1|  hypothetical protein M569_03891                         281   2e-87    
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          281   2e-87    
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   281   2e-87    
dbj|BAO73900.1|  cytochrome P450                                        275   2e-87    
ref|XP_010535011.1|  PREDICTED: cytochrome P450 72A15-like              279   2e-87    
dbj|BAL45205.1|  cytochrome P450 monooxygenase                          281   2e-87    
emb|CAN63796.1|  hypothetical protein VITISV_004188                     274   2e-87    
gb|EMS51079.1|  Secologanin synthase                                    276   3e-87    
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          280   3e-87    
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    280   3e-87    
dbj|BAN19927.1|  cytochrome P450                                        281   3e-87    
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    280   3e-87    
dbj|BAH01411.1|  unnamed protein product                                281   3e-87    
gb|EAY75046.1|  hypothetical protein OsI_02942                          281   3e-87    
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          280   4e-87    
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                280   4e-87    
gb|EPS69403.1|  hypothetical protein M569_05363                         279   5e-87    
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    280   5e-87    
dbj|BAO73904.1|  cytochrome P450                                        273   5e-87    
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                     280   5e-87    
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                280   5e-87    
dbj|BAN19913.1|  cytochrome P450                                        280   6e-87    
emb|CDY20075.1|  BnaA01g29270D                                          279   6e-87    
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              279   6e-87    
dbj|BAJ95191.1|  predicted protein                                      279   8e-87    
emb|CDM83378.1|  unnamed protein product                                280   8e-87    
gb|AJD25170.1|  cytochrome P450 CYP72A329                               279   1e-86    
ref|XP_002516294.1|  cytochrome P450, putative                          278   1e-86    
ref|XP_010678726.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   1e-86    
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               278   1e-86    
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          278   1e-86    
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                278   1e-86    
gb|EYU38223.1|  hypothetical protein MIMGU_mgv1a005129mg                278   2e-86    
dbj|BAJ89369.1|  predicted protein                                      278   2e-86    
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               278   2e-86    
gb|EMT23021.1|  Secologanin synthase                                    278   2e-86    
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             278   2e-86    
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          278   2e-86    
gb|AAK38094.1|  putative cytochrome P450                                278   2e-86    
dbj|BAO73905.1|  cytochrome P450                                        273   3e-86    
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          278   3e-86    
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      278   3e-86    
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          277   3e-86    
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          278   3e-86    
emb|CDP19601.1|  unnamed protein product                                278   3e-86    
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          278   3e-86    
ref|XP_006830581.1|  hypothetical protein AMTR_s00117p00139870          270   3e-86    
ref|XP_010678917.1|  PREDICTED: cytochrome P450 72A15-like              278   3e-86    
ref|XP_006348402.1|  PREDICTED: secologanin synthase-like               276   4e-86    
ref|XP_003557757.2|  PREDICTED: cytochrome P450 72A14-like              278   4e-86    
gb|AAK38090.1|  putative cytochrome P450                                278   4e-86    
ref|XP_007133214.1|  hypothetical protein PHAVU_011G161100g             278   4e-86    
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          277   5e-86    
gb|EMS67452.1|  Secologanin synthase                                    277   5e-86    
gb|EYU26263.1|  hypothetical protein MIMGU_mgv1a019274mg                277   5e-86    
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              277   5e-86    
ref|XP_004295684.1|  PREDICTED: cytochrome P450 CYP72A219-like          277   5e-86    
ref|XP_002455992.1|  hypothetical protein SORBIDRAFT_03g028630          277   6e-86    
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              278   6e-86    
gb|KJB50134.1|  hypothetical protein B456_008G154900                    273   7e-86    
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             276   7e-86    
emb|CDP15985.1|  unnamed protein product                                276   7e-86    
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      276   8e-86    
gb|ADU19849.1|  putative secologanin synthase                           276   8e-86    
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   9e-86    
gb|AJD25171.1|  cytochrome P450 CYP72A330                               276   9e-86    
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               276   9e-86    
ref|XP_003569402.1|  PREDICTED: cytochrome P450 72A13-like              276   1e-85    
gb|KHN44050.1|  Secologanin synthase                                    268   1e-85    
ref|XP_010552157.1|  PREDICTED: cytochrome P450 72A14-like              266   1e-85    
ref|NP_001043631.1|  Os01g0627400                                       277   1e-85    
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   1e-85    
tpg|DAA58480.1|  TPA: putative cytochrome P450 superfamily protein      272   1e-85    
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    276   1e-85    
gb|AAK38093.1|  putative cytochrome P450                                276   2e-85    
gb|ACN25366.1|  unknown                                                 270   2e-85    
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          276   2e-85    
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    276   2e-85    
dbj|BAO73906.1|  cytochrome P450                                        271   2e-85    
gb|EEE55021.1|  hypothetical protein OsJ_02678                          276   2e-85    
emb|CDX98481.1|  BnaC05g38940D                                          289   2e-85    
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               276   2e-85    
ref|XP_010090129.1|  Secologanin synthase                               273   2e-85    
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             274   3e-85    
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   274   3e-85    



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 179/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++N GMS +++I+EC LFYFAGQETTSV+LVWTMVLLSR P+WQARAREEVL VFGD  
Sbjct  305  GSKNFGMSTQEVIEECKLFYFAGQETTSVLLVWTMVLLSRHPEWQARAREEVLQVFGDGM  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
             +F+GLN LK+VTMIL+ESLRLY PV  L R+   +TKLGE+ LP GV+LSLP LL+H D
Sbjct  365  LEFDGLNRLKIVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPMLLVHHD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KAT G+  FFPF  GPRICIG NFA++EAKMAMAMILQR
Sbjct  425  EEIWGEDAKEFKPERFSEGVSKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQR  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +T+QPQYGAPLI+H L
Sbjct  485  FSFELSPSYTHAPQSVITMQPQYGAPLILHKL  516



>gb|KEH38477.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=353

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GMS++ +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEVL VFG+ 
Sbjct  139  GNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNN  198

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMILYE LRLY PV  L R+  ++ KLG + LP GV + L  +++H 
Sbjct  199  KPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHH  258

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WGEDAK F PERF EG++KATNG+ +FFPF+GGPRICIGQNF+++EAKMA+AMILQ
Sbjct  259  DIELWGEDAKVFNPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQ  318

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSYAHAP + +T+QPQYGA +I+H L
Sbjct  319  RFSFELSPSYAHAPATVITLQPQYGAHIILHKL  351



>ref|XP_006348902.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
Length=435

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N G+SIE++I+EC LFYFAGQETTS +LVWT++LL R  DWQ RAREEVL VFG++K
Sbjct  224  GDKNFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRK  283

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLY PV  + R+  E+T LG+M LP GVLLSLP +L+H D
Sbjct  284  PDFDGLNHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHD  343

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAK+F PERFREG+  AT G+  FFPF+ GPRICIGQNFA++EAKM +AMILQR
Sbjct  344  EEIWGEDAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQR  403

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSF+LS SYAHAP+S +T QPQYGAPLI+H L
Sbjct  404  FSFDLSSSYAHAPHSVITTQPQYGAPLILHRL  435



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM+I+++I+EC LFYFAGQETTSV LVWTM+LLSR PDWQ RAREEVL VFGD  
Sbjct  307  GNKNFGMTIKEVIEECKLFYFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQVFGDGM  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+GLN LKVVTMIL+ESLRLY PV+ L R+   +TKLGE+ LP GV+LSLPT+L+H D
Sbjct  367  PGFDGLNRLKVVTMILHESLRLYPPVSALGRRITTKTKLGELNLPAGVMLSLPTILVHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EFKPERF EGI KAT G+  FFPF  GPRICIG NFA++EAKM MAMILQR
Sbjct  427  KEIWGEDATEFKPERFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMTMAMILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F+FELSPSY HAP S +T+QP+YGAPL++H L
Sbjct  487  FAFELSPSYTHAPQSVITMQPKYGAPLVLHRL  518



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N G+SIE++I+EC LFYFAGQETTS +LVWT++LL R  DWQ RAREEVL VFG++K
Sbjct  308  GDKNFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRAREEVLQVFGNRK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLY PV  + R+  E+T LG+M LP GVLLSLP +L+H D
Sbjct  368  PDFDGLNHLKVVTMILYESLRLYPPVMTVTRRLNEDTVLGDMSLPAGVLLSLPAVLLHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAK+F PERFREG+  AT G+  FFPF+ GPRICIGQNFA++EAKM +AMILQR
Sbjct  428  EEIWGEDAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQR  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSF+LS SYAHAP+S +T QPQYGAPLI+H L
Sbjct  488  FSFDLSSSYAHAPHSVITTQPQYGAPLILHRL  519



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   325 bits (834),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I+++I+EC LFYFAGQETTSV+LVWTM+LLSR PDWQ RAREEVL VFGD  
Sbjct  307  GNKDFGMTIKEVIEECKLFYFAGQETTSVLLVWTMILLSRHPDWQVRAREEVLQVFGDGM  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+GLN LKVVTMIL+ESLRLY PV  L R+   +TKLGE+ LP GV+LSLPT+L+H D
Sbjct  367  PGFDGLNRLKVVTMILHESLRLYPPVGALGRRITTKTKLGELNLPAGVMLSLPTILVHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EFKPERF EGI KAT G+  FFPF  GPRICIG NFA++EAKMAMAMILQR
Sbjct  427  KEIWGEDATEFKPERFNEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F+FELSP Y HAP S +T+QP+YGAPL++H L
Sbjct  487  FAFELSPLYTHAPQSVITMQPKYGAPLVLHKL  518



>gb|KHN12943.1| Secologanin synthase [Glycine soja]
Length=351

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  G  +N GM++E++I+EC LFYFAGQ+TTSV+LVWTM+LLSR+PDWQARAREEV  VF
Sbjct  132  EEQGNNKNVGMNLEEVIEECKLFYFAGQDTTSVLLVWTMILLSRYPDWQARAREEVSQVF  191

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KP F+GLN LK+VTMILYE LRLY P  G+ RK +++ KLG +  P GV + + T+L
Sbjct  192  GNQKPTFDGLNQLKIVTMILYEVLRLYPPGVGVPRKVIKDVKLGNLSFPAGVEIFISTIL  251

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D+E+WG+DAKEFKPERF EG++KATNG+ +FFPF GGPRICI QNFAL+EAK+A++M
Sbjct  252  VHHDSELWGDDAKEFKPERFSEGVLKATNGRFSFFPFGGGPRICIAQNFALLEAKIALSM  311

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSP+Y HAP   +TIQPQYGAP+I+H +
Sbjct  312  ILQCFSFELSPTYTHAPTMVMTIQPQYGAPVILHKV  347



>gb|KEH38476.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=493

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GMS++ +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEVL VFG+ 
Sbjct  279  GNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNN  338

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMILYE LRLY PV  L R+  ++ KLG + LP GV + L  +++H 
Sbjct  339  KPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHH  398

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WGEDAK F PERF EG++KATNG+ +FFPF+GGPRICIGQNF+++EAKMA+AMILQ
Sbjct  399  DIELWGEDAKVFNPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQ  458

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSYAHAP + +T+QPQYGA +I+H L
Sbjct  459  RFSFELSPSYAHAPATVITLQPQYGAHIILHKL  491



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I EC LFYFAGQETTSV+LVWT++LLSR  DWQA AREEVL VFG++K
Sbjct  307  GNKDFGMSIEEVIQECKLFYFAGQETTSVLLVWTLILLSRHQDWQALAREEVLQVFGNQK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMILYESLRLY PV  L R+  E+T LG++ LP GVL+SLP +L+H D
Sbjct  367  PDFDGLNRLKIVTMILYESLRLYPPVVTLTRRPKEDTVLGDVSLPAGVLISLPVILLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DAK+FKPERFR+G+  AT G+  FFPF+ GPRICIGQNFA++EAK  +AMILQR
Sbjct  427  EEIWGKDAKKFKPERFRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTTLAMILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP S +T+QPQYGAPLI+H +
Sbjct  487  FSFELSPSYAHAPQSIITLQPQYGAPLILHKI  518



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GMS++ +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEVL VFG+ 
Sbjct  304  GNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNN  363

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMILYE LRLY PV  L R+  ++ KLG + LP GV + L  +++H 
Sbjct  364  KPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHH  423

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WGEDAK F PERF EG++KATNG+ +FFPF+GGPRICIGQNF+++EAKMA+AMILQ
Sbjct  424  DIELWGEDAKVFNPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQ  483

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSYAHAP + +T+QPQYGA +I+H L
Sbjct  484  RFSFELSPSYAHAPATVITLQPQYGAHIILHKL  516



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GMS++ +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEVL VFG+ 
Sbjct  304  GNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVFGNN  363

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMILYE LRLY PV  L R+  ++ KLG + LP GV + L  +++H 
Sbjct  364  KPDFDGLSHLKIVTMILYEVLRLYPPVIALARRVHKDVKLGNLALPAGVQVFLSIIMVHH  423

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WGEDAK F PERF EG++KATNG+ +FFPF+GGPRICIGQNF+++EAKMA+AMILQ
Sbjct  424  DIELWGEDAKVFNPERFSEGVLKATNGRNSFFPFAGGPRICIGQNFSMLEAKMAIAMILQ  483

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSYAHAP + +T+QPQYGA +I+H L
Sbjct  484  RFSFELSPSYAHAPATVITLQPQYGAHIILHKL  516



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM++E++I+EC LFYFAGQETTSV+LVWTM+LLS +PDWQ RAREEVL VFG++K
Sbjct  324  GNKNVGMNLEEVIEECKLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRK  383

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+FEGLN LK+VTMIL E LRLY PV GL RK  E+ KLG + LP GV +SLP +L+H D
Sbjct  384  PNFEGLNHLKIVTMILNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHD  443

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WG+DAKEFKPERF EG++KATNG+ +FF F GGPRICIGQNF+ +EAK+A++MILQR
Sbjct  444  CELWGDDAKEFKPERFSEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQR  503

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP+Y HAP S +T+QPQ+GA LI+H +
Sbjct  504  FSFELSPTYTHAPTSVITLQPQHGAHLILHKV  535



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 180/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM++E++I+EC LFYFAGQETTSV+LVWTM+LLS +PDWQ RAREEVL VFG++K
Sbjct  324  GNKNVGMNLEEVIEECKLFYFAGQETTSVLLVWTMILLSMYPDWQTRAREEVLQVFGNRK  383

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+FEGLN LK+VTMIL E LRLY PV GL RK  E+ KLG + LP GV +SLP +L+H D
Sbjct  384  PNFEGLNHLKIVTMILNEVLRLYPPVVGLARKVNEDVKLGNLSLPAGVQISLPIVLVHHD  443

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WG+DAKEFKPERF EG++KATNG+ +FF F GGPRICIGQNF+ +EAK+A++MILQR
Sbjct  444  CELWGDDAKEFKPERFSEGLLKATNGRVSFFAFGGGPRICIGQNFSFLEAKIALSMILQR  503

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP+Y HAP S +T+QPQ+GA LI+H +
Sbjct  504  FSFELSPTYTHAPTSVITLQPQHGAHLILHKV  535



>gb|ABC68405.1| cytochrome P450 monooxygenase CYP72A68 [Glycine max]
Length=457

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GM+IE++I+EC LFYFAGQ+TTSV+LVWTM+LLSR+PDWQARAREEV  VFG++
Sbjct  241  GNNKNVGMNIEEVIEECKLFYFAGQDTTSVLLVWTMILLSRYPDWQARAREEVSQVFGNQ  300

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KP F+GLN LK+VTMILYE LRLY P  G+ RK +++ KLG +  P GV + + T+L+H 
Sbjct  301  KPTFDGLNQLKIVTMILYEVLRLYPPGVGVPRKVIKDVKLGNLSFPAGVEIFISTILVHH  360

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D+E+WG+DAKEFKPERF EG++KATNG+ +FFPF GGPRICI QNFAL+EAK+A++MILQ
Sbjct  361  DSELWGDDAKEFKPERFSEGVLKATNGRFSFFPFGGGPRICIAQNFALLEAKIALSMILQ  420

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSP+Y HAP   +TIQPQYGAP+I+H +
Sbjct  421  CFSFELSPTYTHAPTMVMTIQPQYGAPVILHKV  453



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GMS+E +I+EC LFYFAGQETTSV+LVWTMV LSR+PDWQARAREEV  VFG+K
Sbjct  305  GNNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVCLSRYPDWQARAREEVFQVFGNK  364

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMIL E LRLY PV  L R   ++ KLG + LP GV +SLP +L+H 
Sbjct  365  KPDFDGLSHLKIVTMILNEVLRLYPPVIALARSVHKDVKLGNITLPAGVQVSLPVVLVHH  424

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WG+DAK F PERF EG++KATNGK +FFPF GGPRICIGQNF+++EAKMAMAMILQ
Sbjct  425  DCELWGDDAKVFNPERFSEGVLKATNGKVSFFPFGGGPRICIGQNFSMLEAKMAMAMILQ  484

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSPSYAHAP + +T+QPQYGA +I+  +
Sbjct  485  HFSFELSPSYAHAPATVITLQPQYGAHIILRKV  517



>ref|XP_006348305.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006348306.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X3 [Solanum 
tuberosum]
Length=417

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAG ETTSV ++WT+VLLSR+PDWQARAREEVL VFG +K
Sbjct  206  GNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAREEVLQVFGSRK  265

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLYSP+  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  266  PDFDGLNHLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSLPTGVLVSLPIILLHHD  325

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA +F PERFREGI  AT G+  +FPF+ GPRICIGQNFA++EAKM + MILQ 
Sbjct  326  KDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTVCMILQS  385

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSPSY HAP S +T QPQYGAPLI H L
Sbjct  386  FFFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  417



>ref|XP_006377681.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP55478.1| cytochrome P450 family protein [Populus trichocarpa]
Length=410

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G T++ GMSIE +IDEC +FYFAGQETT V+L WTM+LL+++P+WQARAREEV+ VF
Sbjct  195  QEHGNTKSVGMSIEDVIDECKIFYFAGQETTLVLLTWTMILLAQYPNWQARAREEVVQVF  254

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPDF+GLN LKVVTMILYE LRLY PV  L R   EE KLG ++LP GV +SLPT+L
Sbjct  255  GNKKPDFDGLNHLKVVTMILYEVLRLYPPVITLNRDVHEEIKLGNLLLPAGVQVSLPTIL  314

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DA EFKPERF EG+ KAT  + +F PF  GPRIC+GQNFAL+EAKMA+AM
Sbjct  315  LHQDHELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAM  374

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +LQR+SFELSPSY HAP + +T+QPQ+GAP+I+  L
Sbjct  375  VLQRYSFELSPSYIHAPRTVITLQPQHGAPMILRKL  410



>gb|KHN44060.1| Secologanin synthase [Glycine soja]
Length=457

 Score =   318 bits (816),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 181/216 (84%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  G  +N GM++E++I+EC LFYFAGQ+TTSV+LVWTM+LLSR+PDWQARAREEV  VF
Sbjct  238  EEQGNNKNVGMNLEEVIEECKLFYFAGQDTTSVLLVWTMILLSRYPDWQARAREEVSQVF  297

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KP F+GLN LK+VTMILYE LRLY P  G+ RK +++ KLG +  P GV + + T+L
Sbjct  298  GNQKPTFDGLNQLKIVTMILYEVLRLYPPGVGVPRKVIKDVKLGNLSFPAGVEIFISTIL  357

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D+E+WG+DAKEFKPERF EG++KATNG+ +FFPF GGPRICI QNFAL+EAK+A++M
Sbjct  358  VHHDSELWGDDAKEFKPERFSEGVLKATNGRFSFFPFGGGPRICIAQNFALLEAKIALSM  417

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSP+Y HAP   +TIQPQYGAP+I+H +
Sbjct  418  ILQCFSFELSPTYTHAPTMVMTIQPQYGAPVILHKV  453



>emb|CDP14360.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I+++IDEC LFYFAGQETTSV+LVWTM+LLSR+P+WQARAREEVL  FG  K
Sbjct  197  GNKDFGMTIKEVIDECKLFYFAGQETTSVLLVWTMILLSRYPNWQARAREEVLQHFGTNK  256

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDFEGLN LK+VTMIL+E LRLY P A + R+   E +LG++ LP  VLLSLPT+L+H D
Sbjct  257  PDFEGLNHLKLVTMILHEVLRLYPPAATIARRAAVEIQLGDLNLPAQVLLSLPTILLHHD  316

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG D +EFKPERF +G+  AT G+ AFFPF  GPRICIGQNF +VEAK+A+AM+LQR
Sbjct  317  PEIWGNDVEEFKPERFADGVSNATKGQVAFFPFGWGPRICIGQNFTMVEAKLAVAMVLQR  376

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP   +TIQPQYGA LI+H L
Sbjct  377  FSFELSPSYAHAPREVITIQPQYGAHLILHKL  408



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            ++  MSIE++I EC LFY AGQETTSV+LVWT++LLSR  DWQ+RAREEV  VFG++KPD
Sbjct  309  KDSAMSIEEVIQECKLFYVAGQETTSVLLVWTLILLSRHQDWQSRAREEVFQVFGNQKPD  368

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
            F+GLN LKVVTMILYESLRLYSPV  LIR+  E+  LG + LP GVLLSLP +L+H D E
Sbjct  369  FDGLNRLKVVTMILYESLRLYSPVVSLIRRPNEDAILGNVSLPEGVLLSLPVILLHHDEE  428

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
            IWG+DAK+F PERFR+G+  AT G+  FFPF+ GPRICIGQNFA++EAK A+AMILQRFS
Sbjct  429  IWGKDAKKFNPERFRDGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKTALAMILQRFS  488

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELSPSYAHAP S LT+QPQ+GAPLI+H +
Sbjct  489  FELSPSYAHAPQSILTMQPQHGAPLILHKI  518



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMS  +II+EC LFYFAGQETTSV+LVWTM+LLSR  DWQ RAREEVL VFGD K
Sbjct  307  GNKDFGMSTREIIEECKLFYFAGQETTSVLLVWTMILLSRHLDWQTRAREEVLQVFGDSK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
             +F+GLN LK+VTMIL ESLRLY P   L RKT   TKLGE+ LP GV+L LP +L+H D
Sbjct  367  LEFDGLNRLKIVTMILNESLRLYPPADSLNRKTTTNTKLGELSLPAGVMLVLPIILLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EFKPERF EG+ KAT G+  FFPF GGPRICIG NF ++EAKMA+AMILQ 
Sbjct  427  KEIWGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFTMIEAKMALAMILQH  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +TIQPQYGAPLI+H L
Sbjct  487  FSFELSPSYTHAPQSVITIQPQYGAPLILHKL  518



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I  ++DEC LFYFAGQETTSV+LVWTM+LL   P+WQ RAREEVL +FG+ K
Sbjct  305  GKKDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQIFGNNK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGLN LK+VTMILYE+LRL+ P+    R+T EE KL E+ LP GVLL +PT+L+H D
Sbjct  365  PDLEGLNRLKIVTMILYETLRLFPPLPIFGRRTEEEVKLRELNLPAGVLLIIPTILVHYD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KAT G+ +F PFS GPR+CIGQNFA++EAKMA+AMILQR
Sbjct  425  KEIWGEDAKEFKPERFSEGVSKATKGQVSFIPFSWGPRVCIGQNFAMMEAKMALAMILQR  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+MH L
Sbjct  485  FSFELSPSYTHAPFAVVTIHPQYGAPLLMHKL  516



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM++ ++I+EC LFYFAGQETTSV+LVWTM+LLSR+P+WQ RAREEVL +FG  K
Sbjct  307  GNKNFGMTVLEVIEECKLFYFAGQETTSVLLVWTMILLSRYPEWQMRAREEVLQLFGTDK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK++TMIL+E LRLY PV  L R+  EET+LG + LP G+L+SLP +L+H D
Sbjct  367  PDFDGLNHLKLITMILHEVLRLYPPVTALFRRAAEETRLGNLTLPAGLLVSLPVMLLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+D KEFKPERF +G+ KAT G+ AFFPFS GPRICIGQNFA++EAK+AM MILQR
Sbjct  427  PEIWGDDVKEFKPERFADGVSKATKGQFAFFPFSWGPRICIGQNFAMLEAKLAMTMILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP +  T+QPQ+GA LI+H L
Sbjct  487  FSFELSPSYTHAPRAMATLQPQFGAQLILHRL  518



>ref|XP_003546748.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase isoform X1 [Glycine 
max]
 ref|XP_006598130.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase isoform X2 [Glycine 
max]
Length=511

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 180/213 (85%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GM+IE++I+EC LFYFAGQ+TTSV+LVWTM+LLSR+PDWQARAREEV  VFG++
Sbjct  295  GNNKNVGMNIEEVIEECKLFYFAGQDTTSVLLVWTMILLSRYPDWQARAREEVSQVFGNQ  354

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KP F+GLN LK+VTMILYE LRLY P  G+ RK +++ KLG +  P GV + + T+L+H 
Sbjct  355  KPTFDGLNQLKIVTMILYEVLRLYPPGVGVPRKVIKDVKLGNLSFPAGVEIFISTILVHH  414

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D+E+WG+DAKEFKPERF EG++KATNG+ +FFPF GGPRICI QNFAL+EAK+A++MILQ
Sbjct  415  DSELWGDDAKEFKPERFSEGVLKATNGRFSFFPFGGGPRICIAQNFALLEAKIALSMILQ  474

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSP+Y HAP   +TIQPQYGAP+I+H +
Sbjct  475  CFSFELSPTYTHAPTMVMTIQPQYGAPVILHKV  507



>ref|XP_006377690.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP55487.1| cytochrome P450 family protein [Populus trichocarpa]
Length=353

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G T++ GMSIE +IDEC LFYFAGQETT V+L WTMVLL+++P+WQARAREEV+ VF
Sbjct  138  QEHGNTKSVGMSIEDVIDECKLFYFAGQETTLVLLTWTMVLLAQYPNWQARAREEVVQVF  197

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPDF+GLN LKVVTMILYE LRLY PV  L R   EE KLG ++LP GV +SLP +L
Sbjct  198  GNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVSLPIIL  257

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DA EFKPERF EGI KAT  + +F PF  GPRIC+GQNFAL+EAKMA+AM
Sbjct  258  LHQDHELWGDDASEFKPERFAEGISKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAM  317

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +LQR+SFELS SY HAP + +T+QPQ+GAP+I+  L
Sbjct  318  VLQRYSFELSSSYIHAPRTVITLQPQHGAPMILRKL  353



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   320 bits (819),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 175/214 (82%), Gaps = 0/214 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N G+SI  +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEVL VF
Sbjct  343  QEHGNNKNMGISIRDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVLQVF  402

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G   PDF+GL  LK+VTMILYE LR Y PV  L R   ++T+LG + LPPGV +SLP +L
Sbjct  403  GYNNPDFDGLGHLKIVTMILYEVLRFYPPVILLTRTVQKQTQLGNLSLPPGVQISLPVIL  462

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H DT +WGEDAKEFKPERF EG+ KAT G+ +FFPF  GPRICIGQNFA++EAKMA+A+
Sbjct  463  VHRDTNLWGEDAKEFKPERFAEGVSKATKGQVSFFPFGWGPRICIGQNFAMIEAKMALAL  522

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            ILQRF+FELSPSYAHAP + +T+QPQYGA + +H
Sbjct  523  ILQRFTFELSPSYAHAPCTVITLQPQYGAHITLH  556



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAG ETTSV ++WT+VLLSR+PDWQARAREEVL VFG +K
Sbjct  308  GNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQARAREEVLQVFGSRK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLYSP+  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  368  PDFDGLNHLKVVTMILYESLRLYSPITVLARRIYEDITLGEVSLPTGVLVSLPIILLHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA +F PERFREGI  AT G+  +FPF+ GPRICIGQNFA++EAKM + MILQ 
Sbjct  428  KDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTVCMILQS  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSPSY HAP S +T QPQYGAPLI H L
Sbjct  488  FFFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  519



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM+I+ +I+EC LF+FAGQETTSV LVWTM+LLSR PDWQ RAREEVL +FGD  
Sbjct  308  GNKNFGMTIKDVIEECKLFFFAGQETTSVWLVWTMILLSRHPDWQVRAREEVLQLFGDGM  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+F+GLN LKVVTMIL+ESLRLY P A L R+   + KLG++ LP GV+LSLPT+L+H D
Sbjct  368  PEFDGLNRLKVVTMILHESLRLYPPTAALGRRITTKMKLGKLNLPEGVMLSLPTILVHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA +FKPE+F EGI KAT G+  FFPF  GPRICIG NFA++EAKMAMAMILQR
Sbjct  428  KEIWGEDATKFKPEKFSEGISKATKGQMTFFPFGAGPRICIGLNFAMIEAKMAMAMILQR  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F+FELSPSY HAP S +T+QP+YGAPL++H L
Sbjct  488  FAFELSPSYTHAPQSVITMQPKYGAPLMLHKL  519



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAG ETTSV ++WT+VLLSR PDWQARAREEVL V G +K
Sbjct  308  GNKDFGMSIEEVIEECKLFYFAGTETTSVWILWTLVLLSRCPDWQARAREEVLQVLGSRK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLYSP+  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  368  PDFDGLNHLKVVTMILYESLRLYSPITVLTRRIYEDITLGEVSLPTGVLVSLPIILLHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA +F PERFREGI  AT G+  +FPF+ GPRICIGQNFA++EAKM + MILQ 
Sbjct  428  KDIWGEDANKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMTLCMILQS  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +T QPQYGAPLI H L
Sbjct  488  FSFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  519



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
              +N GMS+E++I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEV  VFG +K
Sbjct  307  NNKNVGMSLEEVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL+ LK+VTMILYE LRLY PVAG+ R   ++ KLG + LP GV + LPT+LIH D
Sbjct  367  PDFDGLSRLKIVTMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             + WGEDAK+F PERF EG++KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ 
Sbjct  427  RKFWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQH  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP+YAHAP + +TIQPQYGA +I+  +
Sbjct  487  FSFELSPAYAHAPTALITIQPQYGAHIILRKV  518



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
              +N GMS+E++I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREEV  VFG +K
Sbjct  307  NNKNVGMSLEEVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEVFQVFGYQK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL+ LK+VTMILYE LRLY PVAG+ R   ++ KLG + LP GV + LPT+LIH D
Sbjct  367  PDFDGLSRLKIVTMILYEVLRLYPPVAGMTRSIEKDVKLGTLTLPAGVHVLLPTILIHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             + WGEDAK+F PERF EG++KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ 
Sbjct  427  RKFWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQH  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP+YAHAP + +TIQPQYGA +I+  +
Sbjct  487  FSFELSPAYAHAPIALITIQPQYGAHIILRKV  518



>gb|KEH38472.1| cytochrome P450 family protein [Medicago truncatula]
Length=353

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GMS++ +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQ RAREEVL VFG+ 
Sbjct  139  GNNKNVGMSLDDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVFGNN  198

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMILYE LRLY P   L R   ++  LG + LP GV + L  +L+H 
Sbjct  199  KPDFDGLSHLKIVTMILYEVLRLYPPAIALARSVHKDVILGNLALPAGVQVFLSIILVHH  258

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WG+DAK F PERF EG++KATNG+ +FFPF GGPRICIGQNF+++EAKMA+AMILQ
Sbjct  259  DIELWGDDAKVFNPERFSEGVLKATNGRNSFFPFGGGPRICIGQNFSMLEAKMAIAMILQ  318

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RF FELSPSYAHAP + +T+QPQYGA +I+  +
Sbjct  319  RFDFELSPSYAHAPATVITLQPQYGAHIILRKV  351



>gb|ABC59099.1| cytochrome P450 monooxygenase CYP72A66 [Medicago truncatula]
Length=395

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 176/210 (84%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            ++ GMS++ +++EC LF+FAGQETTSV+LVWTM+LLSR+PDWQ RAREEVLHVFG+KKPD
Sbjct  184  KSVGMSLDHVVEECKLFHFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLHVFGNKKPD  243

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
            F+GLN+LK+VTMILYE LRLY PV GL R  V++ KLG + LP GV + LP LLIH D +
Sbjct  244  FDGLNNLKIVTMILYEVLRLYPPVMGLARNVVKDMKLGNLTLPAGVEVFLPILLIHHDCK  303

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
            +WG+DAK F PERF  GI KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ FS
Sbjct  304  LWGDDAKMFNPERFSGGISKATNGRVSFFPFGWGPRICIGQNFSLMEAKMALSMILQHFS  363

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELS +YAHAP + +T+QPQYGA +I+  +
Sbjct  364  FELSSTYAHAPSTVITLQPQYGAHIIIRKV  393



>ref|XP_011009101.1| PREDICTED: cytochrome P450 CYP72A219-like [Populus euphratica]
Length=547

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G T++ GMSIE +IDEC +FYFAGQETTSV+L WTMVLL+++P+WQAR REEV+ VF
Sbjct  332  QEHGNTKSVGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARGREEVVQVF  391

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPDF+GLN LKVVTMILYE LRLY PV  L R   EE KLG ++LP GV +S+PT+L
Sbjct  392  GNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQISVPTIL  451

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DA EFKPERF EG+ KAT  + +F PF  GPRIC+GQNFA++EAKMA+AM
Sbjct  452  LHQDRELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFAMIEAKMALAM  511

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQR SFELSPSY HAP++ +T+QPQ+GAP+I+  L
Sbjct  512  ILQRCSFELSPSYVHAPHTVITLQPQHGAPMILRKL  547



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAGQETTSV+LVWT++LLSR  DWQA+AREEVL VFG +K
Sbjct  305  GNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+V  +LYESLRLY PV  L R+  E+T LG++ LP GVL+SLP +L+H D
Sbjct  365  PDFDGLNRLKIVRELLYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DAK+FKPERFR+G+  A  G+  +FPF+ GPRICIG NFA++EAK A+AMILQR
Sbjct  425  EEIWGKDAKKFKPERFRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQR  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP S +T+QPQYGAPLI+H +
Sbjct  485  FSFELSPSYAHAPQSIITLQPQYGAPLILHKI  516



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 178/212 (84%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAGQETTSV+LVWT++LLSR  DWQA+AREEVL VFG +K
Sbjct  305  GNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQAREEVLQVFGSQK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+V  +LYESLRLY PV  L R+  E+T LG++ LP GVL+SLP +L+H D
Sbjct  365  PDFDGLNRLKIVRELLYESLRLYPPVVSLTRRPKEDTVLGDVSLPAGVLISLPVILLHHD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DAK+FKPERFR+G+  A  G+  +FPF+ GPRICIG NFA++EAK A+AMILQR
Sbjct  425  EEIWGKDAKKFKPERFRDGVSSAAKGQVTYFPFTWGPRICIGLNFAMLEAKTALAMILQR  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP S +T+QPQYGAPLI+H +
Sbjct  485  FSFELSPSYAHAPQSIITLQPQYGAPLILHKI  516



>ref|XP_006407057.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum]
 gb|ESQ48510.1| hypothetical protein EUTSA_v10020855mg [Eutrema salsugineum]
Length=404

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  192  GQAKGNGMSTEEVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  251

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  + R   +E KLG++ LP GV +SLP LL+  
Sbjct  252  EPDAEGLNQLKVMTMILYEVLRLYPPVTQVTRAIHKEMKLGDLTLPGGVQISLPILLVQR  311

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF+EG+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  312  DTELWGDDAAEFKPERFKEGLSKATKSQVSFFPFTWGPRICIGQNFAILEAKMAMALILQ  371

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY  +TI PQ+GA LI+H L
Sbjct  372  RFSFELSPSYVHAPYPVITIHPQFGAQLILHKL  404



>gb|AGX93058.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Amsonia hubrichtii]
Length=518

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GM+IEQII EC LFYFAGQ+TTS +LVWTMVLLSRFP+WQ RAREEVL VFGDK
Sbjct  306  GNNKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREEVLQVFGDK  365

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD++G++ LK+VTMILYE LRLY+PVA L +   E+T+LG+  +P GV L +P +L+H 
Sbjct  366  TPDYDGISHLKIVTMILYEVLRLYTPVAELTKVAHEDTQLGKYFIPAGVQLMMPQMLLHH  425

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D +IWGED  EFKPERF EG++KAT  + ++FPFS GPR+CIGQNFAL+EAKMAMA+IL+
Sbjct  426  DPQIWGEDVMEFKPERFSEGVLKATKSQGSYFPFSLGPRMCIGQNFALLEAKMAMALILR  485

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP++ +T+QPQYGA LI+H L
Sbjct  486  RFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  518



>gb|KEH38469.1| cytochrome P450 family 709 protein [Medicago truncatula]
Length=516

 Score =   315 bits (808),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
              ++ GMS++ +++EC LF+FAGQETTSV+LVWTM+LLSR+PDWQ RAREEVLHVFG++K
Sbjct  303  NNKDVGMSLDDVVEECKLFHFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLHVFGNRK  362

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN+LK+VTMILYE LRLY PV GL R   ++ KLG + LP GV + LP LLIH D
Sbjct  363  PDFDGLNNLKIVTMILYEVLRLYPPVIGLARNVEKDVKLGNLTLPAGVEIFLPILLIHHD  422

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WG+DAK F PERF  GI KATNG+ +FFPF  GPRICIGQNF+L+EAKMAM +ILQ 
Sbjct  423  CELWGDDAKMFNPERFFGGISKATNGRVSFFPFGWGPRICIGQNFSLMEAKMAMTLILQH  482

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP+YAHAP S +T+QPQYGA +I+  L
Sbjct  483  FSFELSPTYAHAPSSMITLQPQYGAHIIIRKL  514



>ref|XP_004488665.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=524

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GM+IE +I+EC LFYFAGQETTSV+LVWTM+LLSR+PDWQARAREEV HVFG+K
Sbjct  310  GNNKNAGMNIEDVIEECKLFYFAGQETTSVLLVWTMILLSRYPDWQARAREEVFHVFGNK  369

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL++LK+VTM+LYE LRLY PV GL RK  ++ KLG + LP GV + LP +L+H 
Sbjct  370  KPDFDGLSNLKIVTMVLYEVLRLYPPVIGLARKIDKDMKLGNLTLPAGVEVFLPIILLHH  429

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG+DA  F PERF  G+ KATNG+ +FFPF  GPRIC+GQNF+L+EAKMAMAMILQ
Sbjct  430  DTQLWGDDATMFNPERFSGGVSKATNGRVSFFPFGWGPRICVGQNFSLLEAKMAMAMILQ  489

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSP+Y+HAP + +T++PQ+GA +I+  +
Sbjct  490  HFSFELSPTYSHAPTTVITLRPQHGAHIILRKV  522



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 177/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
              +N GMS++ +I+EC LFYFAG ETTSV+LVWT+VLLSR+PDWQARAREEVL VFG+ K
Sbjct  305  NNKNVGMSLDDVIEECKLFYFAGAETTSVLLVWTIVLLSRYPDWQARAREEVLQVFGNNK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL+ LK+VTMILYE LRLY PV  L R   ++ KLG + LP GV ++LP +L+H D
Sbjct  365  PDFDGLSHLKIVTMILYEVLRLYPPVIELARSVHKDVKLGNLTLPAGVQITLPIVLVHHD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            +E+WG+DAK F PERF EG++KATNG+ +F PF GGPRICIGQNF+++EAKMA+AMILQR
Sbjct  425  SELWGDDAKVFNPERFSEGVLKATNGRNSFVPFGGGPRICIGQNFSMLEAKMAIAMILQR  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP + +T+QPQYGA +I+  +
Sbjct  485  FSFELSPSYAHAPTALITLQPQYGAHIILRKV  516



>emb|CDX82469.1| BnaA03g33520D [Brassica napus]
Length=206

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  745  MSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDFEGL  566
            MS E +++EC LFYFAGQETTSV+LVWTMV+LS+  DWQ RAREEV  VFGDK+PD EGL
Sbjct  1    MSTEDVMEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQIRAREEVKQVFGDKEPDTEGL  60

Query  565  NDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEIWGE  386
            N LKV+TMILYE LRLY P A L R   +E KLG++ LP GV ++LP LL+H DT++WG 
Sbjct  61   NQLKVMTMILYEVLRLYPPAAQLTRAIHKEIKLGDLTLPGGVQINLPILLVHRDTQLWGN  120

Query  385  DAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSFELS  206
            DA EFKP RF++G+ KATNG+ +FFPF+ GPRICIGQNFAL+E KMA+A+ILQRFSFELS
Sbjct  121  DAGEFKPGRFKDGVSKATNGQVSFFPFAWGPRICIGQNFALMETKMALALILQRFSFELS  180

Query  205  PSYAHAPYSKLTIQPQYGAPLIMHNL  128
            PSY HAPY+ LT+ PQ+GA LI+H L
Sbjct  181  PSYVHAPYTVLTLHPQFGAHLILHKL  206



>emb|CDY70619.1| BnaCnng69060D [Brassica napus]
Length=362

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 174/215 (81%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFG
Sbjct  132  NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFG  191

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+PD EGLN LKV+TMILYE LRLY P A L R   +E KLG++ LP GV ++LP LL+
Sbjct  192  DKEPDTEGLNQLKVMTMILYEVLRLYPPAAQLTRAIHKEMKLGDLTLPGGVQINLPILLV  251

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H D ++WG+DA EFKPERF++G+ KAT G+ +FFPF  GPRICIGQNFAL+E KMA+A+I
Sbjct  252  HRDIQLWGKDAAEFKPERFQDGVSKATKGQVSFFPFGWGPRICIGQNFALMETKMALALI  311

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSY HAPY+ LT+QPQ GA LI+H +
Sbjct  312  LQRFSFELSPSYVHAPYTVLTLQPQSGAHLILHKI  346



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GMSI ++I+EC LFYFAGQETTSV+LVWT++LL R P+WQ RAREEV   FG  K
Sbjct  310  GNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDK  369

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+ L  LK+VTMILYESLRLY P+A   R+T EETKLGE+ LP G LL +PT+L+HLD
Sbjct  370  PTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLD  429

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EF PERF EG+ KAT GK  +FPF  GPR CIGQNFA++EAKMA+AMILQR
Sbjct  430  KEIWGEDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQR  489

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY H+PY+ +T++P+YGAPLIMH L
Sbjct  490  FSFELSPSYTHSPYTVVTLKPKYGAPLIMHRL  521



>ref|XP_011009102.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Populus euphratica]
 ref|XP_011009103.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Populus euphratica]
Length=542

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G +++ GMSIE +IDEC +FYFAGQETTSV+L WTMVLL+++P+WQARAREEV+ VF
Sbjct  327  QEHGNSKSAGMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQARAREEVVQVF  386

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPDF+GLN LKVVTMILYE LRLY PV  L R   EE KLG +++P GV +S+PT+L
Sbjct  387  GNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLVPAGVQISVPTIL  446

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DA EFKPERF EG+ KAT  + +F PF  GPRIC+GQNFA++EAKMA+AM
Sbjct  447  LHQDRELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFAMIEAKMALAM  506

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQR SFELSPSY HAP + +T+QPQ+GAP+I+  L
Sbjct  507  ILQRCSFELSPSYIHAPRTVITLQPQHGAPMILRKL  542



>ref|XP_010323670.1| PREDICTED: cytochrome P450 CYP72A219 isoform X2 [Solanum lycopersicum]
Length=431

 Score =   311 bits (797),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G+++ GM+  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ RAREEVL VFG+ K
Sbjct  220  GSKDFGMTTVEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDK  279

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGL  LK+VTMILYE+LRL+ P+    R   EE KLGE+ LP GV+L +P +L+H D
Sbjct  280  PDLEGLGRLKIVTMILYETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYD  339

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KAT G+ +F PF GGPRICIGQNFA++EAKMA+AMILQR
Sbjct  340  KEIWGEDAKEFKPERFSEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQR  399

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  400  FSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  431



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GMSI ++I+EC LFYFAGQETTSV+LVWT++LL R P+WQ RAREEV   FG  K
Sbjct  310  GNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDK  369

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+ L  LK+VTMILYESLRLY P+A   R+T EETKLGE+ LP G LL +PT+L+HLD
Sbjct  370  PTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLD  429

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EF PERF EG+ KAT GK  +FPF  GPR CIGQNFA++EAKMA+AMILQR
Sbjct  430  REIWGEDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQR  489

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY H+PY+ +T++P+YGAPLIMH L
Sbjct  490  FSFELSPSYTHSPYTVVTLKPKYGAPLIMHRL  521



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   313 bits (803),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMS + +I+EC LFYFAGQETTSV+L+WTMVLLS+  +WQARAREEVL VF
Sbjct  300  QEHGERKNVGMSNKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY P + LIR    +T++G M LP GV +SLP LL
Sbjct  360  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRSVYADTEVGGMYLPDGVQVSLPILL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+DAK+F PERF EG+ KAT G+ AFFPF  GPR+CIGQNFA++EAKMA+AM
Sbjct  420  LHHDHEIWGDDAKDFNPERFSEGVSKATKGQFAFFPFGYGPRVCIGQNFAMMEAKMALAM  479

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S +TIQPQYGA LI+H L
Sbjct  480  ILQRFSFELSPSYAHAPISVITIQPQYGAHLILHGL  515



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   314 bits (804),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GMSI ++I+EC LFYFAGQETTSV+LVWT++LL R P+WQ RAREEV   FG  K
Sbjct  320  GNKKFGMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQERAREEVFQAFGSDK  379

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+ L  LK+VTMILYESLRLY P+A   R+T EETKLGE+ LP G LL +PT+L+HLD
Sbjct  380  PTFDELYRLKIVTMILYESLRLYPPIATRTRRTNEETKLGELDLPKGALLFIPTILLHLD  439

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EF PERF EG+ KAT GK  +FPF  GPR CIGQNFA++EAKMA+AMILQR
Sbjct  440  KEIWGEDADEFNPERFSEGVAKATKGKMTYFPFGAGPRKCIGQNFAILEAKMAIAMILQR  499

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY H+PY+ +T++P+YGAPLIMH L
Sbjct  500  FSFELSPSYTHSPYTVVTLKPKYGAPLIMHRL  531



>ref|XP_006598138.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
 ref|XP_006598139.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X3 [Glycine 
max]
 ref|XP_006598140.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X4 [Glycine 
max]
Length=419

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
             ++N GMS+E +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREE   VFG +K
Sbjct  206  NSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQK  265

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL+ LK+VTMILYE LRLY P+ G+ R   ++ KLG + LP GV + LPT+LIH D
Sbjct  266  PDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHD  325

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            +E+WGEDAK+F PERF EG++KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ 
Sbjct  326  SELWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQN  385

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSP+YAHAP   +T QPQYGA +I+  +
Sbjct  386  FLFELSPAYAHAPTMSITTQPQYGAHIILRKV  417



>ref|XP_009615909.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=436

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++  GM+  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ  AREEVL VFG+ K
Sbjct  225  GSKEFGMTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVLAREEVLQVFGNDK  284

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGLN LK+VTMILYE+LRL+ P+    R+T EE KLGE+ LP GV+L +P +L+H D
Sbjct  285  PDLEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNLPDGVVLLIPAVLVHYD  344

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KATNG+ ++ PF GGPRICIGQNFA++EAK A+ MILQR
Sbjct  345  KEIWGEDAKEFKPERFSEGVSKATNGQVSYIPFGGGPRICIGQNFAMLEAKTAITMILQR  404

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  405  FSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  436



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   313 bits (801),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAG ETTSV ++WT+VLLSR PDWQ RAREEVL V G +K
Sbjct  303  GNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRHPDWQERAREEVLQVLGSRK  362

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLYSP+  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  363  PDFDGLNHLKVVTMILYESLRLYSPITVLTRRVYEDITLGEVSLPTGVLVSLPMILLHHD  422

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA +F PERF EGI  AT G+  +FPF+ GPRICIGQNFA++EAKM + MILQ 
Sbjct  423  KDIWGEDATKFNPERFSEGISSATKGQVTYFPFAWGPRICIGQNFAILEAKMTLCMILQS  482

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +T QPQYGAPLI H L
Sbjct  483  FSFELSPSYTHAPQSLVTTQPQYGAPLIFHKL  514



>gb|KEH38470.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=513

 Score =   312 bits (800),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 176/210 (84%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            ++ GMS++ +++EC LF+FAGQETTSV+LVWTM+LLSR+PDWQ RAREEVLHVFG+KKPD
Sbjct  302  KSVGMSLDHVVEECKLFHFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLHVFGNKKPD  361

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
            F+GLN+LK+VTMILYE LRLY PV GL R  V++ KLG + LP GV + LP LLIH D +
Sbjct  362  FDGLNNLKIVTMILYEVLRLYPPVMGLARNVVKDMKLGNLTLPAGVEVFLPILLIHHDCK  421

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
            +WG+DAK F PERF  GI KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ FS
Sbjct  422  LWGDDAKMFNPERFSGGISKATNGRVSFFPFGWGPRICIGQNFSLMEAKMALSMILQHFS  481

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELS +YAHAP + +T+QPQYGA +I+  +
Sbjct  482  FELSSTYAHAPSTVITLQPQYGAHIIIRKV  511



>ref|XP_009796906.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=446

 Score =   310 bits (795),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++  GM+  ++I+EC LFYFAGQE TSV+LVWTM+LL   P+WQ RAREEVL VF  +K
Sbjct  235  GSKEFGMTTSEVIEECKLFYFAGQEITSVLLVWTMILLCLHPEWQVRAREEVLQVFRIEK  294

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDFEGLN LK+VTMILYE+LRL+ P+    R+T EE KLGE+ LP GV++ +P + +H D
Sbjct  295  PDFEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNLPDGVVVLIPAVFVHYD  354

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIW EDAKEFKPERF EG+ KATNG+ +F PF GGPRIC+GQNFA++EAKMA+AMILQR
Sbjct  355  KEIWSEDAKEFKPERFSEGVSKATNGQVSFIPFGGGPRICVGQNFAMLEAKMAIAMILQR  414

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  415  FSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  446



>gb|AGX93061.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Vinca minor]
Length=520

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  RN GM+IEQII EC LFYFAGQ+TTS ++VWTMVLLSRFP+WQ RAREEVL VFG+K
Sbjct  308  GNNRNAGMTIEQIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEWQTRAREEVLQVFGNK  367

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD++G++ LKV+TMILYE LRLY+PVA L +   E+T+LG+  +P GV L +P  L+H 
Sbjct  368  PPDYDGISRLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYFIPAGVQLMMPQALLHH  427

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D EIWGED  EFKPERF EG++KAT  + +FFPFS GPR+CIGQNFAL+EAKMAM++IL+
Sbjct  428  DPEIWGEDVMEFKPERFSEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAKMAMSLILR  487

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RF+FELSPSY HAP++ +T+QPQYGA LI+H L
Sbjct  488  RFAFELSPSYVHAPFTLITMQPQYGAHLILHKL  520



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GMSI ++I+EC LFYFAGQETTSV+LVWTM+LLSR+P+WQARAREEVL  FG  K
Sbjct  314  GNKGFGMSIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPNWQARAREEVLQHFGTNK  373

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD +GLN LK+VTMIL+E LRLY PV  L RK  EET+LG + LP  V +SLP +L+H  
Sbjct  374  PDLDGLNHLKLVTMILHEVLRLYPPVPELARKAAEETQLGNLTLPSQVQVSLPAMLLHYA  433

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+D KEFKPERF +G+  ATNGK AFFPF  GPRIC+GQNFA++EAK+A+AMILQR
Sbjct  434  PEIWGDDVKEFKPERFADGVSNATNGKVAFFPFGWGPRICVGQNFAMLEAKVALAMILQR  493

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP   LT+QPQYGA LI+H L
Sbjct  494  FSFELSPSYRHAPRVVLTLQPQYGAHLILHKL  525



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G    GM+I ++I+EC LFYFAGQETTSV+LVWTM+LLSR+PDWQARAREEVL +FG +K
Sbjct  305  GQDGAGMTIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPDWQARAREEVLQLFGTRK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN L +VTMIL+E LRLY+PV  L R+  EETKLG M LP  VLLSLP +++H D
Sbjct  365  PDFDGLNRLNLVTMILHEVLRLYAPVPALSRRVAEETKLGSMRLPADVLLSLPVMVLHHD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            TEIWG+DAKEFKPERF EG+  AT G+ AFFPF  GPR+CIGQ+FA++EAK+ + MIL+ 
Sbjct  425  TEIWGDDAKEFKPERFAEGVPHATKGQVAFFPFGWGPRVCIGQHFAMLEAKLVLVMILRS  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY+HAP + +T+QPQ+GA LI+H L
Sbjct  485  FSFELSPSYSHAPRAIITLQPQHGAHLILHKL  516



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 173/213 (81%), Gaps = 1/213 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+ E+I+DEC LFYFAGQETTS +LVWTMVLL R+P+WQARAREEVL  FG K 
Sbjct  312  GNKDSGMTTEEIVDECKLFYFAGQETTSALLVWTMVLLCRYPEWQARAREEVLQQFGTKD  371

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMIL+E LRLY PVA + R+T+EETKLG + LP GV L+LP LL+H D
Sbjct  372  PDFDGLNHLKIVTMILHEVLRLYPPVATMSRRTIEETKLGNLTLPAGVQLTLPILLMHHD  431

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGED KEFKPERF EG+  AT G  A+FPF  GPRICIGQNFA++EAK+AM+MILQR
Sbjct  432  PDIWGEDVKEFKPERFAEGVSHATKGHVAYFPFGWGPRICIGQNFAMLEAKLAMSMILQR  491

Query  223  FSFELSPSYAHAPYSKLT-IQPQYGAPLIMHNL  128
            FSFELSPSY HAP +    +QPQYGA LI+  +
Sbjct  492  FSFELSPSYTHAPGTATALVQPQYGAHLILQKI  524



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
              ++ GMS++ +I+EC LFYFAGQETTSV+LVW M+LLSR+PDWQARAREEVL VFG+KK
Sbjct  305  NNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWAMMLLSRYPDWQARAREEVLQVFGNKK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMILYE LRLY P     R T ++ KLG + LP GV ++LP +L+H D
Sbjct  365  PDFDGLNQLKIVTMILYEVLRLYPPAIATSRSTHKDVKLGNLTLPAGVQITLPIVLVHHD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            +E+WGEDAK F PERF  GI KATNG+ +FFPF GGPRICIGQNF+++EAKMAMAMIL++
Sbjct  425  SELWGEDAKVFNPERFSGGISKATNGRFSFFPFGGGPRICIGQNFSMLEAKMAMAMILKK  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP   +T+QP+YG  LI+  +
Sbjct  485  FSFELSPSYAHAPTQVITLQPKYGVHLILRKV  516



>ref|XP_003543172.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=519

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N G+++E++I EC LFYFAGQETTSV+LVWTM+LLSR+PDWQ RAREEVL VF
Sbjct  302  QEHKNNKNVGLNLEEVIQECKLFYFAGQETTSVLLVWTMILLSRYPDWQTRAREEVLKVF  361

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KP+F+GL+ LK+VTMILYE LRLY P  GL+RK  ++ KLG + LP GV +SLP +L
Sbjct  362  GNQKPNFDGLSHLKIVTMILYEVLRLYPPAIGLVRKVNKDVKLGNLSLPAGVQISLPIVL  421

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEFKPERF EG++KATNG+ +FF F GGPRICIGQNF+ +EAK+A++M
Sbjct  422  VHHDCELWGDDAKEFKPERFSEGLLKATNGRFSFFAFGGGPRICIGQNFSFLEAKIALSM  481

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRF F LSP+Y HAP + +T+QPQYGA LI+  +
Sbjct  482  ILQRFLFGLSPTYTHAPTTVITLQPQYGAHLILRKV  517



>gb|KJB12898.1| hypothetical protein B456_002G043200 [Gossypium raimondii]
Length=518

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             +N GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL+R+PDWQ++AREEVLHV GD KP
Sbjct  305  AKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQSKAREEVLHVLGDSKP  364

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +GLN LKVVTMILYE LRLY PV  L R   +E KLG ++LP G  +S+P L IH D 
Sbjct  365  DADGLNRLKVVTMILYEVLRLYPPVVELGRSVPKEIKLGNLLLPVGTEVSVPILQIHHDK  424

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            ++WG+DA+EFKPERF EG+ KAT  +  F PF  GPRICIGQNFAL+EAKMAMAMILQRF
Sbjct  425  DLWGDDAREFKPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFALMEAKMAMAMILQRF  484

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FELSPSYAH+PYS+ T++PQ+GA +I+H L
Sbjct  485  WFELSPSYAHSPYSRATLRPQHGAQIILHKL  515



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  RN GMS+E +I+EC LFYFAGQETTS +LVWTMVLLSR+PDWQARAREEVL VFG+K
Sbjct  308  GNNRNVGMSLEDVIEECKLFYFAGQETTSGLLVWTMVLLSRYPDWQARAREEVLQVFGNK  367

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL+ LK+VTMILYE LRLY PV  L R   ++ KLG   LP GV L LP +L H 
Sbjct  368  KPDFDGLSHLKIVTMILYEVLRLYPPVIALARTVHKDVKLGNRTLPAGVQLYLPIVLFHH  427

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WG+DA+ F PERF EG++KATNGK +FFPF  GPRIC+GQNF+L+EAKMA++MILQ
Sbjct  428  DRELWGDDAEVFNPERFSEGVLKATNGKVSFFPFGWGPRICVGQNFSLLEAKMAVSMILQ  487

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSP+YAHAP + +T++PQYGA +I+  +
Sbjct  488  HFSFELSPAYAHAPTTVITLRPQYGAHIILRKV  520



>gb|KJB12897.1| hypothetical protein B456_002G043200 [Gossypium raimondii]
Length=512

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             +N GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL+R+PDWQ++AREEVLHV GD KP
Sbjct  299  AKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQSKAREEVLHVLGDSKP  358

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +GLN LKVVTMILYE LRLY PV  L R   +E KLG ++LP G  +S+P L IH D 
Sbjct  359  DADGLNRLKVVTMILYEVLRLYPPVVELGRSVPKEIKLGNLLLPVGTEVSVPILQIHHDK  418

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            ++WG+DA+EFKPERF EG+ KAT  +  F PF  GPRICIGQNFAL+EAKMAMAMILQRF
Sbjct  419  DLWGDDAREFKPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFALMEAKMAMAMILQRF  478

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FELSPSYAH+PYS+ T++PQ+GA +I+H L
Sbjct  479  WFELSPSYAHSPYSRATLRPQHGAQIILHKL  509



>ref|XP_006377676.1| hypothetical protein POPTR_0011s10150g [Populus trichocarpa]
 gb|ERP55473.1| hypothetical protein POPTR_0011s10150g [Populus trichocarpa]
Length=492

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 177/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G T++ GMSIE +IDEC +FY AGQETTSV+L WTMVLL+++P+WQARAREEV+ VF
Sbjct  277  QEHGNTKSVGMSIEDVIDECKIFYVAGQETTSVLLTWTMVLLAQYPNWQARAREEVVQVF  336

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPDF+GLN LKVVTMILYE LRLY PV  L R   EE KLG ++LP GV +S+PT+L
Sbjct  337  GNKKPDFDGLNHLKVVTMILYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQISVPTIL  396

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DA EFKPERF EG+ KAT  + +F PF  GPRIC+GQNFAL+EAK+A+AM
Sbjct  397  LHQDHELWGDDASEFKPERFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKIAVAM  456

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +LQ +SFELSPSY HAP + +T+QPQ+GAP+I+  L
Sbjct  457  VLQLYSFELSPSYIHAPRTVVTLQPQHGAPMILRKL  492



>ref|XP_010465366.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GM+ E++++EC LFYFAGQETT+V+LVWTM+LLS+  DWQ+RAREEV  VFGDK
Sbjct  301  GQTKGNGMTTEELMEECKLFYFAGQETTTVLLVWTMILLSQHKDWQSRAREEVKQVFGDK  360

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG+M LP GV +SLP LL+  
Sbjct  361  EPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDMTLPSGVQISLPILLVQH  420

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  421  DTELWGNDAAEFKPERFKDGVSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  480

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP++ +TI PQ+GAPLI+H L
Sbjct  481  KFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>ref|XP_006377693.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
 gb|ERP55490.1| hypothetical protein POPTR_0011s10300g [Populus trichocarpa]
Length=518

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G T++ GMSIE +IDEC +FYFAGQETT+V+L WTMVLL+++P+WQARAREEV+ VF
Sbjct  303  QEHGNTKSVGMSIEDVIDECRIFYFAGQETTTVLLTWTMVLLAQYPNWQARAREEVVQVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPDF+GLN LKVVTMI YE LRLY PV  L R   EE KLG ++LP GV +S+PT+L
Sbjct  363  GNKKPDFDGLNHLKVVTMIFYEVLRLYPPVIMLNRDVHEEIKLGNLLLPAGVQVSVPTIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DA EFKP RF EG+ KAT  + +F PF  GPRIC+GQNFAL+EAKMA+AM
Sbjct  423  LHQDHELWGDDASEFKPGRFAEGVSKATKSQVSFLPFGWGPRICVGQNFALIEAKMALAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQR SFELSPSY HAP + +T+QPQ+GAP+I+  L
Sbjct  483  ILQRCSFELSPSYIHAPRTVITLQPQHGAPMILRKL  518



>emb|CDX82472.1| BnaA03g33490D [Brassica napus]
Length=406

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 175/215 (81%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAREEV  VFG
Sbjct  192  NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFG  251

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+PD EGLN  KV+TMILYE LRLY P+  + R   +E KLG++ LP GV +SLPTLL+
Sbjct  252  DKEPDTEGLNQRKVMTMILYEVLRLYPPLTQMTRAIHKEMKLGDLTLPGGVQISLPTLLV  311

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG DA EFKPERF+EG+ KAT G+ +FFPF+ GPRICIGQNF L+EAKMA+++I
Sbjct  312  HRDTQLWGSDAAEFKPERFKEGVSKATKGQVSFFPFAWGPRICIGQNFGLLEAKMALSLI  371

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSYAHAPY  +T+ PQ+GA LI+H +
Sbjct  372  LQRFSFELSPSYAHAPYIVITLHPQFGAHLILHKI  406



>ref|XP_009116716.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Brassica rapa]
Length=486

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G     GMS E +I+EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAREEV  VFGDK
Sbjct  274  GQDEGNGMSTEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFGDK  333

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD EGLN LKV+TMILYE LRLY PVA LIR   +E K+G++ LP GV ++LP LL+  
Sbjct  334  KPDAEGLNQLKVMTMILYEVLRLYPPVAQLIRAVHKEMKVGDLTLPGGVHINLPILLVQR  393

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF++G+ KAT  + ++FPFS GPRICIGQ+FAL+EAKMAMA+ILQ
Sbjct  394  DTELWGQDAGEFKPERFKDGLSKATKNQVSYFPFSWGPRICIGQSFALLEAKMAMALILQ  453

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA L +H L
Sbjct  454  RFSFELSPSYVHAPYTVMTIHPQFGAHLTLHKL  486



>ref|XP_010465360.1| PREDICTED: cytochrome P450 72A15 [Camelina sativa]
Length=512

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTKGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  EPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEIKLGDLTLPGGVQISLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  420  DTELWGNDAGEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAPY+ +TI PQ+GA LI+H L
Sbjct  480  KFSFELSPSYLHAPYTIITIHPQFGAQLILHKL  512



>ref|XP_009146335.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +   MS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAR+EV  VFGDK
Sbjct  300  GQAKGNEMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARDEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PVA L R   +E KLG++ LP G  +SLP LL+H 
Sbjct  360  EPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQISLPILLVHR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WGEDA EFKPERF++G+ KATNGK +FFPF+ GPRICIGQ+FAL+E KMA+A+IL+
Sbjct  420  DTQLWGEDAAEFKPERFKDGVSKATNGKVSFFPFAWGPRICIGQSFALLETKMALALILK  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +T+ PQ+GAPLI+  L
Sbjct  480  RFSFELSPSYVHAPYTVITLHPQFGAPLILRKL  512



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N G+SI  +I+EC LFY AGQETTS +LVWTMVLLSRFP WQ RAREEVL +F
Sbjct  303  QEHGNNKNMGISIRDVIEECKLFYIAGQETTSTLLVWTMVLLSRFPSWQDRAREEVLQIF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP F+GL  LKVVTMI YE LRLY P+    RK  ++T+LG + LP GV +S+PT+L
Sbjct  363  GNNKPGFDGLTQLKVVTMIFYEVLRLYPPLILFTRKVEKKTQLGNLSLPAGVEVSIPTIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H DTE+WGEDAK+FKPERF EG+ K T G+ +FFPF  GPRIC+GQNFA+VEAKMA+A+
Sbjct  423  VHRDTELWGEDAKDFKPERFAEGMSKVTKGQVSFFPFGWGPRICVGQNFAMVEAKMALAL  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            ILQRF+FELSPSYAHAP + LT+QPQYGA +I+H
Sbjct  483  ILQRFTFELSPSYAHAPLTILTLQPQYGAHIILH  516



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 173/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
               G  +N GMS+E +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQ RAREEVL VF
Sbjct  303  HAKGDNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KP F+GLN LK+VTMIL E LRLY P  G+ R    + KLG + LP GV + LPT+L
Sbjct  363  GNQKPSFDGLNRLKIVTMILNEVLRLYPPALGMNRLAKRDLKLGNITLPAGVQIFLPTVL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E WGEDAK+F PERF EG++KAT G+ +FFPF  GPRICIGQNF+L+EAKMA++M
Sbjct  423  VHHDCEFWGEDAKQFNPERFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSP+YAHAP   +T+QPQYGA +I+H +
Sbjct  483  ILQHFSFELSPAYAHAPAMLITLQPQYGAHIILHKV  518



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++  GM+  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ  AREEVL VFG+ K
Sbjct  303  GSKEFGMTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVLAREEVLQVFGNDK  362

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGLN LK+VTMILYE+LRL+ P+    R+T EE KLGE+ LP GV+L +P +L+H D
Sbjct  363  PDLEGLNRLKIVTMILYETLRLFPPLPVFGRRTKEEVKLGELNLPDGVVLLIPAVLVHYD  422

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KATNG+ ++ PF GGPRICIGQNFA++EAK A+ MILQR
Sbjct  423  KEIWGEDAKEFKPERFSEGVSKATNGQVSYIPFGGGPRICIGQNFAMLEAKTAITMILQR  482

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  483  FSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  514



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   310 bits (795),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  G++  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ RAREEVL VFG+ K
Sbjct  314  GRKEFGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDK  373

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGL+ LK+VTMILYE+LRL+ P+    R+  EE KLG++ LP GVLL +P +L+H D
Sbjct  374  PDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGKLHLPAGVLLIIPAILVHYD  433

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF+EG+ KATNG+ +F PFS GPR+CIGQNFA++EAKMA+AMILQ+
Sbjct  434  KEIWGEDAKEFKPERFKEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVAMILQK  493

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  494  FSFELSPSYTHAPFAIVTIHPQYGAPLLMRRL  525



>gb|AGX93056.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Lonicera japonica]
Length=519

 Score =   310 bits (795),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             +N G+SIE+II EC LFYFAGQ+TTS +L WTMV+LSRFPDWQARAREEVL VFGD KP
Sbjct  309  NKNAGLSIEEIIGECKLFYFAGQDTTSTLLCWTMVILSRFPDWQARAREEVLQVFGDGKP  368

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D++G+N LK VTMILYE LRLY PV  L +   E+TKLG++ +P GV + LPT+L+H + 
Sbjct  369  DYDGINRLKTVTMILYEVLRLYPPVVELTKVAHEDTKLGDLTIPAGVQVMLPTILLHHNP  428

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            +IWGED  EFKPERF +G++KAT  + +FFPFS GPR+CIGQNFAL+EAKMA+A+IL RF
Sbjct  429  DIWGEDVDEFKPERFAQGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAKMALALILPRF  488

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY HAPY+ +T+QPQ+GA LI+H +
Sbjct  489  SFELSPSYVHAPYTLITMQPQFGAHLILHKI  519



>ref|XP_006299550.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
 gb|EOA32448.1| hypothetical protein CARUB_v10015724mg [Capsella rubella]
Length=512

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTKGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+ MILYE LRLY PV  L R   +E KLG++ LP GV +SLP LLI  
Sbjct  360  EPDTEGLNQLKVMNMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVHISLPILLIQH  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF  GPRICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTELWGNDAAEFKPERFKDGLSKATKSQVSFFPFGWGPRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFE+SPSY HAPY+ +T+ PQ+GAPLI+H L
Sbjct  480  KFSFEISPSYLHAPYTIITVHPQFGAPLILHKL  512



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G+++ GM+  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ RAREEVL VFG+ K
Sbjct  315  GSKDFGMTTVEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRAREEVLQVFGNDK  374

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGL  LK+VTMILYE+LRL+ P+    R   EE KLGE+ LP GV+L +P +L+H D
Sbjct  375  PDLEGLGRLKIVTMILYETLRLFPPLPTFGRTNKEEVKLGELNLPAGVILIVPAILVHYD  434

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KAT G+ +F PF GGPRICIGQNFA++EAKMA+AMILQR
Sbjct  435  KEIWGEDAKEFKPERFSEGVSKATKGQFSFIPFGGGPRICIGQNFAMMEAKMALAMILQR  494

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  495  FSFELSPSYTHAPFAVVTIHPQYGAPLLMRKL  526



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFY AGQETTSV+LVWTMVLLS  PDWQARAREEVL  FG KKPDF
Sbjct  301  NAGMSLHDVIEECKLFYIAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSKKPDF  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  L RK  +ETKLG++ LP GV +S+PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVVVLARKVPKETKLGKLTLPAGVQVSMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRIC+GQNFA++EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFTEGVSKATKNQVSFFPFGWGPRICVGQNFAMMEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELS SYAH+P +K+T+QPQYG  +I+H 
Sbjct  481  ELSASYAHSPLTKITLQPQYGVQVILHK  508



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
             ++N GMS+E +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREE   VFG +K
Sbjct  307  NSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL+ LK+VTMILYE LRLY P+ G+ R   ++ KLG + LP GV + LPT+LIH D
Sbjct  367  PDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            +E+WGEDAK+F PERF EG++KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ 
Sbjct  427  SELWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQN  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSP+YAHAP   +T QPQYGA +I+  +
Sbjct  487  FLFELSPAYAHAPTMSITTQPQYGAHIILRKV  518



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
               G  +N GMS+E +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQ RAREEVL VF
Sbjct  303  HAKGDNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQERAREEVLQVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KP F+GLN LK+VTMIL E LRLY P  G+ R    + KLG ++LP GV + LPT+L
Sbjct  363  GNQKPSFDGLNRLKIVTMILNEVLRLYPPALGMNRLAKRDLKLGNIILPAGVQIFLPTVL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H + E WGEDAK+F PERF EG++KAT G+ +FFPF  GPRICIGQNF+L+EAKMA++M
Sbjct  423  VHHNCEFWGEDAKQFNPERFSEGVLKATKGRVSFFPFGWGPRICIGQNFSLLEAKMALSM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSP+YAHAP   +T+QPQYGA +I+H +
Sbjct  483  ILQHFSFELSPAYAHAPAMLITLQPQYGAHIILHKV  518



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
             ++N GMS+E +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQARAREE   VFG +K
Sbjct  307  NSKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARAREEAFQVFGYQK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL+ LK+VTMILYE LRLY P+ G+ R   ++ KLG + LP GV + LPT+LIH D
Sbjct  367  PDFDGLSRLKIVTMILYEVLRLYPPLIGMNRLVEKDVKLGNLTLPAGVQVFLPTVLIHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            +E+WGEDAK+F PERF EG++KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++MILQ 
Sbjct  427  SELWGEDAKQFNPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSMILQN  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSP+YAHAP   +T QPQYGA +I+  +
Sbjct  487  FLFELSPAYAHAPTMSITTQPQYGAHIILRKV  518



>gb|AGX93060.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Tabernaemontana 
elegans]
Length=519

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 176/213 (83%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GM+IEQII EC LFYFAGQ+TTS +LVWTMVLLSRFP+WQ RAREEVL VFG+K
Sbjct  307  GNNKNAGMTIEQIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQNRAREEVLQVFGNK  366

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD++G++ LK VTMILYE LR+Y+PVA L +   E+T+LG+  +P GV L +P +L+H 
Sbjct  367  TPDYDGISHLKTVTMILYEVLRIYTPVAELTKVAHEDTQLGKYFIPAGVQLMMPQMLLHH  426

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D +IWGED  EFKPERF EG++KAT  + ++FPFS GPR+CIGQNFAL+EAKMAMA+IL 
Sbjct  427  DPQIWGEDVMEFKPERFSEGVLKATKSQGSYFPFSLGPRMCIGQNFALLEAKMAMALILC  486

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP++ +T+QPQYGA LI+H L
Sbjct  487  RFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  519



>ref|XP_009116708.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Brassica rapa]
Length=508

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G     GMS E +I+EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAREEV  VFGDK
Sbjct  296  GQDEGNGMSTEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFGDK  355

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD EGLN LKV+TMILYE LRLY PVA LIR   +E K+G++ LP GV ++LP LL+  
Sbjct  356  KPDAEGLNQLKVMTMILYEVLRLYPPVAQLIRAVHKEMKVGDLTLPGGVHINLPILLVQR  415

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF++G+ KAT  + ++FPFS GPRICIGQ+FAL+EAKMAMA+ILQ
Sbjct  416  DTELWGQDAGEFKPERFKDGLSKATKNQVSYFPFSWGPRICIGQSFALLEAKMAMALILQ  475

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA L +H L
Sbjct  476  RFSFELSPSYVHAPYTVMTIHPQFGAHLTLHKL  508



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G+++ GM+  ++IDEC  FYFAGQETT+V+LVWTM+LL   P+WQARAREE L VFG++K
Sbjct  306  GSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+ EGL+ LK+VTMIL+E+LRL+ PV    R+   E KLGE+ LP GVLL +P +LIH D
Sbjct  366  PNLEGLSRLKIVTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPAGVLLVIPAILIHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDAKEFKPERF EG+ KAT G+ +F PF+GGPR+CIGQNFA++EAK+ +AMILQ+
Sbjct  426  KELWGEDAKEFKPERFSEGVSKATKGRISFIPFTGGPRVCIGQNFAMMEAKIGIAMILQK  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP++ +TI PQYGAPL+M  L
Sbjct  486  FSFELSPSYAHAPFATITIHPQYGAPLLMRKL  517



>emb|CDP19603.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 171/213 (80%), Gaps = 1/213 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+ E+I+DEC LFY AGQETTS +LVWTMVLL R+P+WQARAREEVL  FG K 
Sbjct  199  GNKDFGMTTEEIVDECKLFYLAGQETTSALLVWTMVLLCRYPEWQARAREEVLQQFGAKD  258

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDFEGLN LK+VTMIL+E LRLY PVA + R+T +ETKLG + LP GV ++LP +L+H D
Sbjct  259  PDFEGLNHLKIVTMILHEVLRLYPPVAIMSRRTTQETKLGNLTLPAGVQITLPIMLMHHD  318

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGED KEFKPERF EG+  AT G+ A+FPF  GPRICIGQNFA++EAK+AM+MILQR
Sbjct  319  LDIWGEDVKEFKPERFAEGVSHATKGQVAYFPFGWGPRICIGQNFAMLEAKLAMSMILQR  378

Query  223  FSFELSPSYAHAPYSKLT-IQPQYGAPLIMHNL  128
            FS ELSPSY HAP +    +QPQYGA LI+  +
Sbjct  379  FSLELSPSYTHAPGTATALVQPQYGAHLILQKI  411



>ref|XP_010502020.1| PREDICTED: cytochrome P450 72A13 isoform X2 [Camelina sativa]
Length=513

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GM+ E++++EC LFYFAGQETT+V+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  301  GQKKGNGMTTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  360

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  361  EPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPSGVQISLPILLVQR  420

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  421  DTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  480

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP++ +TI PQ+GAPLI+H L
Sbjct  481  KFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>ref|NP_188083.1| cytochrome P450, family 72, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
 sp|Q9LUC9.1|C7A11_ARATH RecName: Full=Cytochrome P450 72A11 [Arabidopsis thaliana]
 dbj|BAB02397.1| cytochrome P450 [Arabidopsis thaliana]
 dbj|BAF00623.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE75551.1| cytochrome P450, family 72, subfamily A, polypeptide 11 [Arabidopsis 
thaliana]
Length=512

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E +++EC LFYF GQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTKGNGMSTEDLMEECKLFYFVGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY P+  L R   +E +LG++ LP GVL++LP LL+  
Sbjct  360  EPDAEGLNQLKVMTMILYEVLRLYPPIPQLSRAIHKEMELGDLTLPGGVLINLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKP+RF++G+ KAT  + +FFPF+ G RICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTELWGNDAGEFKPDRFKDGLSKATKNQASFFPFAWGSRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+  TI PQ+GAPLIMH L
Sbjct  480  RFSFELSPSYVHAPYTVFTIHPQFGAPLIMHKL  512



>ref|XP_010502013.1| PREDICTED: cytochrome P450 72A13 isoform X1 [Camelina sativa]
Length=519

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GM+ E++++EC LFYFAGQETT+V+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  307  GQKKGNGMTTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  366

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  367  EPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPSGVQISLPILLVQR  426

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  427  DTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  486

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP++ +TI PQ+GAPLI+H L
Sbjct  487  KFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  519



>gb|KFK38821.1| hypothetical protein AALP_AA3G164800 [Arabis alpina]
Length=512

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSIE +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQAKGNGMSIEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVRQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY  V  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  EPDTEGLNQLKVMTMILYEVLRLYPAVTQLARAVNKEMKLGDLTLPAGVQISLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + ++FPF+ GPRICIGQNFAL EAKMAM++ILQ
Sbjct  420  DTELWGNDAAEFKPERFKDGLSKATKNQVSYFPFAWGPRICIGQNFALSEAKMAMSLILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP++ +TI P++GAPLI+H L
Sbjct  480  RFSFELSPSYVHAPFTVITIHPEFGAPLILHKL  512



>ref|XP_010487266.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GM+ E++++EC LFYFAGQETT+V+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  301  GQKKGNGMTTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  360

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  361  EPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPSGVQISLPILLVQR  420

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  421  DTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  480

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP++ +TI PQ+GAPLI+H L
Sbjct  481  KFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G ++N GMS+E +I+EC LFYFAGQETTS +LVWTMVLLSR+PDWQARAREEVL VFG +
Sbjct  304  GNSKNVGMSLEDVIEECKLFYFAGQETTSALLVWTMVLLSRYPDWQARAREEVLQVFGKQ  363

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KP+F+GL+ LK+V+MIL E LRLY P  GL R    + KLG + LP GV +SLPT ++H 
Sbjct  364  KPNFDGLSHLKIVSMILNEVLRLYPPAVGLNRNVDRDMKLGNLSLPAGVQVSLPTTMVHH  423

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WG+D  EFKPERF EG++KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++ ILQ
Sbjct  424  DRELWGDDVNEFKPERFSEGVLKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSTILQ  483

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSP+YAHAP +  T+QPQYGA +I+  +
Sbjct  484  HFSFELSPAYAHAPVTVFTLQPQYGAHVILRKV  516



>ref|XP_009146334.1| PREDICTED: cytochrome P450 72A15 [Brassica rapa]
Length=512

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E +I+EC LFYFAGQETTSV+LVWTMVLLS+  DWQA+AREEV  VFGDK
Sbjct  300  GQVKGNGMSNEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD +GLN LKV+TMILYE LRLY PV  + R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  VPDIDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQH  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF+EG+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTELWGNDAAEFKPERFKEGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA LI+H L
Sbjct  480  RFSFELSPSYVHAPYTVITIHPQFGAHLILHKL  512



>ref|XP_002882888.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59147.1| CYP72A15 [Arabidopsis lyrata subsp. lyrata]
Length=512

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
            T   GMS E +++EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV  VFGDK+P
Sbjct  302  TEGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEP  361

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D EGLN LKV++MILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  DT
Sbjct  362  DAEGLNQLKVMSMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQRDT  421

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            E+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+IL+RF
Sbjct  422  ELWGNDAAEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILKRF  481

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY HAPY+ +TI PQ+GA LIMH L
Sbjct  482  SFELSPSYVHAPYTVITIHPQFGAQLIMHKL  512



>emb|CDX97591.1| BnaA05g24880D [Brassica napus]
Length=495

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +   MS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAR+EV  VFGDK
Sbjct  283  GQAKGNEMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARARDEVKQVFGDK  342

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PVA L R   +E KLG++ LP G  +SLP LL+H 
Sbjct  343  EPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPGGAQISLPILLVHR  402

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WGEDA EFKPERF++G+ KATNGK +FFPF+ GPRICIGQ+FAL+E KMA+A+IL+
Sbjct  403  DTQLWGEDAAEFKPERFKDGVSKATNGKVSFFPFAWGPRICIGQSFALLETKMALALILK  462

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSF LSPSY HAPY+ +T+ PQ+GAPLI+  L
Sbjct  463  RFSFGLSPSYVHAPYTVITLHPQFGAPLILRKL  495



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G+++ GM+  ++IDEC  FYFAGQETT+V+LVWTM+LL   P+WQARAREE L VFG++K
Sbjct  306  GSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQARAREEALQVFGNEK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+ EGL+ LK+VT+IL+E+LRL+ PVA   R+   E KLGE+ LP GVLL +PT+LIH D
Sbjct  366  PNLEGLSRLKIVTIILHETLRLFPPVATYRRRNKHEVKLGELSLPAGVLLFIPTVLIHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDA EFKPERF EG+ KAT G  +F PFSGGPR+CIGQNFA++EAK+A+AMILQ+
Sbjct  426  KELWGEDANEFKPERFSEGVSKATKGHFSFIPFSGGPRVCIGQNFAMMEAKLAIAMILQK  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +TI PQYGAPL+M  L
Sbjct  486  FSFELSPSYTHAPSSTITIHPQYGAPLLMRKL  517



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E++++EC LFYFAGQETT+V+LVWTMVLLS+  DWQARAREEV  VFG K
Sbjct  301  GQEKGNGMSTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGAK  360

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG+M LP GV +SLP LL+  
Sbjct  361  EPDTEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDMTLPSGVQISLPILLVQR  420

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  421  DTELWGNDAGEFKPERFKDGVSKATKNQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  480

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP++ +TI PQ+GAPLI+H L
Sbjct  481  KFSFELSPSYVHAPHTVITIHPQFGAPLILHKL  513



>emb|CDY32349.1| BnaC01g36680D [Brassica napus]
Length=508

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G     GMS E +++EC LF+FAGQETTSV+LVWTMV+LS+  DWQARAREEV  VFGDK
Sbjct  296  GQDEGNGMSTEDVMEECKLFFFAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFGDK  355

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD EGLN LKV+TMILYE LRLY PVA LIR   +E K+G++ LP GV +SLP LL+  
Sbjct  356  KPDAEGLNQLKVMTMILYEVLRLYPPVAQLIRAVHKEMKVGDLTLPGGVQISLPILLVQR  415

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF++G+ KAT  + ++FPFS GPRICIGQ+FAL+EAKMAMA+ILQ
Sbjct  416  DTELWGQDAGEFKPERFKDGLSKATKNQVSYFPFSWGPRICIGQSFALLEAKMAMALILQ  475

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA L +H L
Sbjct  476  RFSFELSPSYVHAPYTVMTIHPQFGAHLTLHKL  508



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   307 bits (787),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GM++  +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQ+RAREEVL VF
Sbjct  279  QEHRNNKNVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVF  338

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G + P+F+GL+ LK+VTMILYE LRLY P  GL R    + KLG + LP GV +SLP ++
Sbjct  339  GKQAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIM  398

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEF PERF EG+ KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++M
Sbjct  399  VHHDRELWGDDAKEFNPERFSEGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSM  458

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSP+Y HAP++ +T+QPQYGA +I+  +
Sbjct  459  ILQHFSFELSPAYTHAPFTVITLQPQYGAHVILRKV  494



>emb|CDY20076.1| BnaA01g29260D [Brassica napus]
Length=486

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G     GMS E +I+EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAREEV  VFGDK
Sbjct  274  GQDEGNGMSTEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFGDK  333

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            K D EGLN LKV+TMILYE LRLY PVA LIR   +E K+G++ LP GV ++LP LL+  
Sbjct  334  KADAEGLNQLKVMTMILYEVLRLYPPVAQLIRAVHKEMKVGDLTLPGGVHINLPILLVQR  393

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF++G+ KAT  + ++FPFS GPRICIGQ+FAL+EAKMAMA+ILQ
Sbjct  394  DTELWGQDAGEFKPERFKDGLSKATKNQVSYFPFSWGPRICIGQSFALLEAKMAMALILQ  453

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA L +H L
Sbjct  454  RFSFELSPSYVHAPYTVMTIHPQFGAHLTLHKL  486



>emb|CDX97592.1| BnaA05g24870D [Brassica napus]
Length=512

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E +I+EC LFYFAGQETTSV+LVWTMVLLS+  DWQA+AREEV  VFGDK
Sbjct  300  GQVKGNGMSTEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD +GLN LKV+TMILYE LRLY PV  + R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  VPDIDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQH  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF+EG+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTELWGDDASEFKPERFKEGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQYGA LI+  +
Sbjct  480  RFSFELSPSYVHAPYTVITIHPQYGAHLILKKI  512



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
             ++N GM+I+++IDEC LFYFAGQETTS +LVWTMV+LS  PDWQ +AREEVL VFG K 
Sbjct  307  NSKNFGMTIDEVIDECKLFYFAGQETTSTLLVWTMVVLSMHPDWQEKAREEVLQVFGGKD  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMILYE LRLY P   + R T +  KLGE+ LP GV L++PTLL+H D
Sbjct  367  PDFDGLNHLKIVTMILYEVLRLYPPAVLMARGTYKTMKLGEITLPAGVHLAMPTLLVHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDA++F PERF  G+ KAT  + +FFPFS GPRICIGQNFAL+E+KMA+AMILQR
Sbjct  427  RELWGEDAEDFNPERFSGGVSKATKNQVSFFPFSWGPRICIGQNFALLESKMAIAMILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELS +Y HAPY+ +T+QPQ+GA LI+H L
Sbjct  487  FSFELSSTYVHAPYTVITLQPQHGAQLILHKL  518



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I  +I+EC LFYFAGQETTSVMLVWTMVLLSR P+WQARAREEVL  FG+ K
Sbjct  307  GNKDFGMTIGDVIEECKLFYFAGQETTSVMLVWTMVLLSRHPNWQARAREEVLQHFGNNK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMIL+E LRLY PV  + R+T E+ +LG + LP  V +SLP +L+H D
Sbjct  367  PDFKGLNHLKLVTMILHEVLRLYPPVPAIPRRTDEDIQLGNLTLPAQVQVSLPAILLHYD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+D +EFKPERF +G+  AT G+ A+FPF  GPRICIGQNFA++EAK+A+AM+LQR
Sbjct  427  PEIWGDDVEEFKPERFADGVSNATKGQTAYFPFGWGPRICIGQNFAMLEAKLAVAMLLQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP + +TIQPQYGA LI+H L
Sbjct  487  FSFELSPSYTHAPRAVITIQPQYGARLILHKL  518



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   308 bits (788),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAGQETTSV+L+W++VLLSR+ DWQARAREE+L VFG +K
Sbjct  302  GNKDFGMSIEEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRK  361

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMILYESLRLY  +  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  362  PDFDGLNHLKIVTMILYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHD  421

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERFREGI  AT G+  +FPFS GPRICIGQNFA++EAKMA++MILQR
Sbjct  422  EEIWGEDAKEFKPERFREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQR  481

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP S +T+QPQYGAPLI H L
Sbjct  482  FSFELSPSYAHAPRSIITVQPQYGAPLIFHKL  513



>ref|XP_010542332.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=509

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G ++  GMS+E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV+ V G
Sbjct  295  NSGQSKGNGMSLEEVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVMQVLG  354

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DKKPD + LN LKV+TMI YE LRLY PV  L R   +E KLG++ LP GV LSLP +LI
Sbjct  355  DKKPDMDSLNQLKVITMIFYEVLRLYPPVVQLNRAVHKEQKLGDLTLPSGVHLSLPIMLI  414

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
              DTE+WG DA EFKPERF++GI KAT  + +F PF  GPRICIGQNFAL+EAKMA+A+I
Sbjct  415  QRDTELWGSDAGEFKPERFKDGISKATRNQVSFLPFGWGPRICIGQNFALIEAKMALALI  474

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSP+Y HAPY+ +TI PQ+GA L++H L
Sbjct  475  LQRFSFELSPTYIHAPYTVVTIHPQFGAHLVLHKL  509



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   308 bits (788),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 181/212 (85%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAGQETTSV+L+W++VLLSR+ DWQARAREE+L VFG +K
Sbjct  308  GNKDFGMSIEEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQARAREEILQVFGSRK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LK+VTMILYESLRLY  +  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  368  PDFDGLNHLKIVTMILYESLRLYPSLITLTRRCNEDIVLGELSLPAGVLVSLPLILLHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERFREGI  AT G+  +FPFS GPRICIGQNFA++EAKMA++MILQR
Sbjct  428  EEIWGEDAKEFKPERFREGISSATKGQLTYFPFSWGPRICIGQNFAMLEAKMALSMILQR  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP S +T+QPQYGAPLI H L
Sbjct  488  FSFELSPSYAHAPRSIITVQPQYGAPLIFHKL  519



>ref|XP_010248211.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nelumbo nucifera]
Length=425

 Score =   305 bits (780),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N G+SIE++I+EC LFYFAGQETT+ +LVWTMV+LS  P+WQ RAREEVL  FG  
Sbjct  213  GSGKNLGLSIEEVIEECKLFYFAGQETTANLLVWTMVVLSMHPEWQIRAREEVLQAFGKN  272

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GLN LK+VTM+LYE LRLY P+  + R T ++ KLG++ LPPGV L LPT+L+H 
Sbjct  273  KPDFDGLNHLKIVTMVLYEVLRLYPPIFIITRYTYKKMKLGDVYLPPGVQLLLPTILVHH  332

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
              ++WGEDA+EFKPERF  G+ KAT  + +FFPF  GPRICIGQNFA++EAKMA+ +ILQ
Sbjct  333  SKQLWGEDAQEFKPERFSGGVSKATKNQVSFFPFGWGPRICIGQNFAMMEAKMALTLILQ  392

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSPSYAHAPY+ +TIQPQYGA +I+H L
Sbjct  393  HFSFELSPSYAHAPYTVITIQPQYGAQIILHKL  425



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   307 bits (787),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 175/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFYFAGQETTS +L+WTMVLLS+  +WQARAREEVL VF
Sbjct  300  QEHDERKNVGMSIKDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSNWQARAREEVLQVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VT+I +E LRLY PV+ LIR  V ++++G    P G L++LP LL
Sbjct  360  GNKKPDGDGLNHLKIVTIIFHEVLRLYPPVSMLIRTVVADSQVGGWYFPDGALITLPILL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH D EIWGEDAKEF PERF EG+ KAT G+ AF+PF  GPR+CIGQNFA++EAKMA+AM
Sbjct  420  IHHDHEIWGEDAKEFNPERFSEGVSKATKGQFAFYPFGYGPRVCIGQNFAMMEAKMALAM  479

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP + +TIQPQYGA LI+H L
Sbjct  480  ILQRFSFELSPSYAHAPSNIITIQPQYGAYLILHGL  515



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 178/216 (82%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  GG ++ GMSI++II+EC LFYFAG ETTSV L+WT+VLLSR+ DWQA+AREEVL VF
Sbjct  299  EQQGGNKDFGMSIDEIIEECKLFYFAGSETTSVWLLWTLVLLSRYQDWQAQAREEVLQVF  358

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G +KPDF GLN LKVVTMILYESLRLYSPV  L R  +E+  LGE+ LP GVL+SLPT++
Sbjct  359  GSRKPDFNGLNRLKVVTMILYESLRLYSPVTTLTRLAIEDITLGEVSLPAGVLVSLPTVI  418

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDA +F PERFREGI  AT G+  +FPFS GPRICIGQNFA++EAKMA++M
Sbjct  419  LHHDKEIWGEDANKFNPERFREGISSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALSM  478

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSPSY HAP   +T+QPQYGAPLI H L
Sbjct  479  ILQTFSFELSPSYTHAPQYSVTVQPQYGAPLIFHKL  514



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G  + G++  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ RAR+EVL +FG+ K
Sbjct  305  GRNDLGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGL+ LK+VTMILYE+LRL+ P+    R+  EE KLGE+ LP GVLL +P +L+H D
Sbjct  365  PDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KATNG+ +F PFS GPR+CIGQNFA++EAKMA+ MILQ+
Sbjct  425  KEIWGEDAKEFKPERFSEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQK  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  485  FSFELSPSYTHAPFAIVTIHPQYGAPLLMRRL  516



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G  + G++  ++I+EC LFYFAGQETTSV+LVWTM+LL   P+WQ RAR+EVL +FG+ K
Sbjct  305  GRNDFGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVRARKEVLQIFGNDK  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGL+ LK+VTMILYE+LRL+ P+    R+  EE KLGE+ LP GVLL +P +L+H D
Sbjct  365  PDLEGLSRLKIVTMILYETLRLFPPLPAFGRRNKEEVKLGELHLPAGVLLVIPAILVHYD  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KATNG+ +F PFS GPR+CIGQNFA++EAKMA+ MILQ+
Sbjct  425  KEIWGEDAKEFKPERFSEGVSKATNGQVSFIPFSWGPRVCIGQNFAMMEAKMAVTMILQK  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP++ +TI PQYGAPL+M  L
Sbjct  485  FSFELSPSYTHAPFAIVTIHPQYGAPLLMRRL  516



>gb|AGX93057.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Cinchona calisaya]
Length=519

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GMSIE+II EC LFYFAGQ+TTS ++VWTMVLLSRFP+WQ  AREEVL VFGD+
Sbjct  307  GNNKSAGMSIEEIIGECKLFYFAGQDTTSTLIVWTMVLLSRFPEWQQHAREEVLQVFGDR  366

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD++G++ LK+VTMILYE LR+Y+PV+ L +   E+T+LG+  +P GV L +P +L+H 
Sbjct  367  KPDYDGISRLKIVTMILYEVLRIYTPVSELTKVAHEDTQLGKYFIPAGVQLMMPQILLHH  426

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D EIWG+D  EFKP+RF EG++KAT  + ++FPFS GPR+CIGQNFAL+EAKMAMA+IL+
Sbjct  427  DPEIWGDDVMEFKPQRFSEGVLKATKSQGSYFPFSLGPRMCIGQNFALLEAKMAMALILR  486

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP++ +T+QPQYGA LI+H L
Sbjct  487  RFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  519



>emb|CDX98485.1| BnaC05g38900D [Brassica napus]
Length=512

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E +I+EC LFYFAGQETTSV+LVWTMVLLS+  DWQA+AREEV  VFG K
Sbjct  300  GQVKGNGMSNEDVIEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAKAREEVKQVFGHK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD +GLN LKV+TMILYE LRLY PV  + R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  IPDTDGLNQLKVMTMILYEVLRLYPPVTQVSRAIHKEMKLGDLTLPGGVQISLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERFREG+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTELWGDDAGEFKPERFREGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA LI+H L
Sbjct  480  RFSFELSPSYVHAPYTVITIHPQFGAHLILHKL  512



>ref|NP_188086.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis 
thaliana]
 sp|Q9LUC6.1|C7A14_ARATH RecName: Full=Cytochrome P450 72A14 [Arabidopsis thaliana]
 gb|AAK32934.1|AF367347_1 AT3g14680/MIE1_18 [Arabidopsis thaliana]
 dbj|BAB02400.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAN46762.1| At3g14680/MIE1_18 [Arabidopsis thaliana]
 gb|AEE75555.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis 
thaliana]
Length=512

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T   GMS E +++EC LFY AGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTEGNGMSTEDMMEECKLFYLAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+H 
Sbjct  360  QPDTEGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGVQISLPVLLVHR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNF L+EAKMAM++ILQ
Sbjct  420  DTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQNFTLLEAKMAMSLILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +T+ PQ+GA L++H L
Sbjct  480  RFSFELSPSYVHAPYTIITLYPQFGAHLMLHKL  512



>ref|XP_006407055.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
 dbj|BAJ33634.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48508.1| hypothetical protein EUTSA_v10020534mg [Eutrema salsugineum]
Length=512

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQAKGNGMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMI YE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  EPDTEGLNQLKVMTMIFYEVLRLYPPVNQLTRAIHKEMKLGDLTLPGGVQISLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF+EGI KAT  + +FFPF  GPRICIGQNFAL+EAKMAMA+IL 
Sbjct  420  DTELWGKDAAEFKPERFQEGISKATKSQVSFFPFGWGPRICIGQNFALLEAKMAMALILH  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFS ELSPSY HAPY+  TI PQ+GA LI+H L
Sbjct  480  RFSLELSPSYVHAPYTVFTIHPQFGAHLILHKL  512



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 170/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ G+SIE++I+EC LFYFAGQETTS +LVWT++LL R  DWQ RAR EVL VFG +K
Sbjct  308  GDKDFGLSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTRARTEVLQVFGSRK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL  LKVVTMILYESLRLY PV  + R+  E+  LG++ LP  VLLSLP +L+H D
Sbjct  368  PDFDGLTHLKVVTMILYESLRLYPPVTTVTRRLNEDAVLGDISLPADVLLSLPAVLLHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAK+F PERFREG+  AT G+  FFPF+ GPRICIGQNFA++EAKM +AMILQR
Sbjct  428  EEIWGEDAKKFNPERFREGVSSATKGQVTFFPFTWGPRICIGQNFAMLEAKMVLAMILQR  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FS +LS SY HA +S +T QPQYGAPLI+H L
Sbjct  488  FSLDLSTSYTHALHSVITTQPQYGAPLILHKL  519



>emb|CDP14358.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 169/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I+++IDEC LFYFAGQETTS++LVWTM+LLSR+P WQARAREEVL  FG  K
Sbjct  167  GNKDFGMTIKEVIDECKLFYFAGQETTSLLLVWTMILLSRYPYWQARAREEVLQHFGTNK  226

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
             DFEGLN LK+VTMIL+E LRLY P A + R+   E +LG + LP  VLLSLPT+L+H D
Sbjct  227  LDFEGLNRLKLVTMILHEVLRLYPPAATIARRAAVEIQLGNLTLPAQVLLSLPTILLHHD  286

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG D +EFKPERF +G+  AT G+  FF F  GPRICIGQNF +VEAK+A+AM+LQR
Sbjct  287  PEIWGNDVEEFKPERFADGVSNATKGQVTFFTFGWGPRICIGQNFTMVEAKLAVAMVLQR  346

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP YAHAP   +TIQPQYGA LI+H L
Sbjct  347  FSFELSPFYAHAPREVITIQPQYGAHLILHKL  378



>emb|CDY65331.1| BnaC03g73770D, partial [Brassica napus]
Length=439

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV LVWTMV+LS+  DWQARAREEV  VFG
Sbjct  225  NSGQAKGNEMSIEDVMEECELFYFAGQETTSVFLVWTMVMLSQHQDWQARAREEVKQVFG  284

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+PD EGLN LKV+TMILYE LRLY P+  + R   +E KLG++ LP GV +SLPTLL+
Sbjct  285  DKEPDTEGLNQLKVMTMILYEVLRLYPPLPQMTRAIHKEMKLGDLTLPGGVQISLPTLLV  344

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG DA EFKP+RF++G+ KAT G+ +FFPF+ GPRICIGQNFA++EAKMA+A+I
Sbjct  345  HRDTQLWGSDAAEFKPKRFKDGVSKATMGQVSFFPFAWGPRICIGQNFAMMEAKMALALI  404

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSYA+APY  +T+ PQ+GA LI+H +
Sbjct  405  LQRFSFELSPSYAYAPYIVITLHPQFGAHLILHKI  439



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 173/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q      N GM++  +I+EC LFYFAGQETTSV+LVWTMVLLSR+PDWQ+RAREEVL VF
Sbjct  306  QEHRNNENVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSRAREEVLQVF  365

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G + P+F+GL+ LK+VTMILYE LRLY P  GL R    + KLG + LP GV +SLP ++
Sbjct  366  GKQAPNFDGLSHLKIVTMILYEVLRLYPPGIGLTRSVHRDMKLGNLTLPAGVQVSLPIIM  425

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEF PERF EG+ KATNG+ +FFPF  GPRICIGQNF+L+EAKMA++M
Sbjct  426  VHHDRELWGDDAKEFNPERFSEGVSKATNGRVSFFPFGWGPRICIGQNFSLLEAKMALSM  485

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSP+Y HAP++ +T+QPQYGA +I+  +
Sbjct  486  ILQHFSFELSPAYTHAPFTVITLQPQYGAHVILRKV  521



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  335  GQTKGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  394

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  395  EPDAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKEMKLGDLTLPGGVQISLPILLVQR  454

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  455  DTELWGKDAGEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  514

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAPY+ +TI PQ+GA LI+  L
Sbjct  515  KFSFELSPSYLHAPYTIITIHPQFGAQLILQKL  547



>ref|XP_009135392.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=328

 Score =   300 bits (767),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVWTMVLLS+  +WQARAREEV  VFG
Sbjct  99   NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQEWQARAREEVEQVFG  158

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+P+ EGLN LKV+TMILYE LRLY P   L R   +E KLG++ LP GV ++LP LL+
Sbjct  159  DKEPNTEGLNQLKVMTMILYEVLRLYPPAVQLTRAIHKEMKLGDLTLPGGVQINLPILLV  218

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H D ++WG+DA EFKPERF +G+ KAT G+ ++FPF  GPRICIGQNFAL+E KMA+A++
Sbjct  219  HRDIQLWGKDAAEFKPERFEDGVSKATKGQVSYFPFGWGPRICIGQNFALMETKMALALM  278

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSY HAPY+ LT+QPQ GA LI+H +
Sbjct  279  LQRFSFELSPSYVHAPYTVLTLQPQSGAHLILHKI  313



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GM+IE +I EC LFYFAGQETTS +LVWTM+LLS +PDWQ RAREEVL VF
Sbjct  306  QEHGNNKNVGMNIEDVIGECKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQVF  365

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KPDF+GLN LK+VTMIL E  RLY PV GL RK  ++ KLG + L  G+ +S+P +L
Sbjct  366  GNRKPDFDGLNHLKIVTMILNEVFRLYPPVIGLARKVSKDVKLGNLSLVAGMQVSIPIIL  425

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEFKPERF EG++KAT G+ +  PF GGPRICIGQNF+L+EAK+A++M
Sbjct  426  VHHDCELWGDDAKEFKPERFAEGVLKATKGRASLIPFGGGPRICIGQNFSLMEAKIALSM  485

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELS +Y HAP   +TIQPQYGA LI+  +
Sbjct  486  ILQRFSFELSSTYTHAPTPVITIQPQYGANLILRKV  521



>gb|AGX93062.1| CYP72A224 7-deoxyloganic acid 7-hydroxylase [Catharanthus roseus]
 gb|AHK60834.1| 7-deoxyloganic acid hydroxylase [Catharanthus roseus]
Length=521

 Score =   306 bits (783),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GM+I +II EC LFYFAGQ+TTS +LVWTMVLLSRFP+WQ RAREEV  VFG+K
Sbjct  309  GNNKSAGMTIGEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREEVFQVFGNK  368

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD++G++ LKV+TMILYE LRLY+PVA L +   E T+LG+  +P GV L +P +L+H 
Sbjct  369  TPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEATQLGKYFIPAGVQLMMPQILLHH  428

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D EIWGED  EFKPERF EG++KAT  + +FFPFS GPR+CIGQNFAL+EAKMAM++IL+
Sbjct  429  DPEIWGEDVMEFKPERFAEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAKMAMSLILR  488

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP++ +T+QPQYGA LI+H L
Sbjct  489  RFSFELSPSYVHAPFTLITMQPQYGAHLILHKL  521



>gb|KHG20903.1| Secologanin synthase [Gossypium arboreum]
Length=314

 Score =   299 bits (765),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            ++ GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL+R+PDWQ +AR+EVLHV GD+KPD
Sbjct  102  KHMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQTKARDEVLHVLGDRKPD  161

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
             +GLN LKVVTMILYE LRLY PV  L R   +E K+G ++LP G  + +P L IH D +
Sbjct  162  ADGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDKD  221

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
             WG+DA EF+PERF EG+ KAT  +  F PF  GPRICIGQNFA++E KMAMAMILQRF 
Sbjct  222  HWGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRFW  281

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELSPSYAH+P + +T++PQ+GA +I+H L
Sbjct  282  FELSPSYAHSPCTTMTLRPQHGAQIILHKL  311



>ref|XP_010487265.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=461

 Score =   303 bits (777),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  249  GEAKGNGMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  308

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LK +TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP +L+  
Sbjct  309  EPDTEGLNQLKAMTMILYEVLRLYPPVTHLTRAIHKEMKLGDLTLPGGVHISLPVMLVQR  368

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG DA EFKPERF++GI KAT  + +FFPF+ GPRICIGQNF L+EAKMAMA+IL 
Sbjct  369  DTKLWGNDAGEFKPERFKDGISKATKSQVSFFPFAWGPRICIGQNFTLMEAKMAMALILL  428

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA LI+H L
Sbjct  429  RFSFELSPSYVHAPYTVVTIHPQFGAHLILHRL  461



>ref|NP_188084.1| cytochrome P450, family 72, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
 sp|Q9LUC8.1|C7A13_ARATH RecName: Full=Cytochrome P450 72A13 [Arabidopsis thaliana]
 dbj|BAB02398.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAL57694.1| AT3g14660/MIE1_16 [Arabidopsis thaliana]
 gb|AAO22574.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75552.1| cytochrome P450, family 72, subfamily A, polypeptide 13 [Arabidopsis 
thaliana]
Length=512

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E++++EC LFYFAGQETT+V+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTKGNGMSTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E +LG++ LP GV +SLP LLI  
Sbjct  360  EPDAEGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMQLGDLTLPGGVQISLPILLIQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WG DA EFKP+RF++G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAM +IL+
Sbjct  420  DRELWGNDAGEFKPDRFKDGLSKATKNQVSFFPFAWGPRICIGQNFALLEAKMAMTLILR  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAPY+ LT  PQ+GAPLI+H L
Sbjct  480  KFSFELSPSYVHAPYTVLTTHPQFGAPLILHKL  512



>ref|XP_010275170.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   305 bits (781),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GM+I+ +I+EC LFYFAGQETT+ +LVWTMV+LS  P+WQ R+REEVL  F
Sbjct  302  QEHDNAKNLGMNIDDVIEECKLFYFAGQETTANLLVWTMVVLSMHPEWQIRSREEVLQAF  361

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G  KPDF+GLN LKVVTMILYE LRLY P   L R T ++ KLG + LPPGV L LPT+L
Sbjct  362  GKDKPDFDGLNHLKVVTMILYEVLRLYPPAVILTRHTYKKIKLGGIYLPPGVELLLPTIL  421

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH   E+WGEDA+EFKPERF  G+ KAT  + +FFPF  GPRICIGQNFA+ EAKMA+A+
Sbjct  422  IHHSRELWGEDAQEFKPERFSSGVSKATKNQVSFFPFGWGPRICIGQNFAMTEAKMALAL  481

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ+FSFELSPSYAHAPY+ +T+QPQYGA +I+H L
Sbjct  482  ILQQFSFELSPSYAHAPYTIITLQPQYGAQIILHKL  517



>ref|XP_010060780.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 ref|XP_010060781.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67645.1| hypothetical protein EUGRSUZ_F01392 [Eucalyptus grandis]
Length=510

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLRIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY P   L+R+ ++ETKLG++ +PPGV LS+PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPATDLVREVLKETKLGKLTIPPGVQLSMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            ELSPSYAHAP + +T+QP+YG  +I+ 
Sbjct  481  ELSPSYAHAPSNVITLQPRYGVQVILR  507



>emb|CDX98484.1| BnaC05g38910D [Brassica napus]
Length=512

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +   MS   +++EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAR+EV  VFGDK
Sbjct  300  GQAKGNEMSTADVMEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARARDEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PVA L R   +E KLG++ LP G  +SLP LL+H 
Sbjct  360  EPDTEGLNQLKVMTMILYEVLRLYPPVAQLTRAIHKEMKLGDLTLPRGAQISLPILLVHR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WGE+A EFKPERF++G+ KATNGK +FFPF+ GPRICIGQ+FAL+E KMA+A+IL+
Sbjct  420  DTQLWGEEAAEFKPERFKDGVSKATNGKVSFFPFAWGPRICIGQSFALLETKMALALILK  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +T+ PQ+GAPLI+  L
Sbjct  480  RFSFELSPSYVHAPYAVITLHPQFGAPLILRKL  512



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q        GMS + +IDEC LFY AGQETTSV+L+WTMVLLS+ PDWQARAREEVL VF
Sbjct  300  QEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+VTMI +E LRLY PV  L R   ++T++G+M  P GV +SLPT+L
Sbjct  360  GNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTIL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+DAKEF PERF EG+ KAT  + +F PF  GPR+CIGQNFA++EAK+A+AM
Sbjct  420  VHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAM  479

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAPYS +TIQPQYGA LI+  L
Sbjct  480  ILQRFSFELSPSYAHAPYSLITIQPQYGAHLILRGL  515



>gb|AGX93059.1| 7-deoxyloganic acid 7-hydroxylase-like protein [Rauvolfia serpentina]
Length=520

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GM+IE+II EC LFYFAGQ+TTS +LVWTMVLLSRFP+WQ RAREEV  VFG+K
Sbjct  308  GHNKTAGMTIEEIIGECKLFYFAGQDTTSTLLVWTMVLLSRFPEWQTRAREEVFQVFGNK  367

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
             PD++G++ LKV+TMILYE LRLY+PVA L +   E+T+LG+ ++P GV L +P +L+H 
Sbjct  368  TPDYDGISHLKVITMILYEVLRLYTPVAELTKVAHEDTQLGKYLIPAGVQLMMPQVLLHH  427

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D EIWGED  EFKPERF EG++KAT  + +FFPFS GPR+CIGQNFAL+EAKMAM +IL+
Sbjct  428  DPEIWGEDVMEFKPERFAEGVLKATKSQGSFFPFSLGPRMCIGQNFALLEAKMAMTLILR  487

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELS SY HAP++ +T+QPQYGA LI+H L
Sbjct  488  RFSFELSLSYVHAPFTLITMQPQYGAHLILHKL  520



>emb|CBI39912.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +   MS++ +I+EC LFY AGQETTSV+LVWTMVLLS  P+WQARAREEVL VF
Sbjct  223  QEHQNNKKIRMSVKDVIEECKLFYLAGQETTSVLLVWTMVLLSEHPNWQARAREEVLQVF  282

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKP+  GLN LK+VTMI +E LRLY PVA L R   ++T++G+M  P GV + LPT+L
Sbjct  283  GNKKPEAAGLNHLKIVTMIFHEVLRLYPPVAMLARAVYKDTQVGDMCFPAGVQVVLPTIL  342

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+DAKEF PERF EG++KAT  + +FFPF  GPR+CIGQNFA++EAK+A+AM
Sbjct  343  VHHDHEIWGDDAKEFNPERFAEGVLKATKNQVSFFPFGWGPRVCIGQNFAMMEAKIALAM  402

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSPSYAHAP+S LT+QPQYGA LI+  L
Sbjct  403  ILQHFSFELSPSYAHAPFSILTMQPQYGAHLILRGL  438



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ G++  ++I+EC LFYFAGQETTSV+LVWTMVLL   P+WQ RAREEVL VFG++K
Sbjct  306  GNKDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMVLLCLHPEWQVRAREEVLQVFGNEK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD EGL+ LK+VTMILYE+LRL+ P+    R+  EE KLGE+ LP  V+L +P + IH D
Sbjct  366  PDLEGLSHLKIVTMILYETLRLFPPLPVFSRRNKEEVKLGELQLPAEVILIIPAIFIHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDAKEFKPERF EG+ KAT G+ +F PF  GPRICIGQNFA++EAKMA+AMILQ+
Sbjct  426  KEIWGEDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQK  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIM  137
            FSFELSPSY HAP++ +TI PQYGAPL++
Sbjct  486  FSFELSPSYTHAPFATITIHPQYGAPLLL  514



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMSI+ +IDEC +FYFAGQETTSV+L+WTMVLLS+ P+WQARAREEVLHVF
Sbjct  303  QEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+V MIL+E LRLY PV  L R   E+ ++G+M LP GV +SLPT+L
Sbjct  363  GNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDA+EF PERF +G +KAT    +FFPF  G R+CIGQNFA++EAKM +AM
Sbjct  423  VHHDHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF LSPSY+HAP S +T++PQYGA LI+H +
Sbjct  483  ILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|NP_188087.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
 sp|Q9LUC5.1|C7A15_ARATH RecName: Full=Cytochrome P450 72A15 [Arabidopsis thaliana]
 dbj|BAB02401.1| cytochrome P450 [Arabidopsis thaliana]
 gb|AAK92762.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM20382.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE75556.1| cytochrome P450, family 72, subfamily A, polypeptide 15 [Arabidopsis 
thaliana]
Length=512

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
            T   GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK+P
Sbjct  302  TEGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDKEP  361

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP LL+  D 
Sbjct  362  DAEGLNQLKVMTMILYEVLRLYPPVTQLTRAIHKELKLGDLTLPGGVQISLPILLVQHDI  421

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            E+WG DA EF P+RF++G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+IL+RF
Sbjct  422  ELWGNDAAEFNPDRFKDGLSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILRRF  481

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFE+SPSY HAPY+ +TI PQ+GA LIMH L
Sbjct  482  SFEISPSYVHAPYTVITIHPQFGAQLIMHKL  512



>emb|CDX75787.1| BnaC03g38700D [Brassica napus]
Length=405

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 174/215 (81%), Gaps = 1/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G T+   MS + +++EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAREEV  VF 
Sbjct  192  NSGQTKGNEMSTD-VMEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARAREEVKQVFS  250

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+PD EGLN LKV+TMILYE LRLY P A L R   +E KLG++ LP GV ++LP LL+
Sbjct  251  DKEPDTEGLNQLKVMTMILYEVLRLYPPAAQLTRAIHKEIKLGDLTLPGGVQINLPILLV  310

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG DA+EFKP RF++G+ KATNG+ +FFPF+ GPRICIGQNFAL+E KMA+A+I
Sbjct  311  HRDTQLWGNDAEEFKPGRFKDGVSKATNGQVSFFPFAWGPRICIGQNFALMETKMALALI  370

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSY HAPY+ LT  PQ+GA LI+H L
Sbjct  371  LQRFSFELSPSYVHAPYTVLTPHPQFGAHLILHKL  405



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G+++ GM+  ++I+EC LFYFAGQE TSV+LVWTM+LLS  P+WQ RAREEVL VFG++K
Sbjct  306  GSKDFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSVHPEWQVRAREEVLQVFGNEK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+ EGL+ LK+VTMIL+E+LRL+ PV    R+ + E KLGE+ LP GVLL +PT+LIH D
Sbjct  366  PNLEGLSRLKIVTMILHETLRLFPPVPTYRRRNIHEVKLGELSLPAGVLLFIPTVLIHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDAKEFKPERF EG+  AT G+ +F PF  GPRICIGQNFA++EAKMA+AMILQ+
Sbjct  426  KELWGEDAKEFKPERFSEGVSNATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQK  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSPSY+HAP + +T QPQYGAPL+M  L
Sbjct  486  FCFELSPSYSHAPVAIITTQPQYGAPLLMRKL  517



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q        GMS + +IDEC LFY AGQETTSV+L+WTMVLLS+ PDWQARAREEVL VF
Sbjct  300  QEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQARAREEVLQVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+VTMI +E LRLY PV  L R   ++T++G+M  P GV +SLPT+L
Sbjct  360  GNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTIL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+DAKEF PERF EG+ KAT  + +F PF  GPR+CIGQNFA++EAK+A+AM
Sbjct  420  VHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKIALAM  479

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAPYS +TIQPQYGA LI+  L
Sbjct  480  ILQRFSFELSPSYAHAPYSLITIQPQYGAHLILRGL  515



>ref|XP_010487263.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=404

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFG K
Sbjct  192  GQTKGNGMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGVK  251

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +P+ EGLN LKV+T ILYE LRLY PV+ L R   +E KLG++ LP GV ++LP LL+  
Sbjct  252  EPNTEGLNQLKVMTTILYEVLRLYPPVSQLTRAINKEMKLGDLTLPSGVQITLPILLVQR  311

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT G+ +F  F+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  312  DTELWGNDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRICIGQNFAMLEAKMAMALILQ  371

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP + LT  PQ+GAPLI+H L
Sbjct  372  KFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  404



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMSI+ +IDEC +FYFAGQETTSV+L+WTM+LLS+ P+WQARAREEVLHVF
Sbjct  303  QEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMILLSKHPNWQARAREEVLHVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+V MIL+E LRLY PV  L R   E+ ++G+M LP GV +SLPT+L
Sbjct  363  GNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDA+EF PERF +G +KAT    +FFPF  G R+CIGQNFA++EAKM +AM
Sbjct  423  VHHDHEIWGEDAREFNPERFSQGALKATKSLVSFFPFGWGSRLCIGQNFAILEAKMVLAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF LSPSY+HAP S +T++PQYGA LI+H +
Sbjct  483  ILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I+++++EC LFYFAGQETTSV+LVWT++LLSRFPDWQ RAREEVL VFG + 
Sbjct  305  GNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWTLILLSRFPDWQKRAREEVLQVFGSQT  364

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+ LN LK+VTMIL E LRLY PV GL RK  EETKLG++ LP GV +SLP +L+H  
Sbjct  365  PDFDSLNHLKIVTMILNEVLRLYPPVVGLGRKVTEETKLGKLTLPAGVQISLPIILLHHS  424

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DA +F PERF EG+ KA   +  FFPF  GPRICIGQ FA++EAK+A+AMILQR
Sbjct  425  REIWGDDAMDFNPERFSEGVAKAQKRQGIFFPFGWGPRICIGQMFAMMEAKVALAMILQR  484

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP + +T+QPQ+GA L++H L
Sbjct  485  FSFELSPSYTHAPQTIITLQPQHGAHLLLHKL  516



>ref|XP_006348301.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=350

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GMSIE++I+EC LFY AGQETTSV+LVWT+VLLSR+ DWQ +AREEVL VFG +K
Sbjct  139  GNKNFGMSIEEVIEECKLFYLAGQETTSVLLVWTLVLLSRYQDWQTQAREEVLQVFGSRK  198

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLYSP+    R+  E+  LGE+ LP GVL+SLP  L+H D
Sbjct  199  PDFDGLNHLKVVTMILYESLRLYSPLITHNREVTEDIVLGELSLPAGVLVSLPDSLLHHD  258

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA +F PERFREGI  AT G+  +FPFS GPRICIGQNFA++EA+MA++MILQ 
Sbjct  259  KDIWGEDANKFNPERFREGIASATKGQVTYFPFSWGPRICIGQNFAMLEARMAVSMILQS  318

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP   LTIQPQYGAPLI H L
Sbjct  319  FSFELSPSYTHAPQPILTIQPQYGAPLIFHKL  350



>ref|XP_010644760.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
 emb|CBI39892.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q        GMS + +IDEC LFY AGQETTSV+L+WTMVLLS+  DWQARAREEVL VF
Sbjct  193  QEHQNNTKIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHTDWQARAREEVLQVF  252

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+VTMI +E LRLY PV  L R   ++T++G+M  P GV +SLPT+L
Sbjct  253  GNNKPENDGLNHLKIVTMIFHEVLRLYPPVTVLTRMVSKDTQVGDMYFPAGVQVSLPTIL  312

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+DAKEF PERF EG+ KAT  + +F PF  GPR+CIGQNFA++EAK A+AM
Sbjct  313  VHHDHEIWGDDAKEFNPERFAEGVSKATKNQVSFLPFGWGPRVCIGQNFAMMEAKTALAM  372

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP+S +TIQPQYGA LI+  L
Sbjct  373  ILQRFSFELSPSYAHAPFSLITIQPQYGAHLILRGL  408



>emb|CAN71061.1| hypothetical protein VITISV_032613 [Vitis vinifera]
Length=281

 Score =   295 bits (756),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GM I+ +I+EC +FYFAGQETTS +L+WTMVLLS+ P+WQARAREEVLHVF
Sbjct  66   QEHENDKNVGMCIKDVIEECKIFYFAGQETTSALLLWTMVLLSKHPNWQARAREEVLHVF  125

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+V MIL+E LRLY PV  L R   E+ ++G+M LP GV +SLPT+L
Sbjct  126  GNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTIL  185

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDA+EF PERF +G++KAT    +FFPF  G R+CIGQNFA++EAKM +AM
Sbjct  186  VHHDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAM  245

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF LSPSY+HAP S +T++PQ+GA LI+H +
Sbjct  246  ILQRFSFTLSPSYSHAPCSLVTLKPQHGAHLILHGI  281



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 172/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++  G++I+++I EC LFYFAGQETTSV LVWTM+LLSR  +WQA+AREEVL  FG  +
Sbjct  307  GSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQNWQAKAREEVLQAFGSDQ  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+ L+ LK+VTMILYESLRLY P+A  IR+T EETKLG M LP G LL +PT+L+H D
Sbjct  367  PAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETKLGNMYLPNGSLLFIPTILLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA+EFKPERF EG++ AT G+  FFPF  GPRICIGQNFA++EAKMA+A+ILQR
Sbjct  427  KEIWGEDAEEFKPERFSEGVLNATKGQMTFFPFGAGPRICIGQNFAMLEAKMAIALILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSPSY H P+  + +QP+YGAPL++  L
Sbjct  487  FEFELSPSYIHVPHCIVALQPKYGAPLLLQKL  518



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  L RK   ETKLG++ +PPGV LS+PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDQEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP + +T+QP+YG  +I+  
Sbjct  481  ELSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_006300449.1| hypothetical protein CARUB_v10020157mg [Capsella rubella]
 gb|EOA33347.1| hypothetical protein CARUB_v10020157mg [Capsella rubella]
Length=512

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
            + G  +  G+SIE++I+EC +FYFAGQETTSV+LVWTMVLLS+  DWQ RAREEV  VFG
Sbjct  298  SIGQEKGNGLSIEEVIEECKMFYFAGQETTSVLLVWTMVLLSQHQDWQVRAREEVKQVFG  357

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+PD EGLN LKV+TMILYE LRLY PV  L+R T +E KLG++ LP GV ++LP +L+
Sbjct  358  DKEPDKEGLNQLKVMTMILYEVLRLYPPVVQLLRATEKEMKLGDLTLPAGVQINLPIMLV  417

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
              D E+WG DA EFKPERF++G++KAT  + +FF F+ GPRICIGQ FAL+E KMAMA+I
Sbjct  418  QRDIELWGNDAAEFKPERFKDGLLKATKNQVSFFAFAWGPRICIGQTFALLEVKMAMALI  477

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSP+Y HAPY  +TI PQ+GAP+I+  L
Sbjct  478  LQRFSFELSPNYVHAPYEAMTIHPQFGAPVILKKL  512



>ref|XP_010644766.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=460

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +   MS++ +I+EC LFY AGQETTSV+LVWTMVLLS  P+WQARAREEVL VF
Sbjct  243  QEHQNNKKIRMSVKDVIEECKLFYLAGQETTSVLLVWTMVLLSEHPNWQARAREEVLQVF  302

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKP+  GLN LK+VTMI +E LRLY PVA L R   ++T++G+M  P GV + LPT+L
Sbjct  303  GNKKPEAAGLNHLKIVTMIFHEVLRLYPPVAMLARAVYKDTQVGDMCFPAGVQVVLPTIL  362

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+DAKEF PERF EG++KAT  + +FFPF  GPR+CIGQNFA++EAK+A+AM
Sbjct  363  VHHDHEIWGDDAKEFNPERFAEGVLKATKNQVSFFPFGWGPRVCIGQNFAMMEAKIALAM  422

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSPSYAHAP+S LT+QPQYGA LI+  L
Sbjct  423  ILQHFSFELSPSYAHAPFSILTMQPQYGAHLILRGL  458



>ref|XP_010502007.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTKGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE +RLY PV  L R   +E KLG++ LP GV +SLP LL+  
Sbjct  360  EPDAEGLNQLKVMTMILYEVVRLYPPVTQLTRAIHKEIKLGDLTLPGGVQISLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  420  DTELWGNDAGEFKPERFKDGLSKATKSQVSFFPFAWGPRICIGQNFAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELS SY HAPY+ +TI PQ+GA LI+  L
Sbjct  480  KFSFELSLSYLHAPYTIITIHPQFGAQLILQKL  512



>gb|KFK38823.1| hypothetical protein AALP_AA3G165300 [Arabis alpina]
Length=512

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 168/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSIE +++EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV   FGDK
Sbjct  300  GEGKGNGMSIEDVMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQAFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMI  E LRLY PV  L R   +ETKLG+M LP GV ++LP LL+  
Sbjct  360  EPDTEGLNHLKVMTMIFNEVLRLYPPVIQLTRAIHKETKLGDMTLPSGVHITLPILLVQH  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++GI KAT  + +FFPF  GPRICIGQN A++EAKMAMA+ILQ
Sbjct  420  DTELWGNDAAEFKPERFKDGISKATKSQVSFFPFGWGPRICIGQNLAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP    T+ PQ+GAPLI+H L
Sbjct  480  RFSFELSPSYVHAPLPVFTVHPQFGAPLILHKL  512



>ref|XP_010502025.1| PREDICTED: cytochrome P450 72A13-like isoform X1 [Camelina sativa]
Length=425

 Score =   300 bits (767),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFG+K
Sbjct  213  GQTKGNGMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGNK  272

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +P+ EGLN LKV+T ILYE LRLY PV+ L R   +E KLG++ LP GV ++LP LL+  
Sbjct  273  EPNTEGLNQLKVMTTILYEVLRLYPPVSQLTRAINKEMKLGDLTLPGGVQITLPILLVQR  332

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG DA EFKPERF++G+ KAT G+ +F  F+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  333  DTDLWGNDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRICIGQNFAMLEAKMAMALILQ  392

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP + LT  PQ+GAPLI+H L
Sbjct  393  KFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  425



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  G  +N GM+ E +I EC LFYFAG ET S +LVWTM+LLS +PDWQ RAR+E+L VF
Sbjct  299  EEQGNNKNIGMNNEDVIAECKLFYFAGHETVSSLLVWTMILLSMYPDWQTRARKEILQVF  358

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G++KPDF+GL+ LK+VTMIL E LRLY PV  L RK  ++ KLG + LP  V + LP LL
Sbjct  359  GNRKPDFDGLSHLKIVTMILNEVLRLYPPVLSLARKVRKDVKLGNLSLPSEVQVFLPILL  418

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEFKPERF EG++KATNG+ + FPF GGPRICIGQNFAL+E K+A+++
Sbjct  419  VHHDCEVWGDDAKEFKPERFSEGVLKATNGRVSLFPFGGGPRICIGQNFALLEVKIALSI  478

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF+LSP+Y HAP + LT+QPQYGA LI+H L
Sbjct  479  ILQRFSFQLSPTYTHAPTAWLTLQPQYGAHLILHKL  514



>emb|CDX82468.1| BnaA03g33530D [Brassica napus]
Length=527

 Score =   303 bits (775),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVWTMVLLS+  +WQARAREEV  VFG
Sbjct  298  NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQEWQARAREEVKQVFG  357

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+P+ EGLN LKV+TMILYE LRLY P A L R   +E KLG++ LP GV ++LP LL+
Sbjct  358  DKEPNTEGLNQLKVMTMILYEVLRLYPPAAQLTRAIHKEMKLGDLTLPGGVQINLPILLV  417

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H D ++WG+DA EFKPERF +G+ KAT G+ +FFPF  GPRICIGQNFAL+E KMA+A++
Sbjct  418  HRDIQLWGKDAAEFKPERFEDGVSKATKGQVSFFPFGWGPRICIGQNFALMETKMALALM  477

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSY HAPY+ LT+QPQ GA LI+H +
Sbjct  478  LQRFSFELSPSYVHAPYTVLTLQPQSGAHLILHKI  512



>ref|XP_003525967.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=518

 Score =   302 bits (774),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  ++ GM+ + +I+EC LFYFAGQETTSV+L WTMVLLSRFP+WQ  AREEV+ +FG K
Sbjct  306  GHRKDVGMNTDDVINECKLFYFAGQETTSVLLNWTMVLLSRFPNWQTLAREEVIGIFGTK  365

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD++GLN LKVVTMILYE LRLY PV  + R   +E ++G + LP G L ++P +L+H 
Sbjct  366  EPDYDGLNRLKVVTMILYEVLRLYPPVTAITRVVRKEARVGNLTLPAGALATIPIVLVHH  425

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D+E+WG DAKEFKPERF EGI+KATNG+ +F PF+ GPRICIGQNFAL+EAKMA+ +ILQ
Sbjct  426  DSELWGSDAKEFKPERFSEGILKATNGQVSFLPFAWGPRICIGQNFALLEAKMALCLILQ  485

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELS SY HAP++ +T QPQ+G P+I H L
Sbjct  486  NFSFELSASYTHAPFTVITAQPQFGTPIIFHKL  518



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GM+++++I+EC LFYFAGQETTS +LVWTMV+LS  P+WQ RAREEVL  FG  
Sbjct  305  GNEKNIGMNVDEVIEECKLFYFAGQETTSNLLVWTMVVLSMHPEWQMRAREEVLQSFGKD  364

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+G+N LKVV+MILYE LRLY P   L R+T ++ KLG++ LPP V LSLPT+LIH 
Sbjct  365  KPDFDGINHLKVVSMILYEVLRLYPPAVALTRQTYKKVKLGDVYLPPRVELSLPTILIHH  424

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
              E+WGEDA+EFKPERF  G+ KA N + +F PF  GPRICIGQNFA++EAKMA+A+ILQ
Sbjct  425  SRELWGEDAQEFKPERFLGGVSKAANNQVSFIPFGWGPRICIGQNFAMIEAKMALALILQ  484

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSPSYAHAP + +T+QPQYGA +I+H L
Sbjct  485  HFSFELSPSYAHAPCTIITLQPQYGAQIILHKL  517



>emb|CDX97593.1| BnaA05g24860D [Brassica napus]
Length=512

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSIE +I+EC LFYFAGQETTSV+LVWTMV+LS+  DWQARAR+EV  VFGDK
Sbjct  300  GQAKGTGMSIEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQARARDEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LK++TMILYE LRLY PV  L R   +E KLG++ LP G  +SLP +L+  
Sbjct  360  EPDTEGLNHLKIMTMILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGTHISLPVMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT +WG DA EFKP+RF++G+ KAT  + +F PF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  420  DTNLWGNDAGEFKPDRFKDGVSKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+  T+ PQ+GA LI+H L
Sbjct  480  RFSFELSPSYVHAPYNVFTLHPQFGAHLILHKL  512



>ref|XP_009594692.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Nicotiana 
tomentosiformis]
Length=408

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GMS++++I+EC LFYFAGQETTS +L W+M++LS+  DWQARAREEVL VFG+ +
Sbjct  197  GNKKFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQARAREEVLQVFGNNR  256

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD++ LN LKVVTMI+ E LRLY P+  + R+  +ETKLG + LP GV L LPT+++H D
Sbjct  257  PDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQLLLPTIMLHHD  316

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGED KEF PERF EG+ KAT GK A+FPFS GPRICIGQ+FA+++AKMA+AMILQ 
Sbjct  317  QEIWGEDVKEFNPERFSEGVNKATKGKFAYFPFSWGPRICIGQHFAMLQAKMALAMILQH  376

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ++F++SPSYAH PYS LT+QPQ+GA LI+H L
Sbjct  377  YAFDVSPSYAHVPYSVLTLQPQHGAQLILHKL  408



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  300  GQTKGNGMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+T ILYE LRLY P   L R   +E KLG+M LP GV +SLP LLI  
Sbjct  360  EPDAEGLNQLKVMTTILYEVLRLYPPPCQLTRTINKEMKLGDMTLPSGVQISLPVLLIQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT G+ +F  F+ GPR CIGQN+A++EAKMAMA+ILQ
Sbjct  420  DTELWGHDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRFCIGQNYAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP + LT  PQ+GAPLI+H L
Sbjct  480  KFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  512



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  L RK   ETKLG++ +PPGV LS+PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            +LSPSYAHAP + +T+QP+YG  +I+  
Sbjct  481  DLSPSYAHAPSNVITLQPRYGVQVILRK  508



>gb|KCW67648.1| hypothetical protein EUGRSUZ_F01396 [Eucalyptus grandis]
Length=519

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  310  NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLRIFGSGKPDP  369

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY P   L+R+ ++ETKLG++ +P GV LS+PTLLIH D E+
Sbjct  370  DGLSHLKIVTMILNEVLRLYPPATDLVREVLKETKLGKLTIPTGVQLSMPTLLIHHDKEL  429

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  430  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  489

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP + +T+QP+YG  +I+  
Sbjct  490  ELSPSYAHAPSNVITLQPRYGVQVILRK  517



>ref|XP_010060779.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Eucalyptus 
grandis]
Length=510

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  L RK   ETKLG++ +PPGV LS+PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVTELGRKVPTETKLGKLTIPPGVQLSMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            +LSPSYAHAP + +T+QP+YG  +I+  
Sbjct  481  DLSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFYFAGQETTSV+L+WTMVLLS+ P+WQARAREEVLHVF
Sbjct  303  QEHENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+V MIL+E LRLY PV  L R   E+ ++G+M LP GV +SLPT+L
Sbjct  363  GNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDA+EF PERF +G++KAT    +FFPF  G R+CIGQNFA++EAKM +AM
Sbjct  423  VHHDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF LSPSY+HAP S +T++PQYGA LI+H +
Sbjct  483  ILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+  +II+EC LFYFAGQETTSV+L W M+LLS+ PDWQA AREEVL VFGD K
Sbjct  307  GNKDFGMTTREIIEECKLFYFAGQETTSVLLGWAMILLSKHPDWQAHAREEVLQVFGDGK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
             +F+GLN LK+VTMIL E+LRLY PV    RKT   TKLGE+ LP GV+L LP +L+H D
Sbjct  367  LEFDGLNRLKIVTMILNETLRLYPPVDATSRKTTTNTKLGELSLPAGVMLLLPIILLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA EFKPERF EG+ KAT G+  FFPF GGPRICIG NFA++EAKMA+AMILQ 
Sbjct  427  KEIWGEDATEFKPERFSEGVSKATKGQMTFFPFGGGPRICIGLNFAMIEAKMALAMILQH  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +TIQPQYGAPLI+H L
Sbjct  487  FSFELSPSYTHAPQSVITIQPQYGAPLILHRL  518



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFYFAGQETTSV+L+WTMVLLS+ P+WQARAREEVLHVF
Sbjct  303  QEHENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQARAREEVLHVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KP+ +GLN LK+V MIL+E LRLY PV  L R   E+ ++G+M LP GV +SLPT+L
Sbjct  363  GNNKPEGDGLNHLKIVMMILHEVLRLYPPVPLLARTVYEDIQVGDMYLPAGVDVSLPTIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDA+EF PERF +G++KAT    +FFPF  G R+CIGQNFA++EAKM +AM
Sbjct  423  VHHDHEIWGEDAREFNPERFSQGVLKATKSPVSFFPFGWGSRLCIGQNFAILEAKMVLAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF LSPSY+HAP S +T++PQYGA LI+H +
Sbjct  483  ILQRFSFSLSPSYSHAPCSLVTLKPQYGAHLILHGI  518



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 173/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N G++IE +I+EC LFYFAGQ++TS +LVWTM+LLS +PDWQ RAREEVL VF
Sbjct  306  QEHGNNKNVGLNIEDVIEECKLFYFAGQDSTSSLLVWTMILLSMYPDWQTRAREEVLQVF  365

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KPDF+GLN LK+V MIL E  RLY PV GL RK +++ KLG + L  G+ +S+P +L
Sbjct  366  GNHKPDFDGLNHLKIVPMILNEVFRLYPPVIGLPRKVLKDVKLGNLSLVAGMQVSIPIIL  425

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEFKPERF EG++KATNG+ +  PF GGPRIC G+NF+ +EAK+A++M
Sbjct  426  VHHDCELWGDDAKEFKPERFAEGVLKATNGRASLIPFGGGPRICTGRNFSFLEAKIALSM  485

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELS SY HAP + +T+QPQYGA LI+H +
Sbjct  486  ILQRFSFELSSSYTHAPITAITLQPQYGAHLILHKV  521



>ref|XP_007133275.1| hypothetical protein PHAVU_011G166000g [Phaseolus vulgaris]
 gb|ESW05269.1| hypothetical protein PHAVU_011G166000g [Phaseolus vulgaris]
Length=339

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  G  ++ GM+   +I+EC LFYFAGQETTSV+L WTMVLLSRFP+WQ  AREEV+ +F
Sbjct  124  EDGGVKKDVGMNTNDVINECKLFYFAGQETTSVLLNWTMVLLSRFPNWQTLAREEVIEIF  183

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G K+PD+EGLN LKVVTMILYE LRLY PV  + R   ++T++G M LP G L+++P +L
Sbjct  184  GTKEPDYEGLNRLKVVTMILYEVLRLYPPVTAITRVLRKKTRVGNMTLPEGALVTIPIVL  243

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG DAKEFKPERF EGI+KATNG+ +F PF  GPRICIGQNFAL+EAKMA+++
Sbjct  244  VHHDFELWGSDAKEFKPERFSEGILKATNGQVSFIPFGWGPRICIGQNFALLEAKMALSL  303

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ F FELS SY HAP + +T QPQ+G  +I+  L
Sbjct  304  ILQNFKFELSSSYVHAPVTVITAQPQFGTNIILQKL  339



>ref|XP_010465355.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+   WQARAR+EV  VFGDK
Sbjct  300  GQAKGNGMSTEDVMEECKLFYFAGQETTSVLLVWTMVLLSQHQAWQARARDEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+TMILYE LRLY PV  L R   +E KLG++ LP GV +SLP +L+  
Sbjct  360  EPDTEGLNQLKVMTMILYEVLRLYPPVTHLTRAIHKEMKLGDLTLPGGVHISLPVMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG DA EFKPERF++GI KAT  + +FFPF+ GPRICIGQNF L+EAKMAMA+IL 
Sbjct  420  DTKLWGNDAAEFKPERFKDGISKATKSQVSFFPFAWGPRICIGQNFTLMEAKMAMALILL  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+ +TI PQ+GA LI+H L
Sbjct  480  RFSFELSPSYVHAPYTVVTIHPQFGAHLILHKL  512



>ref|XP_009147881.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSI+ +I+EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV  VFGDK
Sbjct  300  GQAKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LK++TMI+ E +RLY PV  L R   +E KLG++ LP GV ++LP +L+  
Sbjct  360  EPDTEGLNHLKIMTMIINEVIRLYPPVTLLTRTIHKEMKLGDLTLPGGVQINLPIMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG DA EFKPERF +G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTQLWGNDAAEFKPERFEDGVSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSP+Y HAPY+  T+ PQYGA LI+H L
Sbjct  480  RFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>ref|XP_007149364.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
 gb|ESW21358.1| hypothetical protein PHAVU_005G064100g [Phaseolus vulgaris]
Length=520

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GM+IE +I EC LFYFAGQETTS +LVWTM+LLS +PDWQ RAREEVL VF
Sbjct  302  QEQGNNKNVGMNIEDVIGECKLFYFAGQETTSSLLVWTMILLSMYPDWQTRAREEVLQVF  361

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+ KPDF+GLN LK+VTM+L E LRLY P+ GL R+  ++ KLG + L  G+ + +  +L
Sbjct  362  GNGKPDFDGLNHLKIVTMVLNEVLRLYPPIIGLAREVCKDVKLGNLSLAAGMQVYISIIL  421

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WG+DAKEFKPERF EG++KATNGK A FPF  GPRICIGQNF+L+EAK+A++M
Sbjct  422  VHHDCELWGDDAKEFKPERFAEGVLKATNGKVALFPFGWGPRICIGQNFSLLEAKVALSM  481

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            IL+ FSFELSP+Y HAP + +T+QPQYGA LI+  +
Sbjct  482  ILRHFSFELSPTYTHAPTTVITLQPQYGAQLILRKV  517



>ref|XP_006362153.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=392

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G+++ G++  ++I+EC LFYFAGQ+TTSV+LVWT +LL   P+WQ RAREEVL+VFG++K
Sbjct  181  GSKDFGLTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEWQVRAREEVLNVFGNEK  240

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDFEGL+ LK+VTMILYE+LRL+ P     R+  +E KLGE+ LP  VLL +P +L+H +
Sbjct  241  PDFEGLSRLKIVTMILYETLRLFPPAPIYGRRNKDEVKLGELSLPAEVLLVIPAILVHYN  300

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDAKEFKPERF EG+ KATNG+ +F PF  GPRICIGQNFA++EAKMA+ MILQ+
Sbjct  301  KELWGEDAKEFKPERFSEGVSKATNGQVSFIPFGWGPRICIGQNFAMMEAKMAITMILQK  360

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP + ++I PQYGAPL+M  L
Sbjct  361  FSFELSPSYTHAPVAVVSIHPQYGAPLLMRKL  392



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            + GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS  PDWQARAREEVL  FG +KPDF
Sbjct  301  DVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHPDWQARAREEVLQTFGSRKPDF  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY P   + RK  +ETKLG++ LP GV LS+ TLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPAIVMARKVPKETKLGKLTLPAGVQLSMSTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+  AT  +  FFPF  GPR C+GQNFA++EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSNATKNQVCFFPFGWGPRTCVGQNFAMIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP +  T+QPQYG  +I+H 
Sbjct  481  ELSPSYAHAPLTIFTLQPQYGVQVILHK  508



>ref|XP_010487268.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=520

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 172/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E +++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFGDK
Sbjct  308  GQTKGNGMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGDK  367

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD E L  LKV+TMI+YE LRLY PV  + R   +E KLG+M LP GV +++PTLL+  
Sbjct  368  EPDAEDLTQLKVMTMIIYEVLRLYPPVFQMSRAIHKEMKLGDMTLPGGVHVTVPTLLVQR  427

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT G+  FF F+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  428  DTELWGNDAGEFKPERFKDGLSKATKGQVPFFSFAWGPRICIGQNFAMLEAKMAMALILQ  487

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAPY+ LTI PQ+GA LI+H L
Sbjct  488  KFSFELSPSYLHAPYTVLTIHPQFGASLILHKL  520



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++  GM+  ++I+EC LFYFAGQE TSV+LVWTM+LLS  P+WQ RAREEVL VFG++K
Sbjct  306  GSKEFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSLHPEWQVRAREEVLQVFGNEK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+ EGL+ LK++TMIL+E+LRL+ PV    R+   E KLGE+ LP GVLL +PT+LIH D
Sbjct  366  PNLEGLSRLKIMTMILHETLRLFPPVPTYRRRNKHEVKLGELSLPSGVLLFIPTVLIHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDAKEFKPERF EG+ KAT G+ +F PF  GPRICIGQNFA++EAKMA+AMILQ+
Sbjct  426  KELWGEDAKEFKPERFSEGVSKATKGQVSFIPFGWGPRICIGQNFAMMEAKMAIAMILQK  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSF+LSPSY HAP + +T QPQYGAPL+M  L
Sbjct  486  FSFKLSPSYTHAPVAIITTQPQYGAPLLMRKL  517



>emb|CBI39923.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFY AGQETTSV+L+WTMVLLS+  +WQ RAREEVL VF
Sbjct  241  QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVF  300

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY PV+ L+R    ++++G + LP GV ++LP LL
Sbjct  301  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILL  360

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  361  LHHDHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAM  420

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S +T+QPQYGA LI+H L
Sbjct  421  ILQRFSFELSPSYAHAPISLITMQPQYGAHLILHGL  456



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   301 bits (771),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 170/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  G+SI+ +I+EC LFYFAGQETTS +LVWTMVLLS++  WQ  AREEVL  FG KK
Sbjct  308  GKKEVGLSIQDVIEECKLFYFAGQETTSTLLVWTMVLLSKYSHWQTLAREEVLQHFGTKK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD++GL+ LK V+MILYE LRLY PV  + R++ +E KLG+M LP G LLSLP +L+H D
Sbjct  368  PDYDGLHHLKTVSMILYEVLRLYPPVPVIARRSTQEIKLGKMTLPAGGLLSLPIMLLHRD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            TE+WGEDA EFKPERF +G+  AT G+  FFPF  GPRICI QNFAL+EAKMAMA+ILQR
Sbjct  428  TELWGEDALEFKPERFADGVSHATKGQVIFFPFGWGPRICIAQNFALLEAKMAMALILQR  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +T++PQYGA LI+H +
Sbjct  488  FSFELSPSYTHAPISIITLRPQYGAHLILHKI  519



>emb|CDX75785.1| BnaC03g38680D [Brassica napus]
Length=374

 Score =   296 bits (759),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVW M++LS+  DWQARAREEV  VFG
Sbjct  160  NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWIMIMLSQHQDWQARAREEVKQVFG  219

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+P  EGLN LKV+TMILYE LRLY P   L R   +E KLG++ LP GV ++LP LL+
Sbjct  220  DKEPATEGLNQLKVMTMILYEVLRLYPPAVQLTRAIHKEMKLGDLTLPGGVQINLPILLV  279

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG DA EFKPERF++G+ KAT G+ +FFPF+ GPRICIGQNFAL+E KMA+A+I
Sbjct  280  HRDTQLWGNDAAEFKPERFKDGVSKATKGQVSFFPFAWGPRICIGQNFALMEIKMALALI  339

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            L++FSFELSPSY HAPY+ +T+ PQ+GA LI++ +
Sbjct  340  LKKFSFELSPSYVHAPYTVITMHPQFGAHLILNKI  374



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 170/216 (79%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G ++N G+S++++I+EC LFY AGQETTS +L+WTMVLLS+ P+WQ  AREEV  VF
Sbjct  301  QEGGNSKNAGISMQEVIEECKLFYLAGQETTSNLLLWTMVLLSKHPNWQTLAREEVFQVF  360

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G  KP+F GL+ LKVVTMI YE LRLY P A L R   E+  LGE+ LP GV + LPT+L
Sbjct  361  GKNKPEFAGLSRLKVVTMIFYEVLRLYPPGATLNRAVYEDINLGELYLPSGVEIVLPTIL  420

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWG+D KEFKPERF EG+MKAT G+ ++FPF  GPRICIGQNFA+ EAKMA+AM
Sbjct  421  VHHDPEIWGDDVKEFKPERFSEGVMKATKGQVSYFPFGWGPRICIGQNFAMAEAKMALAM  480

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ F+FELSPSY HAP S LT+QPQYGA LI+H +
Sbjct  481  ILQCFTFELSPSYTHAPTSVLTLQPQYGAHLILHKI  516



>gb|KHN44049.1| Secologanin synthase [Glycine soja]
Length=219

 Score =   290 bits (743),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 167/213 (78%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +   M+ +++I+EC  FY AGQETTS +LVWTM+LLSR+PDWQA AREEVLHVFG++
Sbjct  7    GNNKTVAMTCQEVIEECNAFYLAGQETTSTLLVWTMILLSRYPDWQAHAREEVLHVFGNQ  66

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD++GL+ LK+VTMILYE LRLY P     +    + +LG + LP GV +SLP LLIH 
Sbjct  67   KPDYDGLSHLKIVTMILYEVLRLYPPAVYFNQAIKNDVELGNVSLPKGVQVSLPILLIHQ  126

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D +IWG+DA EFKPERF EG+ KAT G+ +FFPF  GPR+CIGQNFAL+EAKM ++++LQ
Sbjct  127  DHDIWGDDATEFKPERFAEGVAKATKGQVSFFPFGRGPRVCIGQNFALLEAKMVLSLLLQ  186

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSP+YAHAP    T+ P++GA +I+H L
Sbjct  187  KFSFELSPAYAHAPTIVFTLNPKFGAHIILHKL  219



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G++  G++I+++I EC LFYFAGQETTSV LVWTM+LLSR  DWQA+AREEVL  FG  +
Sbjct  307  GSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQDWQAKAREEVLQAFGSDQ  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P F+ L+ LK+VTMILYESLRLY P+A  IR+T EET+LG + LP G L+ +PT+L+H D
Sbjct  367  PAFDELSRLKIVTMILYESLRLYPPLATRIRRTNEETRLGNLYLPNGSLIFIPTILLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGEDA+EFKPERF+EG++KAT G+  FFPF  GPRICIG NFA++EAKMA+A+ILQR
Sbjct  427  KEIWGEDAEEFKPERFKEGVLKATKGQMIFFPFGAGPRICIGHNFAMLEAKMAVALILQR  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            F FELSPSY H P+  + +QP++GAPL++  L
Sbjct  487  FVFELSPSYTHVPHCIVALQPKFGAPLLLQRL  518



>ref|XP_010060784.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67652.1| hypothetical protein EUGRSUZ_F01400 [Eucalyptus grandis]
Length=510

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 169/207 (82%), Gaps = 0/207 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  L RK  +ETKLG++ +PPGV LS+PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVTELARKVPKETKLGKLTIPPGVQLSMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+  AT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSMATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            ELSPSYAHAP + L +QP+YG  +I+ 
Sbjct  481  ELSPSYAHAPSNVLILQPRYGVQVILR  507



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+I ++IDEC LFYFAGQ+TTSV+LVWTM+LL + P+WQ RAREEVL+VFG++K
Sbjct  312  GNKDFGMTITEVIDECKLFYFAGQDTTSVLLVWTMILLCQHPEWQVRAREEVLNVFGNEK  371

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDFEGL+ LK+VTMILYE+LRL+ P     R   +E KLGE+ LP  VLL +P +L+H +
Sbjct  372  PDFEGLSRLKIVTMILYETLRLFPPALLYGRTNKDEVKLGELSLPAEVLLIIPAILVHYN  431

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDAKEFKP+RF EG+ KATNG+ +F PF  GPRICIGQNF + EAKM +AMILQ+
Sbjct  432  KELWGEDAKEFKPDRFSEGVSKATNGQVSFIPFGWGPRICIGQNFVMTEAKMTIAMILQK  491

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP + ++I PQYGAPL M  L
Sbjct  492  FSFELSPSYTHAPVAVVSIHPQYGAPLHMRKL  523



>ref|XP_010465353.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 173/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G T   GMS E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFG
Sbjct  298  NSGQTEGNGMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQARAREEVKQVFG  357

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            D++P  EGLN LK++T ILYE LRLY PV+ L R   +E KLG+M LP GV ++LP +L+
Sbjct  358  DEEPTTEGLNQLKIMTTILYEVLRLYPPVSQLTRAINKEMKLGDMTLPSGVQITLPIMLV  417

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
              DTE+WG+DA EFKPERF++G+ KAT G+ +F  F+ GPRICIGQNFA++EAKMAMA+I
Sbjct  418  QRDTELWGKDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRICIGQNFAMLEAKMAMALI  477

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQ+FSFELSPSY HAP + LT  PQ+GAPLI+H L
Sbjct  478  LQKFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  512



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAGQETTSV+LVWT+VLLSR+ DWQ +AREEVL VF  +K
Sbjct  308  GNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRYQDWQTQAREEVLQVFESRK  367

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLY P+  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  368  PDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELCLPAGVLVSLPMILLHHD  427

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA EF PERFREGI  AT GK  +FPFS GPRICIGQNFA++EAKMA+ MILQ 
Sbjct  428  KDIWGEDANEFNPERFREGISSATKGKVTYFPFSWGPRICIGQNFAMLEAKMALCMILQS  487

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP S +T+QPQYGAPLI+H L
Sbjct  488  FSFELSPSYTHAPKSLVTMQPQYGAPLILHKL  519



>ref|XP_006297414.1| hypothetical protein CARUB_v10013438mg [Capsella rubella]
 gb|EOA30312.1| hypothetical protein CARUB_v10013438mg [Capsella rubella]
Length=532

 Score =   301 bits (770),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS +++++EC LFYFAGQETTSV+LVWTM+LLS+  DWQA AR+EV  VFGDK
Sbjct  320  GQTKGNGMSTDELMEECKLFYFAGQETTSVLLVWTMILLSQHQDWQAHARDEVKKVFGDK  379

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LKV+ MILYE LRLY PV  L R   +E KLGE+ +P GV ++LP LL+  
Sbjct  380  EPDAEGLNQLKVMNMILYEVLRLYPPVIQLTRAIQKEMKLGELTIPSGVQITLPILLVQH  439

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKP+RF++G+ KAT G+ +FF F+ GPR+CIGQNFAL+EAKMAMA+IL+
Sbjct  440  DTELWGSDAGEFKPDRFKDGVSKATKGQVSFFSFAWGPRVCIGQNFALLEAKMAMALILR  499

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP S +TI PQ+GAPLI+H L
Sbjct  500  KFSFELSPSYVHAPDSVITIHPQFGAPLILHKL  532



>dbj|BAB02395.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=506

 Score =   300 bits (768),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
            ++  G+++E+I++EC LFYFAGQETTSV+L WTMVLLS+  DWQARAREEV+ VFG  KP
Sbjct  296  SKGNGLNMEEIMEECKLFYFAGQETTSVLLAWTMVLLSQHQDWQARAREEVMQVFGHNKP  355

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +G+N LKV+TMI+YE LRLY PV  + R T +E KLG+M LP G+ + +P LLIH DT
Sbjct  356  DLQGINQLKVMTMIIYEVLRLYPPVIQMNRATHKEIKLGDMTLPGGIQVHMPVLLIHRDT  415

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            ++WG+DA EFKPERF++GI KAT  +  F PF  GPRICIGQNFAL+EAKMA+A+ILQRF
Sbjct  416  KLWGDDAAEFKPERFKDGIAKATKNQVCFLPFGWGPRICIGQNFALLEAKMALALILQRF  475

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY H+PY   TI PQ GA LI+H L
Sbjct  476  SFELSPSYVHSPYRVFTIHPQCGAHLILHKL  506



>emb|CDY51036.1| BnaA06g02990D [Brassica napus]
Length=512

 Score =   300 bits (767),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSI+ +I+EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV  VFGDK
Sbjct  300  GQAKGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +P+ EGLN LK++TMI+ E +RLY PV  L R   +E KLG++ LP GV ++LP +L+  
Sbjct  360  EPNTEGLNHLKIMTMIINEVIRLYPPVTQLSRTIHKEMKLGDLTLPGGVQINLPIMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG DA EFKPERF +G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+ILQ
Sbjct  420  DTQLWGNDAAEFKPERFEDGVSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSP+Y HAPY+  T+ PQYGA LI+H L
Sbjct  480  RFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>ref|XP_008778221.1| PREDICTED: cytochrome P450 72A15-like [Phoenix dactylifera]
Length=523

 Score =   300 bits (768),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 168/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  GG++N GMSIE +I+EC LFYFAG ETTSV+L WT+V LS  P WQARAREEVL VF
Sbjct  308  ENEGGSKNSGMSIEDVIEECKLFYFAGHETTSVLLTWTLVALSLHPSWQARAREEVLQVF  367

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G  KPD++GL+ LK+VTM+LYE LRLY P A L+RKT +E KLG+   P GV L LP + 
Sbjct  368  GGNKPDYDGLSRLKIVTMVLYEVLRLYPPAALLVRKTYKEMKLGQFTFPEGVQLLLPIIF  427

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH D E WGEDA EF PERF EG+ KA+  + AFFPF GGPRICIGQNF+++EAKMA++ 
Sbjct  428  IHHDPEFWGEDASEFNPERFAEGVSKASKIQGAFFPFGGGPRICIGQNFSMMEAKMALSR  487

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            ILQ F+F+LSPSYAHAPY+  TI PQ+GA +I+H
Sbjct  488  ILQHFTFQLSPSYAHAPYTVATIHPQHGAQIILH  521



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   300 bits (768),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 168/212 (79%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+ E+IIDEC LFY AGQETTS +LVWTM+ LSR+PDWQARAREEVL  FG   
Sbjct  310  GNKDYGMTTEEIIDECKLFYLAGQETTSALLVWTMIYLSRYPDWQARAREEVLQHFGAND  369

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+F+GLN LK+V MIL+E LRL  P+    R+  EETKLG + +P GVLL LP +L+H D
Sbjct  370  PEFDGLNQLKIVNMILHEVLRLCPPITATARRIAEETKLGNLTIPVGVLLVLPIMLMHHD  429

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGED KEFKPERF EG+  AT G+ AF+PF  GPRICIGQNFA++EAK+AM+MILQR
Sbjct  430  PDIWGEDVKEFKPERFAEGVSHATKGRLAFWPFGWGPRICIGQNFAMLEAKLAMSMILQR  489

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAH+P   +T++PQYGA LI+  +
Sbjct  490  FSFELSPSYAHSPRVAVTLRPQYGAHLILRKV  521



>ref|XP_007211745.1| hypothetical protein PRUPE_ppa006307mg [Prunus persica]
 gb|EMJ12944.1| hypothetical protein PRUPE_ppa006307mg [Prunus persica]
Length=418

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 168/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMSIE +I EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEVL VF
Sbjct  203  QEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQARAREEVLQVF  262

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G   P +E L+ LKVVTMIL E LRLY  V  L R T ++T+LG++ LP GV +SLP LL
Sbjct  263  GSNIPTYEELSHLKVVTMILLEVLRLYPSVVALPRTTHKKTQLGKLSLPAGVEVSLPILL  322

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E+WGEDA EFKPERF EG+ KAT  +  +FPF GGPRICIGQNFA++EAK+A+++
Sbjct  323  VHHDKELWGEDANEFKPERFSEGVSKATKNQFTYFPFGGGPRICIGQNFAMMEAKLALSL  382

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            ILQ F+FELSP Y+HAP   +T+QPQYGA LI+H
Sbjct  383  ILQHFTFELSPQYSHAPSVTITLQPQYGAHLILH  416



>emb|CDX98486.1| BnaC05g38890D [Brassica napus]
Length=512

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSIE +I+EC LFYFAGQETTSV+LVWTMV+LS+  DWQA+AREEV  VFGDK
Sbjct  300  GQAKGTGMSIEDVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQAKAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LK++TMILYE LRLY PV  L R   +E KLG++ LP G+ +SLP +L+  
Sbjct  360  EPDTEGLNHLKIMTMILYEVLRLYPPVIQLTRAIHKEMKLGDLTLPGGIHISLPVMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT +WG DA +FKP+RF++G+ KAT  + +F PF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  420  DTNLWGNDAGDFKPDRFKDGVSKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFE SPSY HAPY+  T+ PQ+GA LI+H L
Sbjct  480  RFSFEFSPSYVHAPYNVFTLHPQFGAHLILHKL  512



>gb|KCW67647.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=413

 Score =   296 bits (759),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +++EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  204  NVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  263

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  + RK  +ETKLG++ +PP V L +PTLLIH D E+
Sbjct  264  DGLSHLKIVTMILNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKEL  323

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  324  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  383

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP + +T+QP+YG  +I+  
Sbjct  384  ELSPSYAHAPSNVITLQPRYGVQVILRK  411



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 174/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G  N G++++++I+EC LF+FAGQETTS +LVWTM+LLS+  DWQ RA+EEVL  FG+ K
Sbjct  306  GNTNFGLTVDEVIEECKLFFFAGQETTSNLLVWTMILLSQHQDWQKRAKEEVLRTFGNNK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVV MIL E LRLY P+  L R   EE KLGE+ LP GV+L LP +L+H D
Sbjct  366  PDFDGLNHLKVVNMILLEVLRLYPPILSLDRTIYEEIKLGEISLPAGVILLLPIILLHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DAKEF PERF EG++KAT G+  +FPFS GPRICIGQNFA++EAKMAMAMILQR
Sbjct  426  QEIWGDDAKEFNPERFSEGVLKATKGRVTYFPFSWGPRICIGQNFAMLEAKMAMAMILQR  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSF LSPSYAHAP++ +T+QPQYGA LI+H+L
Sbjct  486  FSFVLSPSYAHAPHAIITLQPQYGAHLILHSL  517



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
            + + G++  ++I+EC LFYFAGQETTSV+L WTM+LLS  P+WQARAREEVL VFG++KP
Sbjct  307  SNDFGITTAEMIEECKLFYFAGQETTSVLLAWTMILLSLHPEWQARAREEVLQVFGNEKP  366

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            + EGL+ LK+VTMIL+E+LRL+  V    R+   E KLGE+ LP GV L +PT+LIH D 
Sbjct  367  NSEGLSRLKIVTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVQLIIPTILIHYDK  426

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            E+WGEDAKEFKPERF EG+ KAT G+ +F PF GGPR+CIGQNFA++EAKMA+AMILQ+F
Sbjct  427  ELWGEDAKEFKPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKF  486

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY HAP   +TI PQYGAPL+M  L
Sbjct  487  SFELSPSYTHAPVLTITIHPQYGAPLLMRKL  517



>ref|XP_010275158.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=527

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 167/216 (77%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GM+I+++I+EC LFYFAGQETTS +LVWTMV+LS   DWQ RAREEVL  F
Sbjct  306  QEHGSKKNAGMTIKEVIEECKLFYFAGQETTSNLLVWTMVVLSMHMDWQTRAREEVLKFF  365

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+  P + GL+ LK+VTMILYE LRLY P   + R T + TKLGE+ LPPGV L +P LL
Sbjct  366  GNDIPSYGGLSHLKIVTMILYEVLRLYPPTVTIGRSTYKNTKLGEISLPPGVHLEMPILL  425

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D E WGEDA+EFKPERF EG+ KATN + +FFPF  GPRICIGQNFA+ EAKMA+AM
Sbjct  426  LHHDLEFWGEDAQEFKPERFAEGVSKATNNQVSFFPFGWGPRICIGQNFAMTEAKMALAM  485

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQ FSFELSPSY HAP   LT+QPQYGA +I H L
Sbjct  486  ILQHFSFELSPSYTHAPCFVLTLQPQYGAQIIFHKL  521



>ref|XP_010502032.1| PREDICTED: cytochrome P450 72A13-like isoform X2 [Camelina sativa]
Length=512

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMS E++++EC LFYFAGQETTSV+LVWTMVLLS+  DWQARAREEV  VFG+K
Sbjct  300  GQTKGNGMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGNK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +P+ EGLN LKV+T ILYE LRLY PV+ L R   +E KLG++ LP GV ++LP LL+  
Sbjct  360  EPNTEGLNQLKVMTTILYEVLRLYPPVSQLTRAINKEMKLGDLTLPGGVQITLPILLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT++WG DA EFKPERF++G+ KAT G+ +F  F+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  420  DTDLWGNDAGEFKPERFKDGLSKATKGQVSFLAFAWGPRICIGQNFAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAP + LT  PQ+GAPLI+H L
Sbjct  480  KFSFELSPSYVHAPDTVLTTHPQFGAPLILHKL  512



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFY AGQETTSV+L+WTMVLLS+  +WQ RAREEVL VF
Sbjct  300  QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTRAREEVLRVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY PV+ L+R    ++++G + LP GV ++LP LL
Sbjct  360  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  420  LHHDHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAM  479

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S +T+QPQYGA LI+H L
Sbjct  480  ILQRFSFELSPSYAHAPISLITMQPQYGAHLILHGL  515



>ref|XP_009146333.1| PREDICTED: cytochrome P450 72A13-like [Brassica rapa]
Length=512

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+  GMSI  +I+EC LFYFAGQETTSV+LVWTMV+LS+  DWQA+AREEV  VFGDK
Sbjct  300  GQTKGTGMSIADVIEECKLFYFAGQETTSVLLVWTMVMLSQHQDWQAKAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EGLN LK++T ILYE LRLY PV  L R   +E KLG++ LP G  +SLP +L+  
Sbjct  360  EPDTEGLNHLKIMTTILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGTHISLPVMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DT +WG DA EFKP+RF++G+ KAT  + +F PF+ GPRICIGQNFA++EAKMAMA+ILQ
Sbjct  420  DTNLWGNDAGEFKPDRFKDGVSKATKSQVSFIPFAWGPRICIGQNFAMLEAKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAPY+  T+ PQ+GA LI+H L
Sbjct  480  RFSFELSPSYVHAPYNVFTLHPQFGAHLILHKL  512



>ref|XP_006348300.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=350

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             ++ GMSIE +I++C LFY AG ETTSV L+WT+VLLSR+ DWQARAREEVL VFG +KP
Sbjct  140  NKDFGMSIEDVIEKCKLFYLAGAETTSVWLLWTLVLLSRYQDWQARAREEVLQVFGCRKP  199

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            DF+GLN LKVVTMILYESLRLY P+  L R+  E+  LGE+ LP GVL+SLP +L+H + 
Sbjct  200  DFDGLNHLKVVTMILYESLRLYPPITALTRRVNEDITLGELSLPAGVLVSLPVILLHREE  259

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            E+WGED  +F PERFREGI  AT G+  +FPF+ GPRICIGQNFA++EAKMA+ MILQ F
Sbjct  260  EVWGEDVNKFNPERFREGISSATKGQVTYFPFAWGPRICIGQNFAMLEAKMALCMILQSF  319

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY HAP S LT+QPQYGAPLI H L
Sbjct  320  SFELSPSYTHAPQSILTMQPQYGAPLIFHKL  350



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 166/213 (78%), Gaps = 1/213 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G  N GMSI  +I+EC +FYFAGQETT+V+LVWTM+LL  +  WQ RAR EVL VFG+ K
Sbjct  309  GNVNLGMSINDLIEECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNK  368

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVE-ETKLGEMVLPPGVLLSLPTLLIHL  407
            PDF+GLN LK+VTMIL E LRLYSP + L RK V+ ETKLG    P GV+LS P +LIHL
Sbjct  369  PDFDGLNRLKIVTMILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHL  428

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D EIWGEDA EF PERF EG+ KAT  +  FFPF  GPRICIGQNFA++EAK+A+++ILQ
Sbjct  429  DKEIWGEDANEFNPERFAEGVSKATKNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQ  488

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSPSY HAP S LT QPQ+GA +I+H L
Sbjct  489  HFSFELSPSYTHAPISILTTQPQHGAHIILHKL  521



>emb|CDY51038.1| BnaA06g03010D [Brassica napus]
Length=512

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/210 (66%), Positives = 171/210 (81%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            +  GMSI+ +I+EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV  VFGDK+P+
Sbjct  303  KGNGMSIDDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDKEPN  362

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
             EGLN LK++TMI+ E LRLY PV  + R   +E KLG++ LP GV +SLPT+L+  DT+
Sbjct  363  TEGLNHLKIMTMIINEVLRLYPPVTHVKRAIHKEMKLGDLTLPGGVHISLPTMLVQRDTQ  422

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
            +WG DA EFKPERF++G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKMAMA+ILQRFS
Sbjct  423  LWGNDAAEFKPERFKDGVSKATKSQVSFFPFAWGPRICIGQNFALLEAKMAMALILQRFS  482

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELSP+Y HAPY+  T+ PQYGA LI+  L
Sbjct  483  FELSPTYVHAPYTVFTLHPQYGAHLILRKL  512



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFYFAGQETTS +L+WTM+LLS+  +WQARAREE+L VF
Sbjct  300  QEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD  GLN LK+VTMI +E LRLY PV+ LIR    ++++G    P G  ++LP LL
Sbjct  360  GNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATN-GKPAFFPFSGGPRICIGQNFALVEAKMAMA  239
            IH D EIWGEDAKEF PERF EG+ KAT  G+ AFFPF  GPR CIGQNFA++EAKMA+A
Sbjct  420  IHHDHEIWGEDAKEFNPERFSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALA  479

Query  238  MILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            MILQRFSFELSPSYAHAP++ +T+QPQYGA LI+H L
Sbjct  480  MILQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL  516



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFYFAGQETTS +L+WTM+LLS+  +WQARAREE+L VF
Sbjct  313  QEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQARAREEILQVF  372

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD  GLN LK+VTMI +E LRLY PV+ LIR    ++++G    P G  ++LP LL
Sbjct  373  GNKKPDGNGLNHLKIVTMIFHEVLRLYPPVSMLIRTVFVDSQVGRWYFPVGSHVALPILL  432

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATN-GKPAFFPFSGGPRICIGQNFALVEAKMAMA  239
            IH D EIWGEDAKEF PERF EG+ KAT  G+ AFFPF  GPR CIGQNFA++EAKMA+A
Sbjct  433  IHHDHEIWGEDAKEFNPERFSEGVSKATKGGQFAFFPFGYGPRACIGQNFAMMEAKMALA  492

Query  238  MILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            MILQRFSFELSPSYAHAP++ +T+QPQYGA LI+H L
Sbjct  493  MILQRFSFELSPSYAHAPFNVITVQPQYGAHLILHGL  529



>ref|NP_188081.1| cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
 gb|AEE75549.1| cytochrome P450, family 72, subfamily A, polypeptide 9 [Arabidopsis 
thaliana]
Length=508

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 169/211 (80%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
            ++  G+++E+I++EC LFYFAGQETTSV+L WTMVLLS+  DWQARAREEV+ VFG  KP
Sbjct  298  SKGNGLNMEEIMEECKLFYFAGQETTSVLLAWTMVLLSQHQDWQARAREEVMQVFGHNKP  357

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +G+N LKV+TMI+YE LRLY PV  + R T +E KLG+M LP G+ + +P LLIH DT
Sbjct  358  DLQGINQLKVMTMIIYEVLRLYPPVIQMNRATHKEIKLGDMTLPGGIQVHMPVLLIHRDT  417

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            ++WG+DA EFKPERF++GI KAT  +  F PF  GPRICIGQNFAL+EAKMA+A+ILQRF
Sbjct  418  KLWGDDAAEFKPERFKDGIAKATKNQVCFLPFGWGPRICIGQNFALLEAKMALALILQRF  477

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY H+PY   TI PQ GA LI+H L
Sbjct  478  SFELSPSYVHSPYRVFTIHPQCGAHLILHKL  508



>ref|XP_006407056.1| hypothetical protein EUTSA_v10022214mg [Eutrema salsugineum]
 gb|ESQ48509.1| hypothetical protein EUTSA_v10022214mg [Eutrema salsugineum]
Length=505

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSIE ++DEC  FY AGQETTSV+LVWTMVLLS+  DWQARA +EV+HVFG+K
Sbjct  289  GQAQGDGMSIEDVMDECKSFYIAGQETTSVLLVWTMVLLSQHKDWQARALQEVMHVFGNK  348

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EG++ LKV+TMI YE LRLY PV  L R   +E KLG++ LP GV ++LP LL+  
Sbjct  349  EPDTEGMSQLKVMTMIFYEVLRLYPPVIQLNRAIHKEMKLGDLTLPGGVQITLPVLLVQR  408

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG+DA EFKPERF+EGI KAT  + +FFPF  G RICIGQ+FAL+EAKMAMA+ILQ
Sbjct  409  DTELWGDDAAEFKPERFQEGISKATKNQVSFFPFGWGHRICIGQSFALLEAKMAMALILQ  468

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            RFSFELSP Y HAPY+ +T+QPQ+GAPL++H 
Sbjct  469  RFSFELSPCYVHAPYTVITLQPQFGAPLLLHQ  500



>gb|KJB12904.1| hypothetical protein B456_002G043600 [Gossypium raimondii]
Length=518

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 169/211 (80%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             +  GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL+R+PDWQ++AREEVLHV GD KP
Sbjct  305  AKKKGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQSKAREEVLHVLGDSKP  364

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +GLN LKV+TMILYE LRLY     L R   +E KLG ++LP G  +S+P LLIH D 
Sbjct  365  DADGLNRLKVLTMILYEVLRLYPSATELGRSVPKEIKLGNLLLPAGTEISVPILLIHHDK  424

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            ++WG+DA+EFKPERF EG+ KAT  +  F PF  GPRICI QNFA++EAKMA+AMILQRF
Sbjct  425  DLWGDDAREFKPERFAEGVSKATKSQVTFLPFGWGPRICIAQNFAMMEAKMAVAMILQRF  484

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FELSPSYAH+P S +T++PQ+GA +I+H L
Sbjct  485  WFELSPSYAHSPCSMVTLRPQHGAQIILHKL  515



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 170/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM+I+++I+EC LFYFAGQETTSV+LVWT++LLS+  DWQ RAREEV  VFG  K
Sbjct  306  GNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD++ LN LKVVTMI  E LRLY P   + R   E+TKLG + LP G+ L LP + +H D
Sbjct  366  PDYDALNQLKVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DAKEFKPERF EG+ KAT GK A+FPFS GPRIC+G NFA++EAKMA+A+ILQ 
Sbjct  426  NEIWGDDAKEFKPERFSEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQH  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ++FELSPSYAHAP++ +T+QPQ+GAPLI+  L
Sbjct  486  YAFELSPSYAHAPHTIITLQPQHGAPLILRKL  517



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 172/210 (82%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            +  GM+++++I+EC LFYFAGQETTS +LVWT++LLS+  DWQ RAR+EV  VFG KKP+
Sbjct  306  KKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEVQQVFGSKKPE  365

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
            FE LN LKV+TMIL E LRLY PV  L R T E TKLGE+ LP GV L LP +L+H D++
Sbjct  366  FEDLNHLKVITMILNEVLRLYPPVVMLGRMTPETTKLGELTLPAGVQLLLPAILLHHDSK  425

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
            IWG+DAKEFKPERF EGI+KAT G+  +FPF  GPRICIGQNFA+VE+K+A+AMILQRFS
Sbjct  426  IWGDDAKEFKPERFSEGILKATKGQLTYFPFGWGPRICIGQNFAMVESKLALAMILQRFS  485

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELSP YAHAP++ +T+QPQ+GA LI+  L
Sbjct  486  FELSPLYAHAPHTIITLQPQHGAQLILRKL  515



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 170/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +N GM+I+++I+EC LFYFAGQETTSV+LVWT++LLS+  DWQ RAREEV  VFG  K
Sbjct  306  GNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVHQVFGSNK  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD++ LN LKVVTMI  E LRLY P   + R   E+TKLG + LP G+ L LP + +H D
Sbjct  366  PDYDALNQLKVVTMIFNEVLRLYPPGITISRTVHEDTKLGNLSLPAGIQLVLPAIWLHHD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWG+DAKEFKPERF EG+ KAT GK A+FPFS GPRIC+G NFA++EAKMA+A+ILQ 
Sbjct  426  NEIWGDDAKEFKPERFSEGVNKATKGKFAYFPFSWGPRICVGLNFAMLEAKMALALILQH  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ++FELSPSYAHAP++ +T+QPQ+GAPLI+  L
Sbjct  486  YAFELSPSYAHAPHTIITLQPQHGAPLILRKL  517



>emb|CBI39937.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFY AGQETTSV+L+WTMVLLS+  +WQ  AREEVL VF
Sbjct  241  QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVF  300

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY PV+ L+R    ++++G + LP GV ++LP LL
Sbjct  301  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILL  360

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  361  LHHDHEIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  420

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S LT  PQYGA LI+H L
Sbjct  421  ILQRFSFELSPSYAHAPISLLTTHPQYGAHLILHGL  456



>emb|CDY28093.1| BnaC06g02740D [Brassica napus]
Length=512

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMSIE +I+EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV  VFGDK
Sbjct  300  GQAKGNGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +P+ EGLN LK++TMI+ E +RLY PV  L R   +E KLG++ LP GV ++LP +L+  
Sbjct  360  EPNTEGLNHLKMMTMIINEVIRLYPPVTQLSRTIHKEMKLGDLTLPGGVQINLPIMLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            +T++WG DA EFKPERF +G+ KAT  + +FFPF+ GPRICIGQNFAL+EAKM+MA+ILQ
Sbjct  420  ETQLWGNDAAEFKPERFEDGVSKATKNQVSFFPFAWGPRICIGQNFALLEAKMSMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSP+Y HAPY+  T+ PQYGA LI+H L
Sbjct  480  RFSFELSPTYVHAPYTVFTLHPQYGAHLILHKL  512



>gb|KHG20902.1| Secologanin synthase [Gossypium arboreum]
Length=482

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 168/211 (80%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             ++ GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL+R+PDWQ +AR+EVLHV GD+KP
Sbjct  269  AKHMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQTKARDEVLHVLGDRKP  328

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +GLN LKVVTMILYE LRLY PV  L R   +E K+G ++LP G  + +P L IH D 
Sbjct  329  DADGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDK  388

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            + WG+DA EF+PERF EG+ KAT  +  F PF  GPRICIGQNFA++E KMAMAMILQRF
Sbjct  389  DHWGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRF  448

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FELSPSYAH+P + +T++PQ+GA +I+H L
Sbjct  449  WFELSPSYAHSPCTTMTLRPQHGAQIILHKL  479



>ref|XP_003617766.1| Cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
 gb|AET00725.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=516

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G   N GM+IE +I EC LFYFAGQETTS +LVWTMVLLSR+P+WQARAREEVL +FG+K
Sbjct  302  GNNVNVGMNIEDVIQECKLFYFAGQETTSTLLVWTMVLLSRYPEWQARAREEVLQIFGNK  361

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KP+F+GLN+LK+VTMILYE +RLY P+  L R   +  KLG + L  GV + +P +L+H 
Sbjct  362  KPNFDGLNNLKIVTMILYEVMRLYPPIIELSRNVEKNVKLGNLTLSAGVEVFMPIILLHH  421

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WG+DAK F PERF  GI KATNG+ +FFPF  GPRICIGQNF+L+EAKMAM +ILQ
Sbjct  422  DCELWGDDAKMFNPERFSGGISKATNGRVSFFPFGWGPRICIGQNFSLLEAKMAMTLILQ  481

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSF+LSP+YAHAP + + ++PQYGA +I+  L
Sbjct  482  HFSFQLSPAYAHAPATVIALKPQYGAHIILRKL  514



>ref|XP_011460847.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Fragaria vesca subsp. vesca]
Length=523

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
              ++ GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL +   WQ RAREEVL +FG  K
Sbjct  312  NNKDVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQIWQDRAREEVLQIFGMNK  371

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GL  LKVVTMIL E LRLY  V  L R T +E +LG+  LP GV + LPTLLIH D
Sbjct  372  PDFDGLTHLKVVTMILLEVLRLYPAVVVLSRTTHKEIQLGKFSLPAGVEVGLPTLLIHHD  431

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WG+DAKEF+PERF EG+ KAT G+ +FFPF  GPRICIGQNFA++EAK+A+A+ILQ 
Sbjct  432  KELWGDDAKEFRPERFSEGVSKATKGQLSFFPFGAGPRICIGQNFAMMEAKLALALILQH  491

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMH  134
            F+FELSPSY HAP++ +T+QPQYGAP+I+H
Sbjct  492  FTFELSPSYTHAPFNLITLQPQYGAPIILH  521



>emb|CDX75784.1| BnaC03g38670D [Brassica napus]
Length=508

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 171/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G T+  G++ E+II++C LFYFAGQETTSV+L WTMVLLS+  DWQA  REEV+ VFG
Sbjct  294  NSGETKGNGLTTEEIIEDCKLFYFAGQETTSVLLTWTMVLLSQHQDWQAWVREEVMQVFG  353

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            D+ PD EG+  LKV+TMILYE LRLY PV  + R   +E KLG+M +P GV +++P LLI
Sbjct  354  DRDPDLEGIKQLKVMTMILYEVLRLYPPVIQMNRAIHKEIKLGDMAIPAGVQVNIPVLLI  413

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG+DA EFKPERF++GI KAT  +  F PF  GPRICIGQNFAL+EAKMA+A+I
Sbjct  414  HRDTKLWGDDAAEFKPERFKDGISKATKNQVCFLPFGWGPRICIGQNFALLEAKMALALI  473

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSY HAPY+ +TI PQ+GA LI++ L
Sbjct  474  LQRFSFELSPSYVHAPYTVITIHPQFGAHLIINKL  508



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 172/216 (80%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMSIE +I+EC LFYFAGQETTSV+LVWTM+LL+R P WQ +AREEVL VF
Sbjct  303  QEQGDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            GD KPD +GLN LKVVTMIL+E LRLY  V  L R   ++T+LG+++LP G  ++LP LL
Sbjct  363  GDSKPDSDGLNRLKVVTMILHEVLRLYPAVVALGRSVPKDTRLGKLLLPAGAEITLPVLL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH D E+WG+DA EF P+RF EG+ KAT  +  +FPF  GPRICIGQNFAL+EAKMA+AM
Sbjct  423  IHHDQELWGDDAHEFNPDRFSEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            IL++F FELSPSYAH+P + +T++PQ+GA +I+H L
Sbjct  483  ILRQFWFELSPSYAHSPCTNITLRPQHGAHIILHKL  518



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 165/213 (77%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GMSIE +I+EC LFY AGQETT+ +LVWTMVLLS + +WQ RAR EV  +FG+K
Sbjct  309  GNNKNIGMSIEDVIEECKLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGNK  368

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD++GLN LKVVTMI  E LRLY PV    R   +ET+LG + LP GV+L LP +LIHL
Sbjct  369  KPDYDGLNRLKVVTMIFNEVLRLYPPVNMFGRIIRKETRLGNLTLPEGVMLGLPVVLIHL  428

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D E+WGEDA EF PERF EGI KAT    AF PF  GPRICIGQNFA++EAKMA+++ILQ
Sbjct  429  DPELWGEDAHEFNPERFSEGISKATKNPSAFIPFGWGPRICIGQNFAMIEAKMALSIILQ  488

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            RFSFELSPSY HAP + LT QPQ+GA +I+H L
Sbjct  489  RFSFELSPSYTHAPIAVLTTQPQHGAHIILHKL  521



>ref|XP_010465358.1| PREDICTED: cytochrome P450 72A13-like isoform X1 [Camelina sativa]
Length=512

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G T+   MS E +++EC LFYFAGQETT+V+LVWTM+ LS+  DWQARAREE   VFGDK
Sbjct  300  GQTKGNRMSTEDLMEECKLFYFAGQETTTVLLVWTMIQLSQHQDWQARAREEAKQVFGDK  359

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            +PD EG+N LK +TMILYE LRLY PV  + R   +E KLG+M LP GV +++PTLL+  
Sbjct  360  EPDAEGINQLKFMTMILYEVLRLYPPVFQMSRAIHKEMKLGDMTLPGGVHVTVPTLLVQR  419

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            DTE+WG DA EFKPERF++G+ KAT G+  FF F+ GPRICIGQNFA++E KMAMA+ILQ
Sbjct  420  DTELWGNDAGEFKPERFKDGLSKATKGQVPFFSFAWGPRICIGQNFAMLETKMAMALILQ  479

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FSFELSPSY HAPY+ LTI PQ+GAPLI+H L
Sbjct  480  KFSFELSPSYLHAPYTVLTIHPQFGAPLILHKL  512



>gb|KCW67651.1| hypothetical protein EUGRSUZ_F01398 [Eucalyptus grandis]
Length=350

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +I+EC LFY AGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  141  NVGMSLHDVIEECKLFYIAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  200

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY P+  L RK   ETKLG++ +PP V L +PTLLIH D E+
Sbjct  201  DGLSHLKIVTMILNEVLRLYPPLTELWRKVPTETKLGKLTIPPEVQLLMPTLLIHHDKEL  260

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA++MILQ+F+F
Sbjct  261  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALSMILQQFTF  320

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP + L +QP+YG  +I+  
Sbjct  321  ELSPSYAHAPSNVLILQPRYGVQVILRK  348



>ref|XP_009135391.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
 emb|CDX82473.1| BnaA03g33480D [Brassica napus]
Length=508

 Score =   297 bits (761),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G T+  G++ E+II++C LFYFAGQETTSV+L WTMVLLS+  DWQA  REEV+ VFG
Sbjct  294  NSGETKGNGLTTEEIIEDCKLFYFAGQETTSVLLTWTMVLLSQHQDWQACVREEVMQVFG  353

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            D+ PD EG+  LKV+TM+LYE LRLY PV  + R   +E KLG+M +P GV +++P LLI
Sbjct  354  DRDPDLEGIKQLKVMTMLLYEVLRLYPPVIQMNRAIHKEIKLGDMAIPAGVQVNIPVLLI  413

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG+DA EFKPERF++G+ KATN +  F PF  GPRICIGQNFAL+EAKMA+A+I
Sbjct  414  HRDTKLWGDDAAEFKPERFKDGVSKATNNQVCFLPFGWGPRICIGQNFALLEAKMALALI  473

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +QRFSFELSPSY HAPY+ +TI PQ+GA LI++ L
Sbjct  474  VQRFSFELSPSYVHAPYTVITIHPQFGAHLILNKL  508



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 171/212 (81%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GM+++++I+EC LFYFAGQETTS +LVWT++LLS+  DWQ RAR+EV  VFG KK
Sbjct  304  GDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDRARDEVQQVFGSKK  363

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+FE LN LKV+TMIL E LRLY P   L R T E TKLGE+ LP GV L LP +L+H D
Sbjct  364  PEFEDLNHLKVITMILNEVLRLYPPGVMLGRMTTETTKLGELTLPAGVQLLLPAILLHHD  423

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
            ++IWG+DAKEFKPERF EGI+KAT G+  +FPF  GPRICIGQNFA VE+K+A+AMILQR
Sbjct  424  SKIWGDDAKEFKPERFSEGILKATKGQLTYFPFGWGPRICIGQNFATVESKLALAMILQR  483

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP YAHAP++ +T+QPQ+GA LI+  L
Sbjct  484  FSFELSPLYAHAPHTIITLQPQHGAQLILRKL  515



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +++EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  + RK  +ETKLG++ +PP V L +PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP + +T+QP+YG  +I+  
Sbjct  481  ELSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_010060782.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+  +++EC LFYFAGQETTSV+LVWTMVLLS   DWQARAREEVL +FG  KPD 
Sbjct  301  NVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQARAREEVLQIFGSGKPDP  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E LRLY PV  + RK  +ETKLG++ +PP V L +PTLLIH D E+
Sbjct  361  DGLSHLKIVTMILNEVLRLYPPVTEMTRKVPKETKLGKLTIPPEVQLLMPTLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF EG+ KAT  + +FFPF  GPRICIGQNFAL+EAKMA+AMILQ+F+F
Sbjct  421  WGEDAEEFKPERFAEGVSKATKNQVSFFPFGWGPRICIGQNFALIEAKMALAMILQQFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSYAHAP + +T+QP+YG  +I+  
Sbjct  481  ELSPSYAHAPSNVITLQPRYGVQVILRK  508



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G +  GMS++++I+EC LFYFAGQETTS +L W+M++LS+  DWQARAREEVL VFG+ +
Sbjct  302  GNKKFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQARAREEVLQVFGNNR  361

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD++ LN LKVVTMI+ E LRLY P+  + R+  +ETKLG + LP GV L LPT+++H D
Sbjct  362  PDYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHKETKLGNLSLPGGVQLLLPTIMLHHD  421

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             EIWGED KEF PERF EG+ KAT GK A+FPFS GPRICIGQ+FA+++AKMA+AMILQ 
Sbjct  422  QEIWGEDVKEFNPERFSEGVNKATKGKFAYFPFSWGPRICIGQHFAMLQAKMALAMILQH  481

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ++F++SPSYAH PYS LT+QPQ+GA LI+H L
Sbjct  482  YAFDVSPSYAHVPYSVLTLQPQHGAQLILHKL  513



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 171/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  G+S + +IDEC LFYFAGQETTSV+L+WTMVLLS+  DWQA AREEVL VFGDK
Sbjct  324  GNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVFGDK  383

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GLN LK+V MI YE LRLY P+  L R   +ETK+G+++LP   +++L TLL+H 
Sbjct  384  KPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHH  443

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D ++WG+DAKEFKPERF EGI KAT  + ++FPF+ GPRICIGQNFALVEAKMAMAMILQ
Sbjct  444  DKKLWGDDAKEFKPERFSEGISKATKNQVSYFPFAWGPRICIGQNFALVEAKMAMAMILQ  503

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELS SY HAP++ + +QPQ+GA LI+  L
Sbjct  504  NFSFELSASYVHAPHAFIFLQPQHGAHLILRKL  536



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
            +++ G++  ++I+EC LFYFAGQET SV+LVWTM+LLS  P+WQARAREEVL VFG++KP
Sbjct  307  SKDFGITTIEMIEECKLFYFAGQETASVLLVWTMILLSLHPEWQARAREEVLQVFGNEKP  366

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            + EGL+ LK++TMIL+E+LRL+  V    R+   E KLGE+ LP GVLL +PT+LIH D 
Sbjct  367  NSEGLSHLKIMTMILHETLRLFPSVPTYRRRNKHEVKLGELSLPAGVLLIIPTILIHYDK  426

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            E+WGEDAKEFKPERF EG+ KAT G+ +F PF GGPR+CIGQNFA++EAKMA+AMILQ+F
Sbjct  427  ELWGEDAKEFKPERFSEGVSKATKGQVSFIPFGGGPRVCIGQNFAMMEAKMAIAMILQKF  486

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            SFELSPSY HAP   + I PQYGAPL++  L
Sbjct  487  SFELSPSYTHAPLVTINIHPQYGAPLLLRKL  517



>ref|XP_010470433.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   297 bits (760),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
              G  +  G+SIE++I+EC LFY AGQ TTSV+LVWTMV+LS+  DWQ RAREEV  V G
Sbjct  298  NTGQAKGNGLSIEEVIEECKLFYIAGQVTTSVLLVWTMVMLSQHQDWQVRAREEVKQVLG  357

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+PD EGLN LK + MILYE LRLY PV  L+R T +E KLG++ LP GV +SLP +L+
Sbjct  358  DKEPDTEGLNQLKFIKMILYEVLRLYPPVVQLMRATEKEMKLGDLTLPAGVQISLPIMLV  417

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
              DTE+WG DA EFKPERF++G+ KAT  + +FF F  GPRICIGQ+FAL+EAKMAMA+I
Sbjct  418  QRDTELWGNDAAEFKPERFKDGLSKATKNQLSFFAFGWGPRICIGQHFALLEAKMAMALI  477

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LQRFSFELSPSY HAPY  +TI PQ+GAP+I+  L
Sbjct  478  LQRFSFELSPSYVHAPYEAMTINPQFGAPVILQKL  512



>gb|KHG18227.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   297 bits (761),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 168/211 (80%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             ++ GMSIE +I+EC LFYFAGQETTSV+LVWTMVLL+R+PDWQ +AR+EVLHV GD+KP
Sbjct  305  AKHMGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLARYPDWQTKARDEVLHVLGDRKP  364

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D +GLN LKVVTMILYE LRLY PV  L R   +E K+G ++LP G  + +P L IH D 
Sbjct  365  DADGLNRLKVVTMILYEVLRLYPPVVSLARSIPKEIKVGHLLLPAGTEVLIPILQIHHDK  424

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            + WG+DA EF+PERF EG+ KAT  +  F PF  GPRICIGQNFA++E KMAMAMILQRF
Sbjct  425  DHWGDDAHEFRPERFAEGVSKATKSQVTFLPFGWGPRICIGQNFAMMEVKMAMAMILQRF  484

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FELSPSYAH+P + +T++PQ+GA +I+H L
Sbjct  485  WFELSPSYAHSPCTTMTLRPQHGAQIILHKL  515



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   299 bits (766),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 166/213 (78%), Gaps = 1/213 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G  N GMSI  +I+EC +FYFAGQETT+V+LVWTM+LL  +  WQ RAR EVL VFG+ K
Sbjct  375  GNVNLGMSINDLIEECKIFYFAGQETTAVLLVWTMILLGSYTKWQDRARAEVLQVFGNNK  434

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVE-ETKLGEMVLPPGVLLSLPTLLIHL  407
            PDF+GLN LK+VTMIL E LRLYSP + L RK V+ ETKLG    P GV+LS P +LIHL
Sbjct  435  PDFDGLNRLKIVTMILNEVLRLYSPASVLSRKLVKRETKLGNFTFPSGVMLSFPVILIHL  494

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D EIWGEDA EF PERF EG+ KAT  +  FFPF  GPRICIGQNFA++EAK+A+++ILQ
Sbjct  495  DKEIWGEDANEFNPERFAEGVSKATXNQTGFFPFGWGPRICIGQNFAMIEAKIALSIILQ  554

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSPSY HAP S LT QPQ+GA +I+H L
Sbjct  555  HFSFELSPSYTHAPISILTTQPQHGAHIILHKL  587



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  G+S + +IDEC LFYFAGQETTSV+L+WTMVLLS+  DWQA AREEVL V GDK
Sbjct  306  GNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAHAREEVLQVLGDK  365

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GLN LK+V MI YE LRLY P+  L R   +ETK+G+++LP   +++L TLL+H 
Sbjct  366  KPDFDGLNRLKIVQMIFYEVLRLYPPLPVLSRYVEKETKIGDLILPAESVIALQTLLVHH  425

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D ++WG+DAKEFKPERF EGI KAT  + ++FPFS GPRICIGQNFALVEAKMAMAMILQ
Sbjct  426  DKKLWGDDAKEFKPERFSEGISKATKNQVSYFPFSWGPRICIGQNFALVEAKMAMAMILQ  485

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
             FSFELSPSY HAP++ + +QPQ+G  LI+  L
Sbjct  486  NFSFELSPSYVHAPHAFIFLQPQHGVYLILRKL  518



>ref|XP_010064521.1| PREDICTED: cytochrome P450 72A14-like [Eucalyptus grandis]
 gb|KCW67637.1| hypothetical protein EUGRSUZ_F01382 [Eucalyptus grandis]
Length=413

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N GMS+ ++I+EC LFYF GQETTSV+LVWTMVLLS   DWQARAREEVL VFG +KPDF
Sbjct  204  NVGMSLHEVIEECKLFYFVGQETTSVLLVWTMVLLSAHSDWQARAREEVLQVFGSRKPDF  263

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
            +GL+ LK+VTMIL E L LY PV  L  K  +ETKLG++ +PPGV LS   LLIH D E+
Sbjct  264  DGLSQLKIVTMILNEVLWLYPPVILLECKVHKETKLGKLTIPPGVQLSASPLLIHRDKEL  323

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA +F+PERF EG+ +AT  + +FFPF  GPRICIGQNFAL+EAK+A+AMILQRF+F
Sbjct  324  WGEDADDFEPERFAEGVSRATKNQVSFFPFGWGPRICIGQNFALIEAKIALAMILQRFTF  383

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
             LSPSY H P++  T+QPQYGA +I+H 
Sbjct  384  ALSPSYVHGPFTVFTLQPQYGAQIILHK  411



>ref|XP_010535012.1| PREDICTED: cytochrome P450 72A13-like [Tarenaya hassleriana]
Length=510

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 169/215 (79%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G ++  GMSIE+++ EC LFYFAGQETTSV+LVWTM+LLS+  DWQARAREEV+ V G
Sbjct  296  NSGQSKGNGMSIEEVMQECKLFYFAGQETTSVLLVWTMILLSQHQDWQARAREEVMQVLG  355

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            D+KPD + LN LKVVTMILYE LRLY P   L R   +ETKLG++ LP GV ++LP LLI
Sbjct  356  DRKPDIDSLNQLKVVTMILYEVLRLYPPATQLSRAVHKETKLGDLTLPGGVHVALPILLI  415

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
              D E+WG DA EFKPERF++GI KAT  + +F PF  GPRICIGQNFAL+E+K A+A+I
Sbjct  416  QRDVELWGSDAGEFKPERFKDGISKATKNQVSFLPFGWGPRICIGQNFALLESKTALALI  475

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            L+RFSFELSPSY HAPY+  T+ PQ+GA L++  L
Sbjct  476  LRRFSFELSPSYVHAPYTVFTLHPQFGAHLVLRKL  510



>ref|XP_009790241.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790242.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790243.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790246.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790247.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790248.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009790249.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=458

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             +  GMS++++I+EC LFYFAGQETTS +L W+M++LS+  +WQARAREEVL VFG+ KP
Sbjct  248  NKKFGMSMDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSEWQARAREEVLQVFGNNKP  307

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D++ LN LKVVTMI+ E LRLY P+  + R+   ETKLG + LP GV L LPT++++ D 
Sbjct  308  DYDMLNQLKVVTMIIQEVLRLYPPLLLMGREVHTETKLGNLSLPSGVQLLLPTIMLYHDQ  367

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            EIWGED KEF PERF EG+ KAT GK A+FPFS GPRICIGQNFA++EAKMA+AMILQ +
Sbjct  368  EIWGEDIKEFNPERFSEGVNKATKGKFAYFPFSWGPRICIGQNFAMLEAKMALAMILQHY  427

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +F++SPSYAH PYS LT+QPQ+GA LI+H L
Sbjct  428  AFDVSPSYAHVPYSVLTLQPQHGAQLILHKL  458



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFY AGQETTSV+L+WTMVLLS+  +WQ  AREEVL VF
Sbjct  300  QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTHAREEVLRVF  359

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY PV+ L+R    ++++G + LP GV ++LP LL
Sbjct  360  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPVSMLLRTVFADSQVGGLYLPDGVQIALPILL  419

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H D EIWGEDAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  420  LHHDHEIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  479

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S LT  PQYGA LI+H L
Sbjct  480  ILQRFSFELSPSYAHAPISLLTTHPQYGAHLILHGL  515



>emb|CBI39929.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFY AGQETTS +L+WTMVLLS+  +WQARAREEVL VF
Sbjct  241  QENDERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSNWQARAREEVLRVF  300

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY P   L R    ++++G + LP GV ++LP LL
Sbjct  301  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPAPMLTRAVFADSQVGGLYLPDGVQIALPILL  360

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH D +IWG+DAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  361  IHHDDKIWGDDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  420

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S LT+QPQ+GA LI+H L
Sbjct  421  ILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  456



>emb|CBI39938.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFYFAGQETTSV+L+WTMVLLS+  +WQARAREEVL VF
Sbjct  241  QENDERKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQARAREEVLQVF  300

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD +GLN LK+VTMI +E LRLY P + LIR    ++++G + L  GVL++LP LL
Sbjct  301  GNKKPDGDGLNHLKIVTMIFHEVLRLYPPASMLIRTVFADSQVGGLYLSDGVLIALPILL  360

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH + EIWGEDAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  361  IHHNHEIWGEDAKEFNPGRFSEGVSKAAKTQVSFFPFGYGPRICVGQNFAMMEAKMALAM  420

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSF+LSPSYAHAP S L +QPQ+GA LI+H L
Sbjct  421  ILQRFSFDLSPSYAHAP-SSLLMQPQHGAHLILHGL  455



>ref|XP_004168302.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 166/212 (78%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
             +++ GMSI+ +I+EC LFY AGQETT+ +L+WTMVLLS + DWQ RAR EV  +FG+KK
Sbjct  312  NSKDVGMSIQAVIEECRLFYIAGQETTATLLIWTMVLLSSYSDWQERARAEVFEIFGNKK  371

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PD++GLN LKVVTMI  E LRLY PV+ L R T +ETKLG M LP G++LSLP +LI  D
Sbjct  372  PDYDGLNRLKVVTMIFNEVLRLYPPVSMLGRTTRKETKLGNMTLPGGIMLSLPIILIQRD  431

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDA EF PERF EG+ KAT    AF PF  GPRICIGQNFA++EAKMA++MILQ 
Sbjct  432  PELWGEDAHEFNPERFSEGVFKATKNPGAFMPFGWGPRICIGQNFAMIEAKMALSMILQH  491

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY H P++ LT QPQ+GA +I+H L
Sbjct  492  FSFELSPSYTHTPFAALTTQPQHGAHIILHKL  523



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 171/216 (79%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMSIE +I+EC LFYFAGQETTSV+LVWTM+LL+R P WQ +AREEVL VF
Sbjct  303  QEQGDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTKAREEVLEVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            GD KPD +GLN LKVVTMILYE LRLY     L R   ++TKLG+++LP G  ++LP LL
Sbjct  363  GDSKPDSDGLNRLKVVTMILYEVLRLYPAGVALGRSVPKDTKLGKLLLPAGAEITLPVLL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH D E+WG+DA EF P+RF EG+ KAT  +  +FPF  GPRICIGQNFAL+EAKMA+AM
Sbjct  423  IHHDQELWGDDAHEFNPDRFSEGVSKATKSQVIYFPFGWGPRICIGQNFALMEAKMALAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            IL++F FELSPSYAH+P + +T++PQ+GA +I+H L
Sbjct  483  ILRQFWFELSPSYAHSPCTFITLRPQHGAHIILHKL  518



>ref|XP_009135394.1| PREDICTED: cytochrome P450 72A15-like [Brassica rapa]
Length=512

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVW M++LS+  DWQARAREEV  VFG
Sbjct  298  NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWIMIMLSQHQDWQARAREEVKQVFG  357

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+P  EGLN LKV+TMILYE LRLY P   L R   +E KLG++ LP GV ++LP LL+
Sbjct  358  DKEPATEGLNQLKVMTMILYEVLRLYPPAVQLTRAIHKEMKLGDLTLPGGVQINLPILLV  417

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG DA EFKPERF++G+ KAT G+ +FFPF+ GPRICIGQNFAL+E KMA+A+I
Sbjct  418  HRDTQLWGNDAAEFKPERFKDGVSKATKGQVSFFPFAWGPRICIGQNFALMEIKMALALI  477

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            L++FSFELSPSY HAPY+ +T+ PQ+GA LI++ +
Sbjct  478  LKKFSFELSPSYVHAPYTVITMHPQFGAHLILNKI  512



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 169/211 (80%), Gaps = 0/211 (0%)
 Frame = -2

Query  760  TRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKP  581
             +N GM+I+++I+EC LFYFAGQETTSV+LVWT++LLS+  DWQ RAREEV  VFG  KP
Sbjct  306  NKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQERAREEVRQVFGSNKP  365

Query  580  DFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDT  401
            D+E L  LKVVTMI  E LRLY P   + R   EETKLG + LP G+LL LP + +H D 
Sbjct  366  DYETLKQLKVVTMIFNEVLRLYPPGIMIGRTVHEETKLGNLSLPAGMLLMLPAIWLHHDN  425

Query  400  EIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRF  221
            EIWG+DAKEFKPERF EG+ KAT GK A+FPFS GPRICIG NFA++EAKMA+AMILQ +
Sbjct  426  EIWGDDAKEFKPERFGEGVNKATKGKFAYFPFSWGPRICIGLNFAMLEAKMAVAMILQHY  485

Query  220  SFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +FELSPSYAHAP++ +T+QPQ+GAPLI+  L
Sbjct  486  AFELSPSYAHAPHTIITLQPQHGAPLILRKL  516



>ref|XP_010060773.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67635.1| hypothetical protein EUGRSUZ_F01380 [Eucalyptus grandis]
Length=510

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -2

Query  754  NXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDF  575
            N  MS+  +I+EC LFY AGQETTS +LVWTMVLLS  PDWQARAREE+L  FG +KPDF
Sbjct  301  NVRMSLHDVIEECNLFYVAGQETTSALLVWTMVLLSVHPDWQARAREEILQTFGSRKPDF  360

Query  574  EGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTEI  395
             GL+ LK+VTMIL E LRLY PV  + R   +ETKLG++ LP GV LS+P LLIH D E+
Sbjct  361  GGLSHLKIVTMILNEVLRLYPPVTIMARNVHKETKLGKLTLPSGVQLSVPVLLIHHDKEL  420

Query  394  WGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSF  215
            WGEDA+EFKPERF +G+ KAT  + +F PF  GPRIC+GQNFA++EAKM++AMILQRF+F
Sbjct  421  WGEDAEEFKPERFADGVSKATKNQVSFLPFGWGPRICVGQNFAMIEAKMSLAMILQRFTF  480

Query  214  ELSPSYAHAPYSKLTIQPQYGAPLIMHN  131
            ELSPSY HAP   LT+QPQYGA +I+H 
Sbjct  481  ELSPSYVHAPCIALTLQPQYGAQVILHK  508



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   295 bits (756),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +N GMSI+ ++DEC LFY AGQETTSV+LVWTMVLL+R PDWQ +AREEV  VF D 
Sbjct  308  GDRKNMGMSIQDVVDECKLFYIAGQETTSVLLVWTMVLLARNPDWQTKAREEVFQVFSDG  367

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPD +GL+ LKV+TMIL E LRLY PV  L R   ++ KLG+++LP G ++S+P LLIH 
Sbjct  368  KPDPDGLSHLKVMTMILNEVLRLYPPVVMLGRSMAKDMKLGKLLLPAGAVISIPVLLIHH  427

Query  406  DTEIWGEDAKEFKPERFREGIMKAT-NGKPAFFPFSGGPRICIGQNFALVEAKMAMAMIL  230
            D EIWG+DA EF+PERF EG+ KAT + + AFFPF GGPRICIGQNFAL+EAKM +AMIL
Sbjct  428  DQEIWGDDAHEFRPERFAEGVSKATKSNQLAFFPFGGGPRICIGQNFALMEAKMVLAMIL  487

Query  229  QRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            +RF FELSPSYAH+P + +T++PQ+GA LI+H L
Sbjct  488  KRFRFELSPSYAHSPITVITLRPQHGAHLILHKL  521



>gb|EYU44092.1| hypothetical protein MIMGU_mgv1a0044501mg, partial [Erythranthe 
guttata]
Length=390

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 170/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+ +++++EC LFY AGQETTS ++VWT+VLLS++P+WQ +AREEVL  FG++ 
Sbjct  179  GNKSFGMTTDEVVEECKLFYLAGQETTSALIVWTLVLLSQYPEWQMKAREEVLQNFGNQT  238

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+F+GLN LK+V MIL E LRLY PVA L R+  EETKLG + LP GV +SLP + +H +
Sbjct  239  PEFDGLNHLKIVNMILNEVLRLYPPVAALGRRVTEETKLGRLTLPAGVDVSLPIMFLHHN  298

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             +IWGEDA EFKPERF EG+ KA  G+  FFPF  GPRIC+GQ FA++EAK+AM+MILQR
Sbjct  299  RDIWGEDAMEFKPERFSEGVSKAQKGQAIFFPFGWGPRICVGQMFAMLEAKVAMSMILQR  358

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSP Y HAP++ +TIQPQ+GA L++H L
Sbjct  359  FSFELSPLYTHAPHNFITIQPQHGAHLVLHKL  390



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 170/212 (80%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GM+  ++I+EC LFYFAGQE  SV+LVWTM+LL   P+WQ RAREEVL V G+++
Sbjct  306  GNKDFGMTTTELIEECKLFYFAGQEGNSVLLVWTMILLCLHPEWQVRAREEVLQVLGNER  365

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            P+ EGLN L +VTMIL E+LR++ PVA   R+  +E KLGE+ LP GVLL +PT+LIH D
Sbjct  366  PNLEGLNRLHIVTMILNETLRVFPPVAMFRRRIKDEVKLGELSLPAGVLLFIPTVLIHYD  425

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             ++WGEDA EFKPERF EG+ KAT G+ +FFPF  GPRICIG NFA++EAKMA+AMILQ 
Sbjct  426  KKLWGEDANEFKPERFSEGVSKATKGQASFFPFGRGPRICIGLNFAMMEAKMALAMILQN  485

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSYAHAP++ ++ QPQYGAPL+M  L
Sbjct  486  FSFELSPSYAHAPFAVVSTQPQYGAPLLMRKL  517



>ref|XP_010241316.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 168/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q  G  +N GMSI+++I EC LFYFAG+ETTS++L WTM++LS   +WQ RAREEVL VF
Sbjct  303  QEHGNLKNVGMSIDEVIGECKLFYFAGRETTSILLTWTMLVLSMHSEWQLRAREEVLQVF  362

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G  KPDF  LN LK+VTMILYE LRLY PV  + R T ++ KLGE+ LPPGV LSLP +L
Sbjct  363  GKNKPDFNELNQLKIVTMILYEVLRLYPPVFRISRWTYKKIKLGEIFLPPGVELSLPIIL  422

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            +H   E WG+DA+EFKPERF  G+ KAT  +  FFPFS GPRICIGQNFAL+  KMA+AM
Sbjct  423  LHHSIEFWGDDAQEFKPERFAGGVSKATKNQVTFFPFSWGPRICIGQNFALMVVKMALAM  482

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSP+Y HAP + LT+QPQYGA +++H L
Sbjct  483  ILQRFSFELSPTYCHAPCTVLTLQPQYGAQILLHKL  518



>emb|CDX82471.1| BnaA03g33500D [Brassica napus]
Length=512

 Score =   295 bits (754),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 172/215 (80%), Gaps = 0/215 (0%)
 Frame = -2

Query  772  TAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFG  593
             +G  +   MSIE +++EC LFYFAGQETTSV+LVW M++LS+  DWQARAREEV  VFG
Sbjct  298  NSGQAKGNEMSIEDVMEECKLFYFAGQETTSVLLVWIMIMLSQHQDWQARAREEVKQVFG  357

Query  592  DKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLI  413
            DK+P  EGLN LKV+TMILYE LRLY P   L R   +E KLG++ LP GV ++LP LL+
Sbjct  358  DKEPATEGLNQLKVMTMILYEVLRLYPPAVQLTRAIHKEMKLGDLTLPGGVQINLPILLV  417

Query  412  HLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMI  233
            H DT++WG DA EFKPERF++G+ KAT G+ +FFPF+ GPRICIGQNFAL+E KMA+A+I
Sbjct  418  HRDTQLWGNDAAEFKPERFKDGVSKATKGQVSFFPFAWGPRICIGQNFALMEIKMALALI  477

Query  232  LQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            L++FSFELSPSY HAPY+ +T+ PQ+GA LI++ +
Sbjct  478  LKKFSFELSPSYVHAPYTVITMHPQFGAHLILNKI  512



>emb|CBI39917.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 169/216 (78%), Gaps = 0/216 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            Q     +N GMSI+ +I+EC LFY AGQETTSV+L+WTMVLLS+  +WQA AREEVL VF
Sbjct  241  QENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQACAREEVLRVF  300

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
            G+KKPD + LN LK+VTMI +E LRLY PV  L R    ++++G + LP GV ++LP LL
Sbjct  301  GNKKPDGDDLNHLKIVTMIFHEVLRLYPPVPMLTRAVFADSQVGGLYLPDGVQIALPILL  360

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAM  236
            IH D +IWGEDAKEF P RF EG+ KA   + +FFPF  GPRIC+GQNFA++EAKMA+AM
Sbjct  361  IHHDDKIWGEDAKEFNPGRFSEGVSKAAKSQVSFFPFGYGPRICVGQNFAMMEAKMALAM  420

Query  235  ILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            ILQRFSFELSPSYAHAP S LT+QPQ+GA LI+H L
Sbjct  421  ILQRFSFELSPSYAHAPISLLTMQPQHGAHLILHGL  456



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   294 bits (753),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  757  RNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPD  578
            +  GM+ ++I++EC LFYFAGQETT+V+LVWTM+LLS +PDWQ  AREEVL  FG   PD
Sbjct  304  KEFGMTTKEIVEECKLFYFAGQETTAVLLVWTMILLSMYPDWQEHAREEVLQHFGTNIPD  363

Query  577  FEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLDTE  398
            F+GLN L++VTMIL+E LRLY P   L +   EETKLG +  P G LL++PT+L+H D E
Sbjct  364  FDGLNRLRIVTMILHEVLRLYPPFPILGQTVAEETKLGNLTFPSGQLLTVPTILLHHDPE  423

Query  397  IWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFS  218
            IWGED KEFKPERF +G+  AT G+  FFPF  GPRICIGQNFA++EAK+ +AM LQRFS
Sbjct  424  IWGEDVKEFKPERFADGVSHATKGQVVFFPFGWGPRICIGQNFAMLEAKLVLAMALQRFS  483

Query  217  FELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FELSPSY+HAPYS +T+QPQ+GA LI+H +
Sbjct  484  FELSPSYSHAPYSAVTLQPQFGAHLILHKM  513



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -2

Query  763  GTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKK  584
            G ++ GMSIE++I+EC LFYFAGQETTSV+LVWT+VLLSR  DWQ +AREEVL VFG +K
Sbjct  307  GNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQAREEVLQVFGSRK  366

Query  583  PDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHLD  404
            PDF+GLN LKVVTMILYESLRLY P+  L R+  E+  LGE+ LP GVL+SLP +L+H D
Sbjct  367  PDFDGLNHLKVVTMILYESLRLYPPLITLNRQVNEDIVLGELSLPAGVLVSLPVILLHHD  426

Query  403  TEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQR  224
             E+WGEDA +F PERFREG+  AT G+  +FPFS GPRICIGQNFA++EAKMA+ MILQ 
Sbjct  427  EEVWGEDANKFNPERFREGLSSATKGQVTYFPFSWGPRICIGQNFAMLEAKMALCMILQS  486

Query  223  FSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            FSFELSPSY HAP + +T+QPQ+GAPLI+H L
Sbjct  487  FSFELSPSYTHAPKAIVTMQPQFGAPLILHKL  518



>gb|KJB26994.1| hypothetical protein B456_004G270700 [Gossypium raimondii]
Length=521

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = -2

Query  775  QTAGGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVF  596
            +  G  +N G+SI+ ++DEC LFY AGQETTSV+LVWTMVLL+R PDWQ +AREEVL VF
Sbjct  305  EEQGDRKNMGLSIQDVVDECKLFYIAGQETTSVLLVWTMVLLARNPDWQTKAREEVLQVF  364

Query  595  GDKKPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLL  416
             D KPD +GL+ LKV+TMIL E LRLY PV  L R   ++ KLG+++LP   ++S+P LL
Sbjct  365  SDGKPDPDGLSHLKVMTMILNEVLRLYPPVVMLGRSVAKDMKLGKLLLPARAVISIPVLL  424

Query  415  IHLDTEIWGEDAKEFKPERFREGIMKATN-GKPAFFPFSGGPRICIGQNFALVEAKMAMA  239
            IH D EIWG+DA EF+PERF EG+ KAT   + AFFPF GGPRICIGQNFAL+EAKMA+A
Sbjct  425  IHHDQEIWGDDAHEFRPERFAEGVSKATKRNQLAFFPFGGGPRICIGQNFALMEAKMALA  484

Query  238  MILQRFSFELSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            MIL+RF FELSPSYAH+P + +T++PQ+GA LI+H L
Sbjct  485  MILKRFRFELSPSYAHSPITVITLRPQHGAHLILHKL  521



>gb|AJD25172.1| cytochrome P450 CYP72A331 [Salvia miltiorrhiza]
Length=516

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 172/208 (83%), Gaps = 2/208 (1%)
 Frame = -2

Query  748  GMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDKKPDFEG  569
            GMS+ ++IDEC LFY AGQETTS +LVWTM+LLS+ PDWQARAR+EVL V G  +PDF+ 
Sbjct  309  GMSLREVIDECKLFYLAGQETTSALLVWTMILLSKHPDWQARARDEVLQVLGSHEPDFQE  368

Query  568  LNDLKVVTMILYESLRLYSPVAGLIRKTV-EETKLGEMVLPPGVLLSLPTLLIHLDTEIW  392
            L+ L++VTMI +E +RLY P A ++R+T+ +ET LG + LP GV L LPTLL+  D +IW
Sbjct  369  LSRLQIVTMIFHEVMRLY-PGAAILRRTIHKETTLGNVSLPAGVNLFLPTLLLQHDCKIW  427

Query  391  GEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQRFSFE  212
            GEDAKEF PERFREG+ KAT G+  ++PF GGPRICIGQNFA+++AKMA+A+IL+ +SFE
Sbjct  428  GEDAKEFNPERFREGVSKATRGQLXYYPFGGGPRICIGQNFAMLQAKMALALILKHYSFE  487

Query  211  LSPSYAHAPYSKLTIQPQYGAPLIMHNL  128
            LSPSYAHAPY  L++QPQYGAPLI+H L
Sbjct  488  LSPSYAHAPYLVLSVQPQYGAPLIIHRL  515



>ref|XP_008345110.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=300

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 167/211 (79%), Gaps = 0/211 (0%)
 Frame = -2

Query  766  GGTRNXGMSIEQIIDECILFYFAGQETTSVMLVWTMVLLSRFPDWQARAREEVLHVFGDK  587
            G  +  GMS+  +I+EC LFY AGQETTS +LVWTM+LL ++ +WQ  AREEVL VFG  
Sbjct  88   GSNKKVGMSMHDVIEECKLFYLAGQETTSGLLVWTMILLGQYQNWQDHAREEVLEVFGSN  147

Query  586  KPDFEGLNDLKVVTMILYESLRLYSPVAGLIRKTVEETKLGEMVLPPGVLLSLPTLLIHL  407
            KPDF+GL  LKVVTMIL+E LRLY  +A + R T ++T+L    LP GV ++LPTLL+H 
Sbjct  148  KPDFDGLIHLKVVTMILHEVLRLYPALALIARITSKKTQLANYSLPAGVEVALPTLLVHH  207

Query  406  DTEIWGEDAKEFKPERFREGIMKATNGKPAFFPFSGGPRICIGQNFALVEAKMAMAMILQ  227
            D ++WG+DA+EFKPERF EG++KAT  K  +FPF GGPRICIGQNFA+VEAK+A+++ILQ
Sbjct  208  DKQLWGDDAQEFKPERFSEGVLKATKNKFTYFPFGGGPRICIGQNFAMVEAKLALSLILQ  267

Query  226  RFSFELSPSYAHAPYSKLTIQPQYGAPLIMH  134
             ++FELSPSY HAP S LTI+PQ+GA +I+H
Sbjct  268  HYTFELSPSYTHAPSSHLTIRPQFGAHIILH  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520